4F8YA

Complex structure of nadph:quinone oxidoreductase with menadione in streptococcus mutans
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
196
structure length
196
Chain Sequence
b'MKILIVYTHPNPTSFNAEILKQVQTNLSKEHTVSTLDLYAEHFDPVLQFNETHKRRDLAKVAEMEKYRDLVTWADHLIFIFPIWWSGMPAILKGFIDRVFVADFAYSYKKVGLEGHLQGKSAWIITTHNTPSFAMPFVQDYGKVLKKQILKPCAISPVKLTELTSIEKISDDERQKLLHKVAQITRNILEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH Quinone Oxidoreductase
molecule tags Oxidoreductase
source organism Streptococcus mutans
publication title Complex structure of NADPH:quinone oxidoreductase with menadione in Streptococcus mutans
rcsb
total genus 65
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f8yA00
1GG5A 4NLLA 2V5VA 1D03A 3LCMA 3HR4A 3GFQA 1WSWA 1QBGA 3NHRA 1OBVA 3TZBA 3EDOA 3F6SA 3NFRA 4LTMA 5B3KA 3L9XA 2QX8A 4FGJA 2FVXA 4S24A 3FNIA 1NNI1 2QMYA 3FW1A 4LAFA 4N82A 2F1OA 3OJWA 1ZX1A 2BN4A 2FZ5A 3FJOA 1TIKA 3B6MA 3NHUA 3NHYA 2V9CA 3GFRA 4YALA 4BMPB 1OFVA 4U7FA 1CZOA 2BF4A 5LBUA 4HEQA 5LLDA 3GFSA 3OVMA 1AMOA 4QOGA 3NHLA 5A4KA 3TEMA 2AMJA 2FDXA 2FAXA 2QX4A 1AKWA 1RCFA 1V4BA 1CZNA 1FLDA 2B3DA 2M6RA 2Q62A 2WC1A 3HA2A 2KLBA 1AKQA 3KEGA 3OWXA 5EMNA 1C7FA 1D4AA 3NHPA 1CZHA 2XOEA 4DY4A 3N39C 4QOJA 1XYVA 3B6KA 3ES9A 1AKTA 1KBQA 3RPEA 5BUCA 4GR9A 1H66A 1YCGA 4YQEA 1RLJA 3GAMA 3ZHOA 1FLNA 1QR2A 5LMCA 3B6IA 1J9GA 1AHNA 1AKUA 1JA0A 1ZWKA 1I1OA 4FGLA 3NLLA 4DIKA 1B1CA 2M6SA 2QWXA 2X2PA 3F6RA 5F4BA 4C76A 5JROA 5TGZA 2A5LA 2MTBA 3O2NA 4XDGA 2Z98A 1FVXA 4Y9UA 1RTTA 2BMVA 3UXEA 1FTGA 5F51A 3O73A 4QOHA 5B3LA 2Q9UA 5LVAA 1DXQA 2R97A 1C7EA 1SQSA 3G5MA 3NHSA 4J8PA 3UXHA 1DX9A 4CF6A 5LJIA 1QHEA 4PU0A 1ZWLA 1AG9A 1J9EA 4C14A 4CETA 4YAUA 3SVLA 1QRDA 3LT5A 3HLYA 2QX6A 3R6WA 1BU5A 3D7NA 2N1MA 4QOIA 5EAIA 1TLLA 2Z9DA 4QOFA 3K20A 2HPVA 4LA4A 4LTDA 5F12A 3KAPA 2QX9A 3KLBA 4ESEA 1FUEA 4ZVMA 5NLLA 2KQUA 3ESXA 1XI2A 2XODA 5LJLA 1YRHA 3KAQA 4QODA 3N3AC 3S2YA 4C0XA 4FX2A 5EA2A 2OHJA 6NULA 1AKVA 2HNAA 2OHHA 3FVWA 3TE7A 3W78A 4BMOB 4YAWA 3OJXA 4U7GA 2QR2A 3OX1A 3NHJA 3P0RA 3U7IA 4H2DA 1CZLA 4Y9RA 1FLAA 3NHFA 3B6JA 2R96A 4H6PA 1T5BA 2FOXA 1FX1A 3OX3A 1XT6A 3NHWA 2MT9A 3QFRA 4N65A 2FLVA 2GSWA 4OXXA 4C0WA 3FX2A 4LTNA 1CZRA 4HS4A 1CZKA 2QMZA 2OYSA 2D5IA 1AZLA 3N3BC 3QE2A 3W79A 5FX2A 1BVYF 1AKRA 1YCFA 4PTZA 4FGKA 1F4PA 2BPOA 2OHIA 1FLVA 4ZVKA 1XYYA 1T0IA 1JA1A 2BZSA 1X77A 4PTYA 3U7RA 4D02A 2FCRA 3NHKA 1CZUA 4ZVNA 1DXOA 2Z9BA 1E5DA 1YKGA 5FUQA 4F8YA 2FX2A 4GQIA 2FZVA 3ESYA 3OX2A 4XDHA 2Z9CA 1YCHA 3W7AA 5ULLA 1VMEA 2MOKA 4YAOA 1WSBA 2ARKA 3F2VA 1RLIA 1J9ZA 3F90A 3ESZA 3QFCA 2HNBA 2V5UA 3JSXA 3EYWA 3K1YA 4R81A 2W5UA 4Y7CA 5LBTA 5NULA 1J8QA 2RG1A 3L9WA 1H69A 4M0CA 3W77A 1D04A 2X2OA 3OWHA 2ZKIA 2MWMA 4DILA 4N9QA 4ZVLA 4U7HA 1KBOA 1OBOA 5FA6A 1YDGA 4NULA 4YAFA 1SG0A 4QOEA 1YOBA 4ICIA 4GI5A
chains in the Genus database with same CATH superfamily
1TJYA 2E5FA 3DCIA 1LK5A 2WU1A 4ZT3A 3TEFA 2H57A 1PRYA 4NU0A 3TB4A 4AP9A 1UEIA 4K0RA 5INTA 4CLOA 2HDHA 3UMJA 2UKDA 3KLPX 4QYTA 4RY8A 6YASA 3SQWA 2WSSA 3BMCA 1J5XA 3HJFA 4OEHA 1O6BA 1CR0A 3R09A 2FZ5A 4M9UA 1S01A 3ROZA 1L7OA 1SQGA 5I7EA 2FG5A 4POOA 3U4AA 1Y81A 5CG2A 5IARA 3CHYA 3H8WA 3N87A 3MIZA 1U9JA 3JD4A 1E1MA 1QMPA 4ZIRB 3TKAA 1XXHB 3RVSA 1E0DA 4D0LB 2JC3A 3HA2A 3PEEA 1THMA 1EUDA 1N6RA 3UWDA 4A8JC 4A