4F8YA

Complex structure of nadph:quinone oxidoreductase with menadione in streptococcus mutans
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
196
structure length
196
Chain Sequence
MKILIVYTHPNPTSFNAEILKQVQTNLSKEHTVSTLDLYAEHFDPVLQFNETHKRRDLAKVAEMEKYRDLVTWADHLIFIFPIWWSGMPAILKGFIDRVFVADFAYSYKKVGLEGHLQGKSAWIITTHNTPSFAMPFVQDYGKVLKKQILKPCAISPVKLTELTSIEKISDDERQKLLHKVAQITRNILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH Quinone Oxidoreductase
publication title Complex structure of NADPH:quinone oxidoreductase with menadione in Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Oxidoreductase
total genus 65
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f8yA00
3NLLA 2QR2A 1QR2A 3K1YA 2Z98A 2GSWA 4Y9UA 4ZVLA 2N1MA 5NULA 2BF4A 5LBTA 2B3DA 3U7RA 6NULA 5ULLA 5LMCA 1DX9A 3FJOA 4FGJA 1RTTA 4C14A 3TZBA 3N39C 3W7AA 3OX1A 1B1CA 2V5VA 4GI5A 3F90A 2KQUA 1X77A 3NHWA 4ZVMA 1JA0A 3K20A 4QOJA 4H2DA 3OX2A 3B6KA 3W78A 4QODA 3QFCA 3L9XA 1FLNA 1XI2A 1J9GA 4GR9A 5EMNA 1TLLA 4OXXA 2Z9DA 2X2OA 1CZKA 5A4KA 3B6IA 5F12A 4NULA 5F51A 1YRHA 1J9EA 3GAMA 3JSXA 4BMOB 3HA2A 3NHUA 5LVAA 1WSBA 1CZLA 4BMPB 4ICIA 1T5BA 2M6RA 3NHRA 3KEGA 2Q9UA 1D04A 1DXQA 3OWHA 5LBUA 4YAUA 5LJIA 1AG9A 1OBVA 3F6SA 1F4PA 4FGKA 1GG5A 1ZX1A 2OHIA 1CZNA 3U7IA 1T0IA 2BPOA 4QOHA 2Z9CA 3NHFA 1FUEA 3FNIA 3N3AC 4HS4A 4QOGA 2Z9BA 5EAIA 3ESZA 2R97A 1AKQA 2V5UA 3R6WA 3UXHA 2QX9A 1QRDA 2QX4A 1AKVA 4N65A 2FZ5A 3W77A 1XYYA 1AZLA 4PTZA 3FVWA 4U7FA 4YAFA 5FA6A 3LCMA 1JA1A 1TIKA 1FVXA 5JROA 2OYSA 1AKTA 3B6JA 2QX6A 1CZUA 4M0CA 3SVLA 3OWXA 3QE2A 3TE7A 4C0XA 3GFRA 4H6PA 1NNI1 2FLVA 3GFSA 4LAFA 2HNAA 4N9QA 2OHJA 1I1OA 3NFRA 5NLLA 1AKWA 2X2PA 1RLJA 4DILA 2ZKIA 3F6RA 4C76A 4YAOA 1WSWA 3RPEA 3NHKA 1CZHA 1AMOA 2FDXA 4XDGA 3KAQA 2ARKA 3NHYA 2FAXA 2MOKA 5LJLA 4XDHA 2F1OA 1ZWLA 4YALA 4S24A 3OJWA 3L9WA 4Y9RA 2A5LA 4PTYA 3O2NA 4FX2A 1YCFA 3EYWA 1QHEA 1SG0A 2OHHA 2MT9A 4DY4A 1C7EA 2BN4A 2W5UA 1BVYF 5LLDA 1QBGA 5EA2A 3P0RA 1J8QA 1BU5A 1H69A 1CZOA 2FCRA 1RLIA 2QX8A 4Y7CA 1KBQA 4F8YA 5FX2A 2AMJA 1YOBA 3W79A 1C7FA 3O73A 3TEMA 3NHJA 3ESXA 1OBOA 1SQSA 3OJXA 2FX2A 1AKUA 3ES9A 2HPVA 1YDGA 2QMYA 2MWMA 1AHNA 3HLYA 4LTDA 1E5DA 2XOEA 3LT5A 2QWXA 2XODA 4GQIA 4LTNA 3OX3A 4J8PA 4LA4A 2R96A 3NHPA 2FVXA 3G5MA 1XT6A 1YCHA 2Q62A 1D4AA 4ZVNA 1VMEA 3N3BC 4ZVKA 2MTBA 4CETA 4ESEA 1FLDA 1RCFA 4R81A 1FLVA 2QMZA 4FGLA 3KLBA 3NHLA 2FZVA 4N82A 2BZSA 3HR4A 1FTGA 4YAWA 2BMVA 1CZRA 5B3KA 3FW1A 3F2VA 3KAPA 3UXEA 5TGZA 4CF6A 1FLAA 1V4BA 3NHSA 3FX2A 4QOFA 4C0WA 1YCGA 4PU0A 1H66A 2KLBA 1KBOA 5FUQA 2HNBA 3QFRA 4YQEA 3GFQA 4DIKA 4U7GA 3B6MA 2M6SA 3ZHOA 4QOIA 4NLLA 1D03A 1FX1A 2D5IA 5BUCA 3OVMA 1ZWKA 4QOEA 4D02A 3S2YA 4HEQA 2FOXA 2RG1A 1DXOA 1YKGA 1AKRA 1J9ZA 3ESYA 2V9CA 4LTMA 2WC1A 4U7HA 5B3LA 1OFVA 5F4BA 3EDOA 3D7NA 1XYVA
chains in the Genus database with same CATH superfamily
3ENVA 1BWPA 3ELYA 4IHQA 3P2EA 5IT5A 1VLLA 2QRNA 4FN4A 1R2QA 1ZN8A 4I55B 5LYJA 4QYIB 3W5UA 1FU8A 3R75A 1I3OA 3HN6A 4FDTA 4CCYB 5K0NA 4FYYA 3CPHA 2GSWA 2P6MA 4HAWA 1II8B 1N5MA 4RACA 3QWFA 5TMDA 1ZUWA 1RCUA 5IFLA 2QW8A 1L7EA 2R2AA 5HBGA 1YJ8A 3W2TA 1J4AA 4AIRA 5BYAA 3O31A 4BOYA 3WNDA 3AR2A 1JQKA 4QRDA 3DV2A 3ECCA 3IV6A 5FR2A 1Z8HA 4PN3A 3JD3A 4N7RA 1JZSA 2X23A 3CRQA 4U63A 4DWWA 1EHYA 2BCGY 3KEFA 1EVJA 1AOXA 1BE1A 1GQYA 2W2LA 3JAKB 3SVTA 4YROA 1A9OA 4L75A 1Z0SA 2PGLA 4ZYLA 3EGIA 3O8BA 1H22A 4DMUB 4GH5A 2A78A 4BBJA 3GT3A 1IZZA 4KLCA 2I6TA 4A0HA 5HKKD 1KYZA 4UKDA 3DTVD 4KRFA 3H7AA 2ZAYA 2PUJA 3E7FA 3QLVC 3HUFA 3ZHUA 1J5XA 1QIHA 4CLHA 3TGPA 1SUDA 2HHAA 3V4RA 4ACAA 4AB1A 3N39C 1XA3A 1XCLA 1ZS9A 4GL2A 2R84A 1R4NB 1ZMTA 2WA2A 3EEFA 4K9KA 4KVFA 3RVSA 2E3JA 1MJNA 5TJ9A 4I9FA 4OI4A 5ESRA 5C1IA 4JKYA 1DARA 3S1LA 3I9OA 3I12A 4L9WA 4OCZA 3U5TA 4UCQA 5F1KA 2L0XA 2X1VA 5CDFE 5HNKA 3OF2A 1JLHA 1JBEA 3CURA 4QU9A 3CZ9A 5AKEA 1POXA 3OPMA 5AO9A 4S0ZA 5EPUA 1KI7A 3Q12A 1ZITA 4AG3A 1QNLA 2AGVA 2E4WA 4JL8A 1E2FA 2EZUA 3TKLA 5CD1A 4KYTA 1QRRA 3R0IA 4OH7A 1CEYA 1J5EB 1UKAA 4J0KA 2XQGA 3AJ9A 2HKIA 4G5XA 1IBRA 1EYZA 1UBJS 2C2XA 5KVCA 4CEIB 1KR5A 3FOBA 4N7JA 4NU0A 4NOJA 4KI0A 4HRXA 5LUBA 3IDOA 5KQRA 4OXRA 4DDVA 4PCAA 1TOAA 1YS9A 2E2WA 1PQUA 2JFZA 4TKLA 4KE9A 4XCVA 4V24A 3OI7A 5DW0A 2CF6A 3TLJA 4AZ0B 1QCDA 1YRLA 4QNNA 4X1IB 4ZO6A 4ZD6A 4G41A 5K9ZA 2XGJA 1JIJA 1W2GA 4LF4B 1Q95A 4PY2A 5A62A 4H7HA 4M8KA 3UQZA 4YFVA 4EK9A 1KO8A 3BG5A 3EZGA 3LHKA 4XM0A 5D00A 1BW9A 2HZBA 5DE3A 3V1LA 2VSNA 2WF8A 4CIXA 3RK4A 4MW7A 4FNGA 2OCXA 2X0IA 1X1CA 3E3OA 3UQYS 3P97A 1WCIB 2VRNA 4K6CA 5IP5A 1IL0A 3NM6B 4G5OA 3TDMA 3FETA 3TNFA 1N6IA 3K4HA 2BY4A 2F3RA 1LBIA 4GMXA 4U5QA 3P4YA 4NC9A 5AKZA 3VJKA 4Z4HA 4AI6A 3HA2A 3DLAA 5LVAA 3PSHA 3VYRB 3HJHA 1LCIA 4EGJA 4FCWA 1G1MA 3L1UA 4FLEA 1PZFA 4P7JA 5I4KA 4Q4AA 5CIQA 1Z4NA 4JUIA 4KWTA 1I94B 3TRKA 4XD2A 3SYNA 1NN3A 1GCOA 4MARA 1A8IA 1JIKA 1G21A 1XVVA 2VXCA 4J90A 1CYEA 1Z4MA 2B25A 5H16A 3T4UA 4CMKA 5C18A 3PL5A 1FX0B 5H7XA 4I1PA 4MV1A 1OZ0A 2WJAA 5DTQA 5K09A 4O8CA 4OBXA 1L5GB 1MB2A 1A5TA 3AOEA 4YRFA 5DB4A 1LRKA 4DOMA 3MWKA 5C31A 3WKDA 3FKSA 1S2IA 4KAFA 4C4ZA 3PR3A 1S7CA 2Q9UA 4TV9F 5KYGA 4AZ3B 2P2YA 2ZZNA 1KIAA 3R44A 2BEKA 4XIIA 1T9CA 2EYUA 3GRKA 4DYHA 1H42A 3BSSA 1KQFA 3E61A 4ZQHA 3H3JA 4YAUA 1P2DA 3O3OB 1E6EA 5LJIA 3MSCA 3R7FA 2QG6A 1WEKA 2QRLA 5SY4A 2PJZA 3F96A 4D9FA 4FGKA 1UXGA 1OC4A 1E63A 2ZCVA 4YDQA 4TXMA 5FBVB 3AR5A 1I4WA 5T57A 2TECE 4NBKA 1PJLA 1O94A 1T1EA 2XRMA 1TDJA 4OIMA 4PBTA 3U7IA 1IVNA 1KAMA 1HLPA 3V1YA 4RZQA 4JUCA 3CBGA 4WZAB 4BP3A 5JWOA 1N92A 1VJ5A 4A6DA 3DCYA 4OU4A 4BO8A 3EA0A 3I9MA 3W3AA 4AW9A 4NEHB 2QTVA 2A35A 3WGZA 1PFGA 5EAIA 4YRSA 4E70A 5C80A 2CBZA 4ZQEA 3R4VA 3CS3A 1GY8A 1L5NA 4OIFA 1FDSA 1Z2CA 1JBKA 2ST1A 3H9UA 3QKSA 4G1BA 2YW2A 2H48A 2XE8A 1DC4A 4L15A 5G4KB 4TM8A 3X1KA 2PA3A 4PTZA 5HF9A 5LZ8A 3F73A 1LLFA 2G08A 5F2NA 2QGZA 2ZSHA 4MQEA 3IIKA 5KSYA 2XDAA 2RGUA 5ALXA 4RD1A 2OXIA 4CQMD 1B4DA 1BXZA 1DS6A 4N4AA 4Q4CA 2W93A 4FYPA 1CDDA 1DL5A 2HHJA 3T9EA 3ZWVA 4YCCA 1U99A 2WIKA 3DZIA 3HVUA 3LQQA 4YWHA 2FPGA 4HWPA 1Z25A 4F06A 5HPYB 3U40A 2DR0A 2OBMA 4BZXA 5EKDA 1I2DA 3OPYI 1RXEA 3UTDA 2BGTA 1V7PC 1SCBA 4RJ2A 4RUKA 2WQ6A 4YJFA 1C80A 2X1MA 3E4CA 3LW8A 1PR4A 1BWRA 2IXGA 3AR6A 3M4YA 3KZXA 4KAXA 3K8ZA 4Z4CA 2AXEA 2ZDHA 4QATA 4B45A 1ODFA 3OWXA 3V7YA 3H84A 1N1EA 3OT1B 2PX0A 4OD0A 3NW9A 1E89A 5IC5A 2ZI7A 2ZB7A 2PGXA 4H4CA 1R0ZA 4M1TA 3KZNA 3RFVA 5FEMA 1DPFA 2BCJQ 3A4NA 1AH2A 3MMXA 1ZH8A 4NZPA 3LK6A 2WVJA 4HI0E 4W4TA 3LWBA 3RG8A 3V3KA 4HVCA 5K0CA 1ZSYA 1DJQA 1TZCA 2GPNA 2JHAA 4OB6A 2PYDA 2AEFA 5CYOA 4HXYA 3FSJX 2CMGA 1KDRA 2FR0A 3LFTA 3WK7A 4XWAA 3ZDDA 3N53A 4ZTBA 4MLDA 4P5EA 1Q0QA 3UAGA 5T7BA 5JBQA 2QAGA 3OCJA 4H6VA 1JR6A 1JBQA 2JJ1A 4PPQA 2I78A 4DYDA 4E1BA 3LNCA 5LMUB 1OA1A 1DJNA 2FWBA 3HCPA 1NT4A 3CLUD 4Q48A 4XUGB 5AK5A 1YMUA 3IE1A 1UBMS 1CYDA 3V1NA 2PLRA 4KCGA 4KE7A 1RRKA 4RHXA 1XZDA 2NO1A 2EP8A 3JWPA 2QD3A 2JGMA 2P3LA 2RI0A 2ZLBA 2WZBA 1QG0A 3OD5A 4IDPA 4IQ8A 3GYGA 4M9RA 4KSCA 4R1PA 5F3WB 4IFBA 3SSNA 2DULA 3ZVRA 4AAYA 2ZBDA 5AW4A 1WDLA 4KE8A 2D5CA 1SC4A 2NYAA 1RYBA 5JANA 3EBPA 1R6BX 3I3OA 2VTBB 3HDYA 4AJPA 2WSBA 1DEKA 3C39A 4IG9A 4YRDA 1U2DA 4PAGA 5I9SA 3JQ7A 5LOVA 4FSHA 5T6MA 2Y27A 2O2HA 3S29A 3OP1A 5EN4A 3B7PA 5EHNA 1QHEA 2QQFA 4WZZA 3G6WA 5SY9A 1NHWA 2DQKA 2AUTA 1HZZC 4IVRA 3IP8A 2G1AA 4KWEA 5DCUA 4RDHA 2W2XA 1ZCJA 2I54A 3AWIA 4NFHA 5IJ0A 2SCUA 1IMJA 1EA7A 1EWTA 2PD3A 3AF2A 2Z1DA 3QU9A 3SZMA 3GLGE 3SN6A 1CUAA 1SELA 2ZR9A 1JDVA 4GECA 3D0KA 5DU2A 1QVWA 2O57A 4JWKA 2MSCB 3ZE6A 1IYZA 1M2OA 3PQ4A 2FRDA 4J7XA 3JQAD 3O4VA 3OQ6A 5CVDA 3TTTA 1VCNA 2O59A 3OOHA 3IAAA 4WK6A 3U49A 2VQSA 4OPMA 1KE1A 4DRXB 4AY6A 2IDKA 2FCRA 4NWIA 3RYHB 4IS2A 3F78A 4BNDB 2GM3A 1I6MA 3FNGA 5ISMA 5K03A 1FU4A 5DWDA 4ERXA 2IHNA 1DGQA 1H0RA 4FFVA 5THXA 4B76A 1BKDR 1VE3A 3CVWA 5B6PA 1BEUB 3IBYA 2B8WA 1C1DB 2FJUA 2H1FA 4GRAA 3HDHA 3TQRA 1TQHA 1QHHB 4Y8VA 1CV2A 1CQJB 5EOVA 5KQMA 1OBOA 1TMKA 2EFCB 3ZKAA 2O3UA 2BFFB 4UCXA 5REQB 4C5BA 2JARA 4L74A 4I3GA 4BVJA 3N8DA 1QK4A 3ES9A 3DKIA 1G8FA 3DZHA 4I6JA 3VKVA 1DXYA 1NSTA 4NDZA 5EIOA 1SO8A 4HLUA 2FMHA 2GEDA 4ZAYA 2FGJA 3GQBB 5LQMA 5GOTA 3GEEA 4LTDA 3OJEA 4Y2JA 4ANFA 3P1JA 4C3VA 3HG7A 2VWPA 2E1PA 2N3ZA 1V71A 1VJ0A 2QL6A 4CL8A 3IKMB 3CNOA 5FV7A 3WWPA 1CUWA 4G3XA 3BWMA 4PNZA 3TW8A 1R74A 1EIWA 5KU1A 3OBBA 1NAIA 4X00A 3L0BA 4MKIA 1FFBA 1HT1E 4XXHA 2R9VA 1XMJA 1VLJA 2DERA 3WY9A 4GQIA 3IUMA 5SZIA 5EJ6A 3PF9A 1YA6A 2FMFA 2PFSA 3LYAA 1N7JA 5BWBA 1KARA 1MO6A 2FN8A 1TM1E 2W6NA 3ACCA 4KO3S 1QF9A 1J2RA 5FORA 4JQYA 3TDKA 2B61A 4I4LA 2E5FA 4E0BA 3DDZX 4DMRA 4JJGA 1MHTA 3H2BA 1A8UA 5FP0A 4UU8A 4X3PA 2QT1A 3NUQA 2BSAA 2QLNA 3SIXA 3AUKA 3UJDA 3E1SA 5AR1A 4CLRB 4KQMA 3HWRA 1GCGA 5L3SB 4OHKA 2A33A 2PO7A 2ZXUA 2DG2A 3ZD9A 2C57A 1BMTA 5IZCC 4K9NA 1A7AA 2Q41A 2ZE6A 2EU8A 1SFRA 5T4BA 4I99A 2WB2A 1E3DA 3DYVA 4LHYA 3LP6A 1TO2E 2BGKA 3IEIA 4MUHA 3VC7A 4CETA 2FG6C 5H5JA 4ITVA 4HHEA 2JDID 5L4NA 5HIJA 2GAAA 3AVXA 6REQA 2VPWA 4UM9B 4JB2A 4BEBA 1E9AA 3NORA 1XF1A 3ND5A 5LL6P 3NXSA 1TGVA 2DFLA 3G85A 4YRGA 3IC5A 1BOFA 1X9HA 2JCXA 4N6GA 4PANA 4Q7JB 2X14A 4KSBA 1X80A 2AFHB 4LWPA 3T5TA 1GQRA 2ESRA 2Y68A 3K9QO 4LW8A 2R7AA 1HL3A 2YZGA 5DBHX 1NE7A 3DOHA 5L3RA 5CGZA 4JQCA 1EI9A 2GF0A 2IYYA 1BS9A 3DEKA 5CG2A 2GBLA 1ISGA 3FCOA 2NAPA 1P9OA 1VPVA 1I1HA 4FZJA 4IYJA 4DR5B 4A2WA 3N74A 3O2JA 1SK8A 2Q4OA 4BDSA 4UEOA 2GO7A 2RGNA 1HSOA 3DYBA 4OMUA 4RK1A 2VWHA 4DZZA 4BP9A 1JNYA 4EB6B 4ZCMA 1UAAA 2RCNA 3G2MA 4HEA6 3F98A 5K3DA 4U5XA 3BXGA 3T9CA 3V4FA 3BD7A 1AF7A 1N6KA 2G28A 5DYGA 4IWNA 2DE0X 2N0SA 3ECSA 3EFOB 2HJSA 4NVRA 3SQDA 5A0VA 1Z45A 4RH1A 3DE7X 1W0KA 2P1RA 4Q4LA 2IUTA 5CK4A 3H2JA 5CMLA 2OYCA 2YYSA 4BNGA 2HT1A 1FDRA 2QY6A 5CBPB 3Q9SA 4HSGA 2G1UA 2A0WA 3IQZA 3QE4A 1YQQA 4L2IA 4URWR 5J4KA 2JIBA 2ZWVA 1PFYA 2L42A 4R83A 4BJ1A 5K0SA 1IC6A 4JA0A 1PKXA 1TU3A 3PPYA 3KQWA 5E95A 5E6UA 4E1AA 5KYUA 4C4AA 3A0UA 4RY9A 2XUDA 1KO1A 1L5HA 1U0FA 2F3TA 5HG0A 2PRJA 1SOWA 2P8JA 4GOLD 5B5SA 3TF5A 3R09A 1CF4A 3AUTA 5J40A 1IN1A 4LXUA 4B3TB 2I62A 1GQSA 1YUNA 1I0LA 1PT7A 2AC2A 1MFZA 5DX8A 3VYSB 3M0EA 4NMLA 3PCXA 2KJQA 1A04A 5IK2D 2QBYA 2ZIWB 1PAUA 5J9FA 5JPIA 3NX4A 2EBUA 3D4NA 1X87A 4FXOA 2LDBA 2PZFA 2QE7D 2XQKA 3GPLA 2VAPA 3ZQ6A 3RGWS 2IKQA 4KO4S 1RI4A 2ERCA 1NQOA 1Z35A 3O9VA 3KB8A 4KO8A 4ARZB 1Y4ZA 4BLWA 1QRUA 4X1YB 4B8WA 2WHPA 4LNAA 3I92A 5EHZA 1NVVQ 3ZEIA 4DXDA 1RQ7A 1WY7A 5A02A 3S2YA 2Q0SA 2ZVJA 3U4QA 2J45A 4M46A 2LRHA 3IPAA 4GVLA 4CNBA 3CX3A 2HK9A 1G2PA 4DLZA 1NNLA 5G1NA 4REOA 4X8MA 3ZQJA 4DQXA 5FR1A 3DS8A 5LYJB 1M2FA 4RS3A 1JSXA 5CJPA 3SHQA 1RWOA 2ZJFA 3P9RA 2WV9A 4D9MA 4IUCS 3IV7A 3W1VA 3BGOS 1KI9A 5B4VA 1MDFA 5ALNA 5C34B 1Y6ZA 3CKLA 1NW6A 3HB4X 3CRZA 4PC2A 1OYOA 5E2AA 4EAAA 5L53A 5CXSA 2PXAA 2VNKA 4S2EA 1G3RA 3KTAA 5A0FA 4MA0A 3QQPA 5AXAA 1FDVA 3GFOA 4OP2A 5EIBD 5KPJA 3E18A 3T9FA 5IU6A 5TMPA 4DPLA 4MUBA 3JVEA 3PFWO 3X1ZA 5F7ZA 4NU6A 4NV0A 1OVMA 5FFMA 4EA7A 3QYFA 1Q11A 3ZZUA 3VO8A 3IPYA 1VHWA 3RU3A 5J1SB 3OOYA 4YREA 3WFJA 3KJZA 4JJEA 3KLPX 4EOGA 5E7JA 4G01B 4D2IA 3STVA 5CUQA 2QT9A 4I50A 3QXHA 1DZ3A 1K27A 1Z5GA 2VP5A 3KSUA 2YBDA 1MC4A 3IURA 5CLLA 4YRKA 4LXYA 4WERA 4XCQA 3UWKA 4C4OA 3BH6A 4Q66C 2BWJA 4RHYA 2ZT7A 1A8SA 1J06A 2RMKA 4YRCA 1T13A 3D54D 4RPCA 5TGDA 4MUMA 3NANA 1KEEA 4X6YA 5FPHA 1AUQA 2F6RA 2ZG6A 4JQSA 3FN4A 3RVMA 3T41A 5GINE 5GIOE 2JGRA 4L6IA 4Q03A 4BYGA 3UMMA 3K6SA 3QJ5A 4TS3A 3W5CA 4IGAA 4DM3A 4M0DA 4IEFB 4RF3A 3WFIA 3QMWA 1PNTA 3SC3A 3IVRA 4YUZA 2IZ0A 2XXAA 3G9TA 5CDYA 5J2TB 4ER5A 4AS1A 4GPAA 4GWGA 4C07A 3WZLA 3ZWOA 2A9JA 2VHJA 3FAZA 1O03A 3IUSA 4NONA 3R5XA 1K6IA 4AJ4A 1I32A 1P4RA 3BH7A 2ZREA 4F9TA 2I9KA 1E2LA 4JHLA 2CLIB 1EVEA 1YE3A 4RD4A 3T54A 3EC2A 1WUHS 5FWNA 2GPWA 1A2BA 3UJBA 5KQSA 2MCFA 2P6OA 3QI7A 3HVIA 3VMFA 4K5QA 3EX7C 3HFGA 4LHEA 4BNYA 3RSFA 1H6AA 1RPTA 1KMMA 2I3BA 4QU0A 3C8MA 1CHDA 2CVPA 4QXPA 4B1FA 1O0CA 3TCKA 1W46A 2F8MA 3AU9A 3AHIA 1ZRNA 1I7PA 4DEXA 2I9PA 3U5ZB 4B80A 2NUTA 4O2BF 4KGDA 1GADO 1G8AA 3NJ4A 4H3KB 4ZWNA 2WMDA 4QODA 3K0EA 1V6AA 3EZYA 3L7BA 5EIFA 2WYHA 1KL7A 1XI2A 2X7HA 1BW9B 1SUAA 3Q11A 3PLRA 1DKMA 2DY0A 2ISCA 1K7SN 1YZYA 3CEPB 2X2EA 2VJQA 1UAYA 3LUHA 5DV9A 3PNOA 2X2OA 3K9GA 3MLEA 5FOWA 1LDMA 5B30A 1KJNA 2H1CA 2ZCUA 1X74A 4OP3A 4PQYA 3PJRA 2OV4A 3DMNA 1U65A 5BY2A 5KDOA 4EW2A 1CW2B 1RKVA 3AZPA 3SS7X 3ANMA 5TS3A 3ND9A 3WRVA 3R3WA 1F8XA 2KLHA 4FUTA 4NFSA 3PICA 4Q4AB 3PXUA 4D6PA 2C5BA 1CJSA 2WU0A 4BNJA 5CA0F 4W8HA 4G0YA 2A9OA 1WOYA 1NOJA 1Q83A 1G21B 1YULA 1VJGA 1NN0A 2H06A 2I3AA 1Y1PA 2DQSA 2PSEA 3P0FA 1WG8A 4K3VA 4RIFA 3CLHA 5AI5A 4I3HA 5AW8A 3LW7A 2CNKA 2AR7A 2C8LA 5BVGA 2IIQA 3GGJA 3IJRA 5KX5A 2F8LA 3UT0A 4CM1A 4EG4A 4P82A 4DLRA 1S3SA 1TVKA 1UP7A 1QP8A 1V9CA 3GZTB 3LF1A 4S05A 3QLUC 3K5WA 4HFRA 4EB3A 3JY6A 4OTZA 3BS4A 4MRSA 4LRTB 2V1XA 3OZRA 4GPZA 4O4IA 3V1TC 1WZNA 3VOSA 1JKMA 4QEDA 3EGOA 1KQGA 3OKFA 1EJ6A 4M99A 4WSOA 1U3WA 2YXLA 3TRDA 3DHNA 1ZICA 3WYDA 1EFUA 2JIRA 3QKWA 4M86A 2PN1A 1BWQA 2Q9BA 1UOEA 3STUA 1LVHA 4FLFA 2QRQA 5KAPA 4UHCA 1U8CB 4I1VA 5JCXA 1RT9A 3OZDA 4UUOA 1DXQA 2FW6A 3T0FA 1PR2A 1L3IA 2FW8A 1GG2A 2CL0X 1HDCA 1TTQB 1J25A 4K9LA 4ZPXA 1PDOA 1YR2A 3DHYA 3ANTA 2C7RA 3T3EA 2FB9A 2GD1O 3FHJA 3FPCA 3GLTA 3H8WA 4P3PA 3RIMA 2XRZA 5FWYA 2X0EA 2QTVB 1SVUA 4PYIA 3FTFA 1NMQA 4M0KA 4FQ8A 5KPDA 1ZX1A 3JQBC 3EXHC 4D4LA 3GLHE 1I9CA 3QKSB 1V41E 2BJHA 1DC3A 2YWEA 3ZHSA 1AO0A 3SI7A 4D7AA 5BVHA 5A9RA 1T9BA 1W5SA 2FMXA 5CHYA 3GRUA 1AN0A 3C3CA 3MVEA 3C8DA 2OSVA 4MQEB 3DG9A 4H0NA 3VPAA 1A9SA 4GS5A 3WL3A 2Z57A 3L8DA 5CM8B 3GCWA 1MJHA 1T26A 1I1QB 3JRWA 3ONEA 2PO5A 2FPGB 3Q88A 4FKMA 4GIBA 2ODNA 4KMSA 3DDCA 3E15A 4UVEA 4FHCA 2AW3A 2C4VA 2Q3CA 2WRZA 3Q15C 2W22A 1TT7A 2XVMA 2YL2A 3TQSA 5A4DA 4YJFB 4BCCA 5BV0A 3GLFE 5EIXA 1E1YA 1WMSA 2CL6X 1KJYA 3EK2A 1ZM7A 1UXHA 2V7EA 3PPIA 3TOXA 1QORA 1J0DA 1A9RA 1MX5A 2XY4A 5FA6A 2ZJ0A 5FA8A 1H93A 1NFQA 1TIPA 4V2UA 3SXJA 4NYJQ 1APBA 4UAVA 4ZKEA 5D84A 3IIMA 3PFBA 3F8SA 3DB2A 4P3OA 2XKBA 3VZRA 1XLTA 2RJOA 3IAM1 5K8VA 3OIDA 5EJ8A 2Z56A 4QWMA 4EGCB 3E0XA 2AKAB 3CG0A 5G0TA 4JEUA 4N5LA 4XYBA 5FI0B 3CNLA 3IRUA 1UK6A 5BSKA 5TEWA 2QAGB 3EQ7A 2O2JA 5E6SA 1TRHA 3GJSA 2PRSA 1DO2A 3OJ0A 4FLMA 1SC3A 1YD7A 3ZJYA 4FIDA 1U5CA 2JFYA 1QE0A 4UHHA 4DQLA 1IOLA 2V7PA 4P92A 2I3GA 4PZPA 4WY2A 1NG9A 5C52B 2WR8A 3CH4B 5H1YA 5HDQA 4UHEA 3JZDA 4MKGA 4C76A 5JRJA 1AMNA 4DR4B 3NH6A 1LC0A 2JJYA 1JU4A 2AK2A 2ZPTX 3BAZA 1GUAA 4CMEC 4CG1A 1TADA 5JR3A 1E6CA 3FR8A 3JWEA 4EG5A 2B6NA 2OBXA 1J42A 4EY4A 1H6CA 2FZCA 2OGWA 1HSZA 2PNJA 9LDTA 2GNOA 4YCAA 5JEDA 2H5LA 3PEWA 3H9CA 1KDZA 4X0EA 4PC1A 2AMYA 3CPEA 5LOVB 3OIFA 3IAS6 1M34E 1ZAKA 3JQ7B 4DUGA 4NBVA 3RREA 3U4IA 4RMGA 2B3TA 2G72A 1BJTA 5JVDA 5DNWA 3NHZA 3U7EB 1QBKC 1CY4A 2ODPA 2VATA 1GQFA 4PS0A 4PVDA 5T4EA 2J9YB 4PX2A 3OSZA 5H3HA 4RGQA 4RF2A 3L8FA 4EELA 3GCGA 1J56A 2XA9A 5I51A 1PNQA 2JIQA 3DWEX 2ZQ5A 3BHNA 5IJ0B 2LTAA 3FWHA 2P9CA 4GBMA 2YV2A 3TLYA 4BFYA 4I9NA 3LJKA 3L8MA 1JIIA 1OHHA 1Y42X 1M2OB 4MKRA 1P4HA 2BTEA 3OPQA 1JN0A 2BFMA 2YXNA 3K05A 3QKUA 1ONOA 1XPRA 1H9AA 4ALJA 4CU2A 1R0SA 3A9UA 5CRIA 3GGDA 3V6MA 2EGGA 3GH1A 2YN0A 3TLMA 2D2IA 4DY4A 3IP5A 4EYOA 3ZHVA 1XZJA 4GEGA 4Q15A 2ENWA 2WI8A 1IPHA 1ATIA 3QRWA 1ODLA 4DQKA 1Z6AA 3DBRB 1PTJA 2Z1MA 3P0RA 3DAFA 4C4PA 4DC9A 2JBAA 5DGIA 2ROQA 3FJ1A 1OYYA 2D59A 5AKLA 3PDIA 3KPVA 3UA4A 5G2OA 4PVCA 3S68A 4H1VA 4UVDA 3T9AA 1AZSC 3C1UA 5TGTA 2CLSA 2FWJA 1RLIA 3ZI0A 1R4MA 3LVQE 1NXSA 2H51A 5ICMA 5FX2A 1UXIA 2IGTA 3SDZA 3IX7A 1X8JA 1V11A 3TUZC 4CM9D 2H2IA 1WMDA 3CRNA 1ZU5A 1O95A 4JC4A 4Q34A 1U1FA 2FMIA 3KWFA 1RBMA 2WD8A 1E6WA 4KIUA 3IP6A 4MKZA 4P81A 4PSDA 2Y71A 1IONA 1L5FA 2X8LA 1CUCA 1NYLA 1SC1A 1WNTA 1FEZA 2WWIA 3HE3A 3OPVA 5A3QA 2D7DA 2QTRA 5BYBA 3DLBA 4AF8A 4ME6A 1X1EA 3TW8B 4HNTA 2MSDB 2XNJA 5E9QA 3MXOA 1PR1A 3GA5A 2AK3A 3CMCO 5AHOA 2O3JA 1YS1X 1RYDA 3IR5A 1Y3AA 1FF9A 4UPDA 1JHUA 3RS4A 2BJWA 5L9AA 3PFFA 1SU7A 5AVXA 4HTFA 2WHYA 1S3GA 3GBPA 5EIAA 3LT5A 4M4SA 3DPIA 3BBPA 3OQBA 4PZ0A 3AL0C 4DQ0A 1SVIA 4AP6A 1RZUA 1SIBE 3GP3A 4UVIA 1N2EA 4BFWA 1YK0A 4CQJA 3THXA 3F3MA 1OY1A 2Z3VA 5T6BA 3WHPA 1E0AA 3QK7A 4LZWA 4C0SA 1N33B 1K8XB 4LTNA 3I53A 4CL2A 4I6EA 3W8FA 1A95A 1UBLS 3DTNA 1E18A 4KW7A 4UBLA 1M5RA 3ZJ4A 1H4QA 1EDOA 3DYIA 3NYQA 3LX5A 3WWDA 3OTQA 3A1NA 2ZJ2A 5SZHB 1FXSA 1HV8A 3DV0A 3CX4A 2RHGB 3M6AA 1PJ3A 3OX4A 1AQJA 3N7AA 3WA6A 3N2GA 2JB9A 5DYYA 3S99A 4JNKA 4F38A 4XGKA 4B46A 6REQB 1KJQA 2CZGA 1NV9A 3NPMA 1LX6A 2ZM5A 2Q62A 5HMMA 1GNPA 3ZNPA 1SBHA 2PKQO 2YV3A 3CX8A 1KZ7B 1ZA2A 2EJWA 1X80B 3NWEA 4KDEA 4CM4B 1BDBA 2AXNA 4KYUA 4GXRA 2O4UX 4E31A 3FGOA 4HF7A 3H1TA 3LDUA 3O21A 3WO0A 3W5SA 2C99A 4CKZA 2CDBA 3FTNA 3WBBA 1QZ3A 4MMYB 3FFWA 4BX3A 5HUQA 2YC2C 3WLSA 5DULA 3BDIA 4DBZA 3R23A 1X38A 1X8KA 5KNBH 1NVGA 3UWSA 4GGPA 2JCGA 1E77A 1YRBA 2C0CA 3KWJA 4MWSA 1E5XA 4U39A 2WD7A 1KK0A 4PAOA 1VSQA 1D3AA 1OR8A 1QKKA 2PGOA 4J1SA 5EZYF 3G5AA 1QV6A 3UMJA 1SPXA 3TRFA 1EUDA 3ORHA 2PZAA 4M76B 4II7A 1QLHA 5GY7A 3P9XA 4ZAWA 2F3UA 3TSOA 1JIXA 1JA9A 4US2R 1X1DA 1EVYA 4LYFA 1CQIA 4UBJA 4TWJA 4PZUA 3CF6R 4EENA 4EHIA 4Z4IA 4NCIA 1XLWA 1ZQ1A 2QUZA 4RL4A 4W5RA 2BRUC 1KEUA 1WO8A 2FFJA 4GPD1 4UHBA 1OV6A 2JLUA 4YUAA 4UEQA 2EJUA 2PS0A 3LC0A 2W6CX 2JIZD 1NAHA 1J00A 3OFSA 4Q9KA 4PZZA 4L2IB 3Q41A 2KBEA 3ZZNA 4UFPA 4GP9A 3WNZA 2G5CA 3EIHA 3R5TA 1F2UA 3AUAA 4Y2UA 4KHZA 4P7BA 5E6UB 1P6QA 5KYUB 3RUCA 2PGDA 4JJ4A 4IINA 3T34A 4X7BA 1J2UA 1L5HB 1RWMA 3O9MA 5J4LA 1ZVVA 2XNCA 2QD1A 2R3SA 1KBOA 3E58A 3R74A 1YZLA 1JLKA 1E7WA 2HA5A 1BFUA 2CUKA 5IT4A 1C8BA 2AYXA 3DKRA 4UE2A 1DP4A 1Z8FA 3F5MA 4WFIA 3TVDA 4JJIA 2QBYB 4EZBA 4YAGA 1CUVA 1USUA 3KVVA 2HRCA 4QZVA 2E1RA 2GEJA 3ZBPA 3TKYA 1JR3E 2Z5GA 4Y0NA 3W5DA 5FOVA 3R0VA 1CLUA 1NVVR 4HN2A 5ANRB 2Y3IA 4ZJYA 1IQPA 4PG4A 2IU0A 5LQAA 3HY4A 3SDBA 2ZSEA 4N3AA 5D01A 2WHPB 2C4HA 4ALKA 3CR7A 3D8UA 1JT9A 3I9V1 5LDHA 1U3GA 2AE1A 5DGDA 1Z7GA 3I01M 4XZ3A 3U4QB 1ZIPA 3RTAA 1KC3A 3PYXA 1E2MA 4HL6A 5AKYA 4KFTA 5GIPE 3QF7A 5BWLA 2GESA 3PZRA 3JYHA 2C77A 2JJ2D 3D6AA 3C85A 4FUQA 4UDNA 3SG0A 2G77B 2FDRA 3DMTA 3G49A 5TC4A 4CL0A 3K1TA 4JXJA 4GYJA 2DFVA 1Y1SA 5JRZA 1TPZA 3EQ9A 3KJIA 4QOEA 1LA2A 2ADFA 1RHJA 1NKTA 3FSGD 4CV2A 2B99A 2JL1A 4Q9HA 5JSFA 4GP7A 1ODTC 5GV7A 5IM4A 2HJRA 1JECA 3N0XA 3S4YA 1RQLA 3UGQA 2BMWA 3L92A 4IIFA 3NDJA 4V0SA 1JQBA 3HNRA 4CG2A 1SUEA 3R9XA 4A36A 3B8EA 5TT0A 2OCKA 3VPGA 2JVJA 3ILSA 3O8NA 3PRKE 2BHNA 3I0ZA 4WESA 1DADA 2GETA 3RRYA 4DR3B 3HH8A 1TKAA 3A4TA 1CFZA 3QBVA 1RWBA 5F4BA 5A4IS 4IRUB 1H8EA 2QLBA 4FU0A 1CUHA 1PS9A 3DR5A 5TLSA 2ZAIA 3NDBB 2JGKA 1I2ZA 3OCUA 1UP4A 2XPCA 1BVRA 2XITA 2YWFA 4I50B 1JS1X 2BF7A 1U6JA 2G17A 3AL3A 3I9V6 4R98A 5ES3A 2OV6A 5BSMA 1E6MA 2Z98A 1N6NA 3ETHA 3OU6A 1L4FA 1PGOA 1NSFA 1YR8A 2CXUA 2GCPA 4GU5A 3I28A 1KEEB 1G63A 2H1LA 3A4VA 4NZ9A 4LOKA 4Z0PA 4TV9A 2DECA 2UVDA 4LVUA 5ECGC 4HWKA 1SHLA 1WCWA 1TCVA 2ZSIA 5ES4B 5KNBD 3MW8A 2QR3A 3K6SB 3WP1B 4MWEA 3I61A 5E9AA 1TQ8A 4OUKX 3UH1A 2IZ7A 3E8SA 4HDCA 4BVGA 1E2JA 4G36A 1T9ZA 1Z13A 2C4MA 1YZTA 4QLAA 2XXAB 3L77A 2B2NA 1GPKA 1XRSB 2GCOA 1TAGA 3LL4A 4LXQA 4OL9A 4PINA 4RY2A 5LMCA 5F1YA 2CJYA 2JI4A 2RAFA 4UAUA 4JI3B 2QA5A 3K0CA 4OUDA 5ER9A 4JROA 5FAXA 1DPGA 5LWHA 4XGQA 3NAZA 4C08A 2VYNA 2Q2VA 1BJRE 2CUTA 5HIKA 1Y6RA 3N2ZB 3R4CA 2OQ2A 1KI1A 4R8RA 5HIIA 4Z7QB 3NC1C 3DP9A 4KNWA 5L3QB 5BWMA 4WLNA 4ZEWA 5C51B 1CS4C 1DBSA 4RZIA 2W71A 4AY5A 3MJ4A 4ZI3A 5A7FA 3AW9A 1ORTA 2HRBA 4GDMA 5I5GA 5LZ4A 1NDHA 5BRJA 4XJSA 1FZQA 1RXSA 1GRRA 3ZZTA 2NUTB 1ZR2A 5J5AA 3HFSA 1A27A 2H4HA 3TUJC 1MJGM 3L0OA 1U2QA 4DDKA 5EIBC 4O4HF 2BBWA 4AKTA 5JCZA 5AT1A 2X3YA 4HPWA 2C07A 2GZAA 3GRRA 3IOBA 3SEFA 1TA0A 4MUYA 1JSLA 4RMNA 3HUUA 4TLMB 1DKNA 4K9OA 4B34A 4WDRA 3X2EA 1KKLA 4AZWA 1VHDA 3HP7A 3K20A 2RAUA 4Y2HA 1KYWA 4JR0A 4U6NA 1SCNE 1CY8A 4CODB 2VPXA 1GD1O 1JDPA 3N0RA 4OQYA 1WMBA 3G2JA 3WJ1A 4CV3A 1RRVA 3LHIA 3GDGA 1RBZA 2QVZX 3ANSA 4FN5A 3HMQA 4ESVA 1G64A 3EB9A 3OWOA 4IY1A 4UD6A 1NPYA 2H5IA 3RAFC 3EVNA 3V4LA 1DJLA 2O14A 3FPBA 5EMNA 4EI7A 4ZCSA 1WS6A 1Z88A 2GZRA 2RGYA 2OGUA 3HA5A 2ZB3A 2AC7A 2IX9A 4I5DA 2EAUA 1OIWA 3PGXA 1ETHA 2Y6UA 1XMVA 3CTMA 3EW7A 4KI7A 4MWTA 4IS3A 1G5RA 1NDUA 1P1HA 2FMUA 4Y98A 2ZSFA 5BVGB 5KX5B 1YHNA 4TX1A 5ETJA 3B3QA 3ZR4B 2C8KA 2JJQA 4RFLA 5AXCA 4A5SA 4UARA 5HKLA 2RGAA 3U39A 1ZHFA 5F5LA 4ZTUB 1TVKB 2COKA 5KQPA 3MGCA 1C7QA 2Y1WA 3GH3A 4HXFB 5KWEA 1MABA 3AXTA 4GM4A 4O4IB 1DMSA 1U7UA 3FVVA 1Z6QA 1ABEA 2D5AA 1ABBA 4TMKA 4WH0A 3WGOA 1D0SA 3SP1A 3WRWA 5BQFA 2WJJA 2JRCA 3AHCA 1PTKA 3MJVA 2R8XA 4W9MC 1CZLA 2OV3A 1J22A 3NTLA 1E1QA 1PUXA 3EUAA 4N03A 1A4UA 3WISA 4EYQA 4ZAFA 3ROZA 3T7AA 1R8SA 2RGRA 4TTQA 1A5SB 3M3HA 5DEIA 4OQXA 3IP9A 5B6JA 3R9KA 1DVRA 1GPBA 2Q3DA 4NR0A 2RB4A 3ZWXA 5E3HA 5J5VA 4HDRA 5FWYB 1SVSA 1PR6A 2P4EA 1CD5A 3RSQA 2XNSA 2ISSD 3AY6A 1RHUA 3AR7A 2X6RA 3KB1A 3MTEA 2IA5A 2MR6A 4JGIA 5F64A 2QYHA 3BD6A 2WKSA 3A7EA 1JTVA 3H2IA 3AB7A 3C41J 3UUGA 1AQ6A 1YZHA 1D2CA 3H0KA 2OLEA 3RNOA 2R87A 4RBNA 4EKDA 3SVZA 5ALQA 4OHMA 4MRVA 5FRDA 1QO0D 3ACDA 3CH6A 3W8RA 4MKFA 1OX4A 3QWBA 4A8PA 2CNWD 4D8YA 2DUNA 3WKBA 2P1ZA 3BZUA 1VBMA 3OOSA 2GRUA 2J5BA 3V34A 1NA5A 2A58A 4FWIB 1P0MA 1X9IA 4JXXA 4CF3A 4HWSA 2Q46A 4QOHA 2VF2A 2RGXA 3F6YA 4JB3A 3MNFA 4ENVA 4M55A 5U4XA 3GFPA 1FUEA 2D3WA 4H0CA 3BFVA 5D85A 4MSUA 3CPJB 1WXFA 4PZYA 5AI4A 4JQOA 5KYNA 4MVJH 2OZVA 4OJKA 5IJ9A 1RHRA 2V45A 5ALDA 2ZQYA 4P4SA 4AT1A 3LTEA 2F4NA 3PFIA 3G82C 2P68A 3OUTA 2PV7A 5GVRA 5JAMA 4B71A 1WU7A 4TV8A 3AK4A 5FAKA 2WWGA 1GZVA 1TI7A 1S01A 3JD1A 3U7QA 3H75A 2QM8A 4GQBA 4G24A 1LUAA 4BZQA 1NQWA 3EF1A 3R41A 3TAXA 1VDMA 3HJRA 3Q3JB 3M89A 2QGNA 3SZRA 2Q4TA 2MYNA 2W6JA 5GOZA 3FPSA 1V8FA 3ZBQA 4OHVA 4F92B 2BGUA 1NUHA 1JG3A 2HQSA 5H4HA 5JFTA 2BGJA 3DOUA 2RC5A 5E6SB 3C7AA 2FX5A 2I22A 4MNTA 5JFGA 3GUUA 3FUCA 1E3WA 3KX2A 4OBEA 3TQCA 4DV7B 3ZDYB 1SVOA 2JANA 3N2NA 1DHTA 1LS1A 2JLZA 4BMYA 2ATVA 4CFSA 4QC2A 1C3JA 2ODBA 1UWVA 2Q3LA 3BRWA 4P22A 5EFZA 2RHMA 5BMVA 1MC1A 2NXEA 5BO5A 4LF8B 4PSCA 3I6BA 3L1VA 4X6XA 2FLVA 2NSYA 1FS6A 4FYWA 5I7FA 1XSEA 2GYWA 4RKWA 5F7XA 2ZBVA 5CCBA 3KSZO 3P71T 1NWHA 4GOND 5FBHA 1ZU4A 3ABOB 4BB9A 5CT9A 4RH0A 2ODTX 2QUAA 1I6KA 2EG9A 4PZAA 3TN7A 4Y0VA 2AW5A 2C88A 1HLGA 4I1YA 4BWFB 4HN9A 4FDVA 3T1QA 1E92A 1ISFA 1N6HA 1NBAA 5M04A 1ZUNA 2JVKA 2V7BA 1IRIA 1P2GA 5JVDB 1WKVA 4BECA 2CFSA 2GHIA 4ODIA 4DEYA 2HV9A 2NG1A 4CVNA 1YDWA 2WOJA 4G89A 2G6BA 4JI8B 4CW7A 1GPMA 2OO5A 3HGTA 1MF7A 3NUGA 5HP4A 3H86A 4CM8B 4EX7A 5HJ5A 4ZXFA 1E9SA 5BSTA 4WT7A 4YP5A 2UZIR 2PCJA 1DKUA 5BQPA 1SCUA 2Z04A 4DJFC 1EHIA 1YJBA 3E3AA 2HFKA 3IUYA 2OT3B 3ZY3A 3NNSA 2QORA 2D2EA 4WVLA 2FK8A 2FZGA 1X0VA 2ZT6A 2PRYA 3FWKA 1KDVA 2HEGA 2TMKA 3B3AA 5H83A 2QRMA 2XT9A 1C0LA 1KZ1A 1PYOA 2VDLB 2I8LA 4P3NA 3RM3A 4Y9RA 3D6NB 3SM3A 1MW8X 1GKKA 3Q1LA 3DLTA 4JLBA 1T25A 4RIGA 4F5EA 3KPYA 1ONPA 1NQ5A 1Q3TA 1A5ZA 1ZEJA 221PA 2JASA 1V95A 1Z22A 3A32A 3EYWA 3KQHA 3O84A 2JBAB 1E58A 4G0ZA 3BQ9A 4FGWA 4M9QA 3LQKA 3OH8A 3PDIB 3GJ8A 1RYNA 3NCHA 4TL9A 1HX7A 1IHXA 1R4MB 3S0JA 4E3ZA 2PQ0A 3T7SA 8MHTA 1HFWA 1SPBS 3G7UA 4DNPA 3HO1A 2N46A 4B33A 2QTMA 2CK3A 1V11B 1Q1ZA 2HCFA 3E05A 3ZK9A 5EA2A 3JQDA 4NAUA 1K86A 5B4TA 3MUOA 3E5HA 3NAQA 3CSDA 5AI6A 1LX7A 1YFLA 3ZWBA 1I1NA 1KXJA 3GXBA 4HNAA 1BU5A 3I34X 2WAAA 1Z74A 5DTMA 1Y1TA 2GKSA 3EVCA 2GXUA 2BH2A 2TYSB 4WCFA 3I52A 2H54A 2HPAA 2P6UA 1T34A 3HYNA 4MVJD 3EMBA 3L6OO 1CUDA 5C7IO 4UHJA 2OK8A 1R7RA 1W36D 1PLLA 2EW2A 2Y67A 3IHLA 1EG7A 2B2XA 2HYDA 5KZMB 4HTFB 2HBYA 3NHJA 4XVQA 3W7VA 2WPNA 3ZK7A 2R2GA 1D2EA 3G17A 3RTEA 1OXSC 4RJIA 3WMXA 5J43A 4FILA 3X2SA 4JI4B 4D0SA 1DZIA 1KWGA 4DZRA 4F9EA 3K70D 2DPXA 5BT9A 5LP6B 1PLKA 3M9XA 7GPBA 3NYIA 3PGLA 3FGNA 2Q45A 2WHRA 3T3PB 5CH8A 3ZJVA 2AYZA 3K4QA 3P27A 2NSHA 1TUBA 4JP1A 3HN2A 4U6QA 3CMMA 2Y1LA 3FLMA 2VPYA 4LGVA 1JG7A 4M2LA 5G0UA 3FPHA 3RK1A 1GDHA 2HJVA 2ON6A 5IUNC 2A9QA 5AIBA 1VL2A 1X1SA 4JGBA 5LUAA 3DV0B 5GV8A 4OQLA 3D3QA 4DJTA 2XODA 3M5WA 1GCUA 1V5EA 2AWNA 2WSSD 3N2GB 2ZXFA 1E6UA 3HB9A 4DA9A 1W6UA 1WV0A 1SBIA 2HDWA 2NTJA 4NATA 4U7JA 3FYHA 3UAYA 5AVKA 1JDZA 3Q6IA 1KDOA 4G65A 5DNDA 1L8OA 5AUQA 2BI7A 5F98A 2ACVA 3Q4GA 1ZQ9A 4JC5A 4X5OA 2HU5A 1LWNA 4BUCA 5JNTA 3SR0A 1AS2A 2VDPB 3B1ZA 2UZ3A 4HGNA 4RK4A 1I3KA 1NL3A 4LSMA 1F6DA 1N2BA 4YRBA 1XP5A 2VF8A 1HKUA 2VQ3A 1A88A 4QTUB 4UM7A 5HHTA 2PTHA 4MLCA 4C7OA 2ERYA 3E6AA 4DLWA 1A8PA 1W4AA 3QE3A 4ID3A 2H9AA 5J59A 1U2ZA 4Z2AA 2QPAA 5ARCA 4K81B 1P2SA 3QI2A 2YWBA 4OK5A 1P5ZB 1Z73A 3VHQA 3I62A 1H2XA 2WD7B 4QDOA 5C4GB 1ZM9A 1MDBA 5AVRA 4LKRA 2BKXA 3PT5A 2YOGA 5FEUA 3DBLA 3FE2A 4V0MA 1EUDB 3MMZA 4WLUA 2VPQA 1B42A 1JL3A 3AERB 4FEEA 1CQIB 1U0OC 3E0QA 2IK8A 1ZGGA 2WHQA 1IAVA 4RKQA 2H92A 3DBHA 3EW9A 4PYOA 2ILTA 4RCYA 1JDBB 1ZIYA 2ECOA 4ZOLF 5D6OA 2FE1A 1U2RA 2B7LA 1E2UA 3CJTA 1Q19A 3KKPA 5DLYA 4RVDA 4DR6B 2R68A 4B79A 1QGED 1F0PA 2FW1A 2QMZA 1TVEA 2EFEB 5JC1A 2ZAGA 1Z07A 4QPJC 3TTVA 1F2UB 4YECA 4XM1A 4QFCA 5U9CA 5LD2C 5EINA 4BPBA 3HCWA 4CXMA 3PKIA 4U7DA 3OZCA 3ZDEA 4XR4A 4KGXA 4LCJA 4JVLA 2DJIA 4CMJA 2QV7A 1T9DA 4MPTA 4RLHA 4AWXA 1V9LA 3EPRA 1YB6A 4EEZA 2C9MA 2ZROA 1P39A 3DAPA 1BMFD 3FZNA 3AIKA 1F3OA 2YWCA 3P52A 1VQ1A 3SLGA 2XUOA 9MHTA 4PSAA 3ROMA 1WQ4A 4FX5A 1ZNXA 3BXPA 3S3TA 3DCNA 3JVVA 1MOPA 3HPQA 3FX2A 1MR3F 2OGSA 4HCJA 4XWYA 2UYGA 4ENQA 2P69A 2O1WA 3LO5A 4LZZA 4EY3A 1E1LA 1KOJA 2J3IA 4HAOA 1GKIA 2ZJYA 4XIJA 2QQEA 1E3SA 3LIIA 2JFPA 3L7YA 1DTSA 3P9IA 3QWIA 3AKDA 4JLUA 4TT8A 2FR8A 3UWDA 2H11A 2RKWA 2RGDA 5DHUA 4DCSA 1M5UA 1JFTA 4QXRA 1M2VA 2XYRA 5JNLA 2P79A 5AKXA 5H9WA 4N6NA 4NE2A 5JHGB 4IEEA 1WF6A 5IK2A 1F1BA 2JKVA 4M8SA 4DCUA 2K4MA 2PUGA 2ONKA 4Y67A 3S5UA 1QPZA 1AY0A 1XZAA 3MQ4A 3HR7A 1MB3A 4GHWA 1AN9A 2E87A 4L9SA 3IODA 5BNFA 1G8KA 4OXKA 2D5IA 1NNSA 3CLSD 5AK6A 2MHCA 3RQIA 3WLEA 4IMJB 2JEZA 3M5PA 1MAVA 4LNUA 4RTNA 4EMSA 1PJZA 5BSGA 4MZDA 3DL4A 3OVMA 3VM6A 3R9XB 4WESB 2Q28A 2PKQP 4DLNA 1XU4A 1NW9B 1XCGB 3H2ZA 4L0CA 3VU3A 3PNKA 5CA0A 2G83A 4EB8A 4FZVA 4TZKA 5EI5A 3EPJA 3UK0A 4QBTA 4RL6A 4GYWA 4YJ3A 5FULA 1EP3B 4L9AA 4MYCA 2YTZA 3R7WA 4DLKA 3HO6A 1RZRD 1XG5A 3FVTA 1Z38A 1XTPA 2GBPA 1JSCA 2RGEA 4HGRA 3I32A 2ECQA 1YR1A 1W19A 3FPLA 4DMKA 5B3LA 1N7HA 3WK5A 4AF6A 4L51A 3ORSA 5TQ2A 1O8BA 4I1IA 5K8LA 4IH4A 4OQNA 4YUVA 1QPBA 4BATA 4TV9B 2PZLA 3PI7A 4U2GA 1UDWA 3D0QA 1QZTA 2J08A 2E5LB 1XZIA 1MIOB 3GNQA 3IKJA 3L0PA 5A03A 4MIYA 1P3JA 3QPUA 2W6PA 4P31A 4AC9A 1D2AA 4H0FA 3V80A 3JAMA 3FSRA 3TS1A 1B6SA 1Q1NA 1OD6A 3L82B 4FGSA 4PAQA 4GP6A 4TKZA 3HKCB 3HYCA 3EVDA 3G0CA 4J7AA 1UC9A 3C14C 1ZOOA 1J33A 1E4VA 1UDXA 1YGPA 2GCOB 3OBIA 4MEAA 5C7YA 5ICEA 1G19A 2FZ4A 1B14A 2DY1A 3LP5A 4HV4A 2IPMA 1U0SY 3VJRA 1WPRA 5NULA 3B9BA 4QU8A 4R2KA 1YFKA 1U7ZA 4OUDB 2R1UA 3W9UA 1KS9A 5IKEA 2FKAA 2G67A 1EFRA 2IITA 4FR2A 3KDPA 5JAZA 2ZTLA 1L7MA 4FJ2A 4YMHA 3LUBA 4ROSA 3KRTA 3NV9A 2H3HA 1E94E 1ZUIA 3LLSA 3LDFA 4M8NE 1NURA 3GLUA 4MI3A 2XMZA 3X43A 5KHOC 3TZQA 3DVLA 2BOVA 1W59A 3QX9A 4FGJA 3T61A 2HADA 1H4VB 1ULTA 4TL8A 5AKGA 5AOAA 1AHHA 2AQIA 4URFA 1OLUA 4WOKA 5F1PA 1JH9A 2VT2A 1B2LA 3PWZA 5FOXA 1MAWA 2XMDA 1GVHA 2PKRA 4P80A 5A6SB 2JJ8A 3UENA 1YFZA 1NBMD 4DANA 1WAMA 5ADVA 1W9MA 3HA3A 3JALA 4JJZA 3SLKA 1PFUA 3ZKWA 3SICE 1ZCAA 4D96A 2W70A 3LCVB 4UBMA 4KL8S 3RS7A 4HH0A 4QOSA 2NUBA 1YVPA 2J07A 2VPIA 1P1KA 3LRXA 4V02A 3V7NA 4S0XA 2P9HA 3ETEA 4UCFA 1MX9A 5JMPA 2WIFA 4HDQB 4UQOA 1FSGA 4MI1A 2VHYA 3URMA 3W8NA 1PR3A 1VCIA 3LXMA 4F11A 4WY5A 1JKXA 3BERA 1CJUC 4ZP1A 3PK0A 2AX3A 3DQZA 2AYYA 4Q9IA 1HWYA 2XB6A 2C7OA 2ZYSA 3O1IC 5KSPA 4CQLA 1CJVC 1UJ5A 2PBLA 2E5WA 4BO1A 3HYSA 5LB2A 3WMEA 3L9XA 4B4WA 4LXGA 4BQFA 4W9NC 3HDGA 2NVBA 4OHUA 3LQ4A 3I83A 2JHFA 1MRSA 3LQRA 3NVDA 3PENA 3ZS8A 4ZZ3A 4FB5A 3OZGA 2YVQA 4UNRA 3GMTA 5BORA 4NCJA 4B82A 4ZC1A 1XKQA 4LE2A 1T2FA 3IDZA 3LDAA 1D9XA 1EINA 3JQGA 4HH1A 4AKHA 3HM2A 2B92A 4M1MA 5A04A 2V58A 4QD3A 1CR2A 3GN1A 2IW1A 4EUKA 1TJYA 3N75A 5EPOA 4QG7A 4BS9A 1LJLA 2I6QA 3Q9NA 3K0AA 1D4FA 2B9EA 4PIMA 5DYIA 3ER9A 5AJZA 2VJKA 2C0PA 3PE6A 5FB3A 3UHOA 4HX5A 1U0JA 2P91A 1TM2A 2A14A 1EXWA 3VUFA 3ZCSA 4UFNA 1LTKA 3ZW7A 5EJGA 4FS3A 4LC9A 4YFYA 4WKPA 5D87A 1UQTA 4CWAA 4W7HA 1K2VN 1WSBA 3D5EA 5F2KA 4UTVA 4CMHA 4E6EA 2BT4A 4G1CA 4Y18A 2GYUA 3CB4A 2CDRA 3HA7A 5BW8A 4RTRA 1WCXA 5LFAA 3X1YA 4L3VA 1UKZA 4G1MB 6CHYA 4J9VA 5JYCA 3QY9A 4YYZA 3OQJA 1YQXA 1Z7EA 1P4AA 5AJUA 4JI6B 4AULA 2GWRA 3DFFA 3S2EA 4HADA 2CXPA 2XYPA 5DNAA 1QG2A 3GRCA 2E9SA 2Y1OA 3NHRA 2XCSB 1QFJA 3RLFA 4E5KA 4F8EA 5IT9A 1OX4B 4JK3A 3ZWQA 1J1UA 4GBGA 2PMFA 2CCKA 2CCGA 4MYHA 4QA9A 5HKKA 4ITUA 3OWHA 5DZSA 1BFDA 1CVIA 1R6TA 1V3QE 4TPKA 3M49A 4KR3A 3AI2A 3KD3A 2GJ9A 4GMHA 3L7MA 2GPTA 5IJ9B 3NU1A 4G26A 3CUEF 1KVSA 4MQUA 1Y3IA 4P4SB 2FRVA 3CGGA 2GDZA 4QGFA 5D5HA 1JYEA 2OHIA 2REBA 1CZNA 4KODA 1KRHA 4GBJA 4EVRA 3H4VA 5DLQC 4TV8B 3U80A 2XHEA 2Z9CA 3QHQA 2N9UA 5EHGA 3U7QB 2XW6A 4YRMA 2QRVA 1J21A 4A0FA 1GLNA 4WHMA 1GLVA 3FNIA 1G1AA 4CLDA 1G8SA 2X2FA 2J59A 2I91A 1XTZA 4LFAB 1Y81A 3P9CA 1E1CA 1G0OA 4B31A 1T5DX 5IF3A 4DCCA 3VR6A 1AKQA 1FVFA 2JCVA 5ITSA 2F3QA 2JRLA 3QV1A 4TVSA 3MWYW 3Q40A 3D3WA 3E3NA 4ZT6A 3WYNA 1L4EA 2TSYB 4N65A 3W77A 2SNIE 2MSWA 3WKAA 3ISVA 3QFSA 4QREA 2YWRA 1E3WB 2J5XA 3NGLA 4OSPA 2G9NA 3RTGA 2ZWOA 4KQ1A 1QLWA 5K0FA 3L6UA 2JEYA 1Z4KA 1NW7A 2WV7A 3ZGLA 3N7UA 1ENYA 4RVNA 4Z54A 1E7MA 2ZS9A 4AIIA 4CTNA 1MVLA 4HAIA 4RS4A 2V7QA 4NCBA 1UPFA 4OAPA 2A6PA 1NN1A 2BFEA 1GZ6A 2P78A 3PQFA 1B8UA 4UOQA 3U1VA 3CZPA 1JA1A 7AT1A 4J76A 1ESDA 1JSZA 1VC2A 1E2QA 4TLCA 1VRCA 1FFAA 2XT0A 3IAFA 4NU8X 3ELWA 2DHDA 4FJ1A 1WRBA 1ZGAA 2FXVA 1LQUA 3DC2A 3LF2A 4RVSA 1ZI9A 5DOZA 2C5AA 1POWA 2VOJA 1S02A 3GARA 3FUXA 5DHSA 1GL6A 4B5KA 1EE2A 3WKCA 4EABA 1ZUNB 2B1QA 1S7GA 2VLBA 1PJCA 2PL5A 1L5MA 1FIUA 4M60A 1CJKC 4ES6A 2WTBA 5FCDA 1SVLA 3OOJA 1DCFA 1IXRC 4P36A 4S3MA 5JNRA 3MJDA 1IOZA 4YCSA 4G0UA 4B5LA 3OTOB 3WLLA 1GA4A 4LJRA 4IPTA 3PRJA 1ACLA 4PO3X 3G2NA 2ADMA 1ZH6A 4J7UA 2C3YA 1PGPA 1SCUB 3GFGA 4LDQA 2E48A 3RBXA 1JJIA 3C3XA 2XB8A 3ROTA 5B57C 3AVOA 4L0MA 3R1IA 1TL7C 2IYVA 3R3YA 4Y2RA 4IICA 3WIEA 1VL8A 3HKDA 4IVPA 1O0SA 2ZJOA 1OGIA 4JMPA 3U13A 4DAEA 1QVRA 1E3TA 1OBHA 2BL4A 2E4VA 3TMYA 4S1TA 4FI3C 5DASA 4LG1A 3K0BA 5T8KC 1ZD4A 4RIEA 1BEZA 1DCKA 2ZGVA 5EZQA 5EWMA 3U3ZA 1NG1A 5KEIA 1G8GA 5CCDA 1RWVA 4MVJE 4YBZA 1QOZA 5AESA 4TS9A 1LNZA 4MXDA 3DEJA 1UINA 1E9DA 2RKBA 1QUEA 4YRNA 4F86A 3TR0A 5EZYA 2ZRFA 1EP1B 1XEWY 2RB5A 3F4LA 2GN2A 3M2TA 3NOXA 4XWGA 3V8NA 3WLQA 2F8TA 2PANA 3HGMA 1YCFA 2XUPA 2ORWA 1ZOLA 4HNAB 1SG0A 4PC7A 1U6IA 5DWVA 5ENDA 4BIMA 5K4GA 1ORVA 1EFCA 1LDGA 1UQUA 4RAOA 3RSGA 2FMKA 4WCFB 3DP7A 2QDXA 3E23A 4RELA 1RFLA 4HH3C 5GP1A 3UWPA 1Q0UA 2FUEA 1TMGE 4I9GA 5DN6D 4FVTA 2FZEA 4WA8A 4L1KA 3DDHA 1DJMA 1OBCA 2FLKA 4G09A 4LQCA 1T5LA 1FFGA 2XQFA 4CNQA 2NNLD 1HDOA 3A4MA 3FNFA 2YN4A 2RBGA 3GLQA 4XGNA 5CGQB 2QMEA 1DT5A 4CQMA 1CZOA 5JU6A 2HMYB 3WYFA 10MHA 4IFEA 2ECKA 4OMFG 1PUIA 1U8FO 4UPVA 2C94A 3NH9A 3K4PA 2Y8EA 3BMNA 4PPNA 4ZC8A 1ZONA 1UBCA 1EGAA 4TSFD 4EG6A 1KAEA 3HR8A 3SOZA 1M33A 2XDYA 1RYYA 1QRAA 1TUBB 1QOQB 2AJBA 4OVKA 4AN4A 3VTKA 3OJOA 4MUGA 1Y4UA 5IVHA 3IEKA 2C7PA 3SFZA 3MJSA 3CUTA 1U1GA 4O2AF 3HKBA 3GAFA 2R7LA 5HA5A 5KDLA 1SQSA 4MR9A 2R7KA 4WAUA 5ARBA 5LKRA 1N7GA 4J03A 1HYEA 2HMWA 5BUSA 5C32A 5MGBA 3ZDZB 3ICCA 2FPPA 2Z8YA 2HPVA 2FV8A 5G4LA 5D8DA 3CF4A 2EL9A 2FSSA 1DHRA 1AA6A 3M82A 2QLMA 1MQ8B 3WOVA 4U8GA 3I45A 3ZVNA 2A2ZA 1B73A 3HU1A 1BS1A 3VBCA 4D8TA 1G2IA 3IR7A 3MS2A 2C04A 3RRZA 5J63A 4C7OB 2C1XA 2ZIXA 3T8YA 2FR1A 1E2EA 3KSBC 1QIIA 5ELLA 3ODGA 1I13A 5DMXA 2AJCA 4NV3A 5EWJA 3VFDA 2EFJA 2JLBA 3VR4H 5IT0A 2NN3C 3RE1A 4EGQA 2QRKA 3ANXA 1V8BA 3BC1A 5H3CA 4LKOA 3DBLB 2CMFA 3DFIA 4MW6A 2B4RO 1PUJA 2XHZA 3E1GA 3BE6A 1VL6A 1SUIA 3A11A 5LXTF 4RSGA 1V1JA 3ESRA 1C9MA 3U62A 3S2ZA 3UO8B 4BV9A 5KNCH 1BN7A 1OB2A 3A3PA 3WLNA 2A1IA 3AY0A 4TLLB 5WRFA 4BRUA 1JHMA 3WHKA 3SNHA 1E5QA 1VIYA 1Z63A 5CLQA 5JZVA 3UCFA 5B55A 4MDFA 3K70C 2P9GA 2YJ3A 1WP9A 4HWTA 4R54A 3HBLA 3KBOA 4LV5B 5I7SA 2AG5A 5EE1A 2PLAA 2VK4A 1E4OA 2F9MA 2OAQ1 4WN9A 2XA1A 4X6LA 3C3KA 1YBHA 2JLRA 4X94A 1ZBDA 4GKBA 3WXBA 2OXRA 5BN5A 2RHLA 1OZHA 4I14A 4Z86A 4ND6A 1HDZA 2CFTA 2CYCA 2ADOA 3IVGA 4P54A 4QBFA 3BGDA 3M1LA 4OYLA 5TNXA 3MRVA 3GLSA 4PRZA 4F72A 3EZ9A 3NEJA 1V9SA 5BSWA 3ESQA 3K96A 1MNAA 5KWIA 4DLAA 1QIEA 5H3LA 5SZKB 1XZLA 2IWHA 3SKVA 4B2IA 4BEVA 1V6SA 2CT8A 2OORC 1XTBA 1U80A 2IZ5A 1CY0A 1L5YA 5JS7A 3O93A 5AUPB 4RA9A 3TOSA 2JH9A 2O3QA 2BAGA 3T1YB 1YNOA 4B3RB 4XJTA 1MQ9A 2B5WA 4QRHA 1NVEA 1OTYA 3OU7A 4C87A 5CNKA 3V8PA 4GL4A 1L7RA 5KVSA 1V5GA 4LX0A 1M2VB 3MERA 4RLSA 4FI3F 1A2KC 5FQOA 4A91A 1P9NA 1OXTA 3D7KA 3SAJA 1QV9A 3ZC3A 3DMDA 2GFQA 4C89A 1TKCA 2A86A 1JB1A 2Q5CA 4BP8A 2P5TB 3CPSA 3M1AA 5F73A 3SBOA 4TN5A 1DELA 4O4HA 1W5TA 4EBFA 4H3SA 2ZBFA 3BHIA 3LDGA 2BFDA 1NMEA 2C4WA 2PX8A 1IATA 4U7GA 4NV1A 5FUXA 3H42B 3PX3A 4G5SA 3U4GA 1EQUA 3TLKA 4DMGA 4OQPA 1LLCA 5DF1A 1LK5A 4LNUB 1K89A 1L7BA 3GT4A 3MWDA 2JFQA 3R8CA 4JYAB 2G70A 4IOMA 3FH0A 3CM0A 4XTRA 5AVYA 4QYSA 2Q1XA 1KH3A 1HE1C 4FD2A 4TMXA 2GSDA 3MILA 1T5OA 1UFKA 5CA0B 1DMRA 1FX1A 1EKXA 1GUYA 3M6LA 4YJ3B 4IDQA 2EKDA 3R7WB 2BTQA 1P2VA 1WF3A 1IBSA 1USGA 1EZ4A 1DWOA 5SYMA 4RY8A 3B6EA 1N5DA 2YNMD 1XRNA 2HGZA 4P5PA 4JYPA 1KBZA 1JTFA 2CY0A 4KZKA 4LJ6A 4IW3B 3AWDA 5TQ2B 1B2RA 4IDEA 3AF1A 3UMRA 1G59A 4X9XA 3WMGA 4BNLA 3BOSA 3QJGA 2G9VA 3UJ6A 1TUIA 1XMOB 2LP4Y 1NJ6A 5AK4A 3U4CA 1AKRA 1AS0A 1TK3A 2DBVO 2F43B 1UWCA 5KO2A 4Z7NB 3VR4D 3BBLA 3V8BA 2ZS7A 1JFFA 2WC1A 1II0A 2JDIA 1WD5A 4Q05A 5EQDA 4XQ9A 4A8TA 5A2QA 4TTRA 2XZLA 1DFGA 1VI2A 1Q15A 1R9GA 3RDPA 4B3IA 1ECPA 4AF7A 1U3DA 4IUDS 2A9RA 1W93A 2EIHA 4UUMA 2X0JA 2HUNA 4YO8A 3GLVA 3PXCX 2REQA 3HC7A 2VP6A 3O7MA 5T4HA 3F67A 3L40A 3TAHA 1H5UA 2GBIA 1QVAA 2G82A 1HL7A 2I7TA 1PSWA 2YFQA 1EK5A 4NH4A 3RHSA 5KNCD 4QTZA 3ZCXA 4G9EA 4TLEA 4Q7QA 3PD0A 2AI1A 2EGUA 5JASA 3KQVA 2Z30A 1IOWA 2R8EA 4P93A 1LPBB 1ESMA 1NP6A 3N2KA 4NCNA 4RKEA 1QC5B 3WDMA 4EY5A 4FINA 3B1VA 5C46F 1Z2OX 4N3CA 4PAWA 3BT7A 3D43A 3N6VA 1GKYA 1NXOA 1CRZA 2CXXA 4LOIA 1EFTA 3LBIA 2NZ2A 1Q7EA 1L5KA 2ZXEA 1GFZA 1N57A 4RFSA 1FMFA 3CLSC 4IIJF 4MGEA 1M7GA 1UMBB 1XQVA 5LNK6 2CBGA 3MBIA 1XP8A 2ZDQA 2ZR0A 1L4GA 4R8SA 2Z8ZA 5ILGA 3ZV7A 1CF9A 5DTRA 5DSZA 3LBHA 4CUKA 3U7RA 1YDMA 2N42A 1BX0A 2G6TA 3JALB 4H27A 4DSAA 3RRXA 2BM1A 1DG9A 3ZKWB 4E2WA 5A4JA 4FDMA 3EYAA 1UADA 1L8LA 1KDPA 5KMGA 1IY8A 3KU1A 5EUBA 1DX9A 1ZL2A 4YWJA 4C29A 2LVBA 1JJBA 1R8XA 2F17A 4A6EA 2IS4A 5AKHA 1XRPA 6GPBA 1KU6A 4QGHA 2NU7A 2NZUG 4MVJF 5THKA 3SBDA 5F9FA 1K5GA 1VSTA 2C7BA 1TUGA 4KPUA 4Z1MD 4JUFA 5EZ5A 4A8JC 4H60A 4AROA 3O26A 3VU0A 2FZLA 4RGBA 3QTTA 5KKCA 4F56A 5K3BA 1JSRA 3IPXA 1AKEA 4PPYA 4B47A 1CY1A 4CQLB 4PCVA 3ZCTA 4F6CA 4GI5A 1QIDA 3FDIA 3R3UA 1AV7A 2EW8A 2O19A 1EESA 3OC0A 2A0KA 1RIFA 2J3EA 3DOFA 1L5LA 3PQEA 3GOHA 4NXNB 3Q3IA 3B1XA 2HHLA 2QE7A 3T3OA 4NESA 2C9YA 3TWOA 1FUYB 2R6DA 3JQGB 4FW8A 4B7UA 2ZYUX 2XBMA 2QYSA 1GL3A 3IKTA 3ASZA 4KTVE 5LLTA 3HDQA 1P74A 2EEPA 1RE1A 4KQFA 3MWFA 4H3VA 2HAEA 2BM8A 1RD4A 1YDFA 3HBNA 5HM8A 3N8KA 4QYXA 2PX4A 3K0AB 1YB4A 4REQA 5CVTA 1J9GA 4UHFA 5LQCA 2QSUA 2HI0A 2QTCA 2PEYA 1ZJ4A 3IO5A 4XWTA 4H35A 1NXWA 3QXGA 4PO8A 1TK2A 5LIPA 2CXRA 4W5WA 3L7AA 4R1UA 1LPSA 3EXFA 1K5PA 4NMMA 2BKEA 1O5OA 5C8ZA 2VDVE 1GGHA 2J3JA 3QVMA 3U4DA 5EJ2A 2R00C 1Y9JA 4K40A 4HC4A 3ZDXB 4A82A 4HD8A 4M1EA 3B6IA 4CF4A 1SU6A 3BCHA 3AUJB 1X7GA 1FFXA 3ZYCA 4C05A 4Q4JA 3GPDG 2Q49A 2EP5A 3NUZA 3AH8A 3JW8A 4V2IA 2EJVA 3OLWA 1UJMA 1Z56C 1GZUA 2B8JA 4NDAA 4KFSA 4G97A 4O3FA 5CH3A 3U60B 1D5WA 3H18A 3SLRA 1Z08A 2OCLA 5TSDA 1Y5MA 5FWAA 1OIVA 1FMTA 2A7XA 3DZ8A 4JENA 3T7IA 1Q2XA 1V1MB 3N2LA 4WLVA 1CR4A 1A4RA 3L7NA 3QYPA 1GL9B 4AURA 4YHHB 3MTJA 4LUCA 1TB4A 2IYLD 1K0UA 5JISA 3EFHA 1IPFA 5CTAA 1E66A 1SKUA 4YUYA 2JLAA 3K5HA 2LXNA 2NOAA 1YB1A 3DMGA 4MGYR 1IK4A 3GUZA 4D0NA 2QXTA 3AL2A 1KXZA 5FFNA 2W0MA 3R20A 1KPIA 2NU6A 3TNDA 1E1MA 4BU0A 1EWKA 1ZUHA 1PU2A 3I5YA 1F2VA 4L07A 2Y1XA 4F85A 1B0PA 5JMOA 1UWLA 2QD5A 4HS9A 4K9PA 3U7JA 4FQ7A 2QRVB 4MWOA 3UFXA 1MEOA 3B1KA 4EF4A 3NBAA 5LQRA 3ZJ5A 4INZA 1BQEA 2J5RA 4PIVA 4MA5A 3EG5A 1F4PA 1AQIA 1E1CB 1JWAB 1TX4B 3VYVA 2BBOA 4RA6A 4PG8A 2JGJA 2VBIA 2YWXA 3AX6A 3H2GA 4M0MA 1X14A 1RYFA 4Z53A 2E6UX 2XUGA 4QDKA 1BS2A 1OXBB 1R5BA 2ACKA 4YCBA 4BEWA 1PR0A 2GN9A 3PC8C 4CIBA 4XARA 3JZAA 3N3AC 1O77A 4ZOBA 1P8JA 4YONB 1JI3A 2V98A 3A6JA 1ENPA 5H80A 2X58A 4HVLA 3PLAE 2FPUA 3ESZA 2HXGA 1TZMA 3O74A 1PL8A 3C7CB 3R6WA 2BFEB 2JHPA 1W34A 1AKVA 2OHGA 3HCOA 9GPBA 5I7UA 5DGTA 1OKKA 3CF0A 3LUPA 3UJNA 1AQYA 3DLCA 3WIDA 4V38A 2AZTA 2PZBA 1COWD 4NDNE 3IESA 2AEMA 1H0SA 2XCIA 2PX3A 3OJFA 2MU1A 5F3DA 2NVOA 4CLEA 1I4EB 2ATIA 4KXQA 3WC4A 2A4KA 2RHRA 1KSFX 5T5QA 3RKRA 2V4ZA 2HJ9A 4IL5A 3FBTA 1T8WA 4EUHA 5EEHA 4G0PA 4L28A 4M0FA 1DRKA 4YX9A 3U1TA 2ZEJA 3UAXA 1XQYA 4R2JA 5D6NA 2QJTA 1QHNA 2QTHA 4V0KA 3B6JA 3K9FC 1QE5A 2P30A 1NZJA 1XXHA 2OGZA 4XCXA 3W6ZA 5JI2E 4M7PA 3FOZA 1G7TA 2GPJA 4YASA 1ZD1A 2N75A 3H5VA 1F1JA 3MGAA 4IIJA 4ER3A 3GPBA 5KSOA 4NX2A 2EIXA 3PX7A 1GL7A 3OO0A 3AV3A 4I66A 1YI8A 4KPYA 3LC1O 2HIHA 3IUNA 3RYIA 4KG7A 1UPTA 3HKDB 4B0OA 4ZMBA 5B7GA 3PEYA 5IC4A 3CN9A 3I09A 3MTBA 4P84A 4DN6A 1EUYA 3EGVA 1SBZA 3TFQA 1YDHA 3DL7A 4YAOA 3CZMA 4ZYWA 5EWMB 1AMOA 2QT0A 4GQAA 1QYDA 5IEBA 1HF3A 4WX2B 3WIOA 1O57A 4Z7JA 3D4BA 3UZUA 2O3SA 3H5IA 1HY3A 3VRHA 1XKXA 1DKQA 1E9FA 5EZYB 2XIQA 4KGZA 4ADSG 4DPKA 3RUDA 2VYQA 2NO7A 4Q7MB 3CUWA 3DEAA 4OXQA 3RIXA 5HX7A 1JGTA 3ZE9A 1IBCA 2HOQA 3AIOA 4B4VA 3KVYA 1ZVJA 4J6FA 2C8JA 5DHRA 4ZOLA 4P7KA 1L5QA 2B7BA 1YK1A 4BVKA 1QAQA 4G81A 3ZDFA 5C1BA 3OJWA 1I7QB 2X3FA 5AW0A 5ALWA 2E85A 2B4AA 5J2UF 2P1DA 1FMJA 1DXHA 3ICOA 2C2ZA 1DG3A 1EAYA 1HOXA 1R6DA 4JOSA 1RDFA 5E0OA 4BUJA 5EJ4A 1DKRA 4KRGA 1AU9A 4R1QA 2GEVA 2B82A 1XCBA 1MU0A 1PIWA 3C6YA 4E5VA 3L8GA 4CQMB 1XTSA 2RGGA 1JXQA 5I7EA 3PUVA 1SUBA 2GNAA 2WSIA 4E14A 1ZAYA 2XUIA 5JCOA 4GZ5A 2VRBA 4DMHA 5IXSA 2I7VA 2DKOA 3GDWA 1BX1A 1N8NA 2FPKA 2GCNA 3BMNB 4B32A 5DTJA 3LQ1A 3AVUA 2CHUA 2CCJA 1R5JA 3V00A 4KE6A 3ZIDA 1N0HA 1U2SA 1KHTA 1C9DB 2AZDA 1MLDA 4PQEA 1ZN2A 3NB0A 1QKIA 3ZGVA 5L6MB 3ZVMA 3HKBB 4L0DA 1HG1A 2CDCA 3DH0A 3SYKA 3V7WA 5CDGA 4Q19A 3DULA 3T3NA 2BZ1A 2FPPB 3D6TB 3KJEA 1KSJA 2OEPA 4NHEA 1IWPB 2ZE7A 3AR8A 1KOLA 5SZJA 4Z1OA 3EIFA 1DDIA 1KYTA 3UK2A 2F1JA 4NI5A 3UKOA 2XSZD 1MAHA 4PYRA 2XCRB 1G7SA 2W58A 1NU8A 2NUAA 4MIKA 3ZEAA 2O2SA 5EQTA 4WJKB 3UG6A 3BE8A 3P4XA 4AQ7A 2C03A 2W6QA 2ZIXB 1E64A 2AXQA 1GUDA 4JI7B 4ILKA 2QMYA 3KT6A 1N5RA 5EWJB 3NTOA 4UUQA 4TZ6A 4ZCQA 4EW6A 2QW0X 3D6HA 5HF5A 3VPCA 1MO2A 3CLRD 4A0GA 3CUVA 3C3JA 1ORDA 4BQQA 4DAOA 2JFWA 2ZRMA 4QUHA 2ZPAA 4CT5A 3RD5A 3GK3A 4R7ZA 4R9NA 4LF5B 1WLYA 1M54A 2DWOA 4ZTZB 4PR3A 3PD7A 3QW4B 4DCPA 4LJAA 4RK5A 3SC2A 3T12A 1E4YA 3ZDBA 1RQRA 2VZ9A 2JA2A 3ZHYA 2ZPUA 1Y4SA 3R7SA 4EFDA 1G5TA 1YC5A 3COSA 4AMBA 1Y89A 4L4XA 3FNEA 1GARA 4PPGA 3AVYA 4AL4A 3GPCA 1VMKA 5LA6A 3QITA 3ZZ0A 4QBKA 3N8IA 4ZRMA 2IF2A 1QH9A 1KMHA 4PZLA 2C5SA 4PSKA 4IWXA 4EJ0A 1OASA 5CIYA 2Q6OA 4WN9B 1GAJA 2HCBA 4YRZA 1YF3A 1YQEA 5HKAA 4RJTA 3CTPA 4Q4HA 2XMQA 4MDYA 2MTBA 4KBFA 2UXDB 5F9HA 4CIVA 1GNVA 1DQZA 1W2WB 2CKDA 4C22A 5DHPA 1B6GA 2OC4A 2VJPA 2WFLA 1FQWA 2Z2KA 4G4SP 4GPIB 4WOBA 2P0EA 4DVJA 4EKNB 1RCFA 2DUJA 4ND4A 1P7CA 4DARA 4EX6A 2WLTA 5FTLA 3JYLA 1N2CE 2M1ZA 3HUDA 4J43A 4CLXA 4BQPA 3OJCA 4KQIA 1E2GA 5E8RA 2I2XB 2YYAA 1UPCA 3HU3A 3HFJA 3BWVA 2C7QA 4K6FA 4W6QA 1U7PA 3V9PA 4KV9A 4RA9B 4NBWA 2YW9A 1O89A 2VHUA 3AILA 3EEBA 3ADDA 1J97A 3E9MA 1R0KA 1SVMA 2X4IA 5JMTA 4LBWA 1F7VA 1ZHOA 2WWVD 2CDAA 2PGJA 4K1LA 2IELA 2PR2A 3VDXA 3QOXA 3RC8A 2CLFB 3DAGA 1SKYE 5JG7A 4CEHA 4D9JA 1FTQA 4BMDA 1EPUA 4O4HB 4F2GA 4ZDKA 2I6SA 4PX9A 1MV8A 3BFKA 3OE7D 4JI5B 4DR7B 2BFDB 3NJRA 4CM9A 3HXKA 4OHXA 1A77A 4AKEA 4CF6A 5AIAA 1FU7A 2Q6IA 3SM9A 3NQ41 4QFDA 5AXDA 2PMKA 3SHTA 3BULA 1M6NA 2WJZB 3MMNA 4M1OA 4Y9DA 5HQTA 2ONZA 4PU0A 3H5NA 4OSEA 4RK6A 4RXTA 3AI1A 3MWDB 4U2KA 4EJSA 2Z2XA 3VVBA 1GNLA 1J7KA 1NX6A 4LJ4A 5CFNA 4U00A 4ZA2A 3OKCA 2QGFA 2DM6A 4Q3LA 3FTQA 4JYZA 4H7EA 2ZJ8A 3C6MA 2CWDA 2FPWA 2GYVA 2FF5A 4A73A 3OF5A 4BX0A 4IF4A 1DO0A 3JAWA 1XQ1A 2JGLA 4L0QA 2OKCA 3GWZA 1EB9A 2BTQB 3BVPA 2VCHA 1SKAA 4S1NA 3WAJA 4F5WA 3QEOA 1ZW6A 5FUYA 3HPRA 4AYXA 4BVAA 4BZZA 5ITZA 3VR5D 2DSTA 1P0CA 4ZALA 1BMDA 821PA 3M6VA 1IDN1 5ICCA 2H1IA 2X19A 4TWAA 2PQMA 2WSMA 4Q93A 3ZWKA 3D8SA 3TJZA 2PUBA 2GZ1A 3FR7A 1ETUA 4LNHA 1Z26A 4GI1A 5D86A 1AK1A 4G37A 1YQDA 4N0DA 1VE5A 5IDXA 4LK3A 4AO6A 1ZK2A 4IKOA 1JFFB 5ALUA 1ODJA 5FFFA 1G42A 1IMOA 2CXSA 2GF9A 3FWNA 4B74A 1T8RA 4OM7A 5EFOA 3V9AA 2PUCA 3WMRA 4RQAA 1PZNA 1RCTE 1W52X 1PZHA 2P9EA 1AK2A 2V97A 4PHCA 4QDTA 4ABTA 1BFKA 1MQAA 1XLVA 1KYQA 4RMJA 1AXGA 3DFMA 3BWXA 3KQPA 3T35A 4GSYA 4FT4A 2BEUA 2PPVA 3V2GA 4OLJA 2NO0A 4X71A 4TTVA 1X70A 5FI5A 3VNRA 1QX4A 4CM4A 3BX1A 1OV4A 1RXIA 2P3SA 2O1XA 5H59A 2P2CA 1VCMA 3W9YA 1BJKA 3F4BA 4FR0A 3WIUA 4RENA 4HNUA 4WXRA 3IEPA 4NY1A 3UATA 1NBEA 3G9ZA 3L4JA 1RU3A 3CWZA 3I73A 1AE1A 3CBQA 4NE9A 4PV7A 4RFSB 1CT9A 1OXMA 2YWGA 3KV1A 4PLZA 521PA 1EWVA 3MGGA 3H4TA 3K1YA 3QELA 3ZE1B 1RQXA 2D1QA 2JKYA 3JQ9C 3S2FA 3WRXA 3RADC 2D6FA 3Q2KA 4MB6A 5J47A 3IAEA 4YT4A 4KMMA 1M0WA 1OYVA 3MTQA 1C3VA 3IS3A 5KMGB 4GICA 5F5XA 1NZDA 1U4OA 3ILHA 3F9CA 3KHKA 4KN5A 2JIZA 4MB0A 4CKCA 1B0AA 2W4QA 3MFQA 4PFQA 2NU7B 3AFOA 2ZZKA 4YJ2F 5IDVA 4BLVA 2ODQA 3ASYA 2CJPA 4N18A 4P35A 5E3JA 1GRQA 4NPAA 4KPUB 3U3DA 4B6QA 2MSEB 2YNMC 1OWLA 5AM5A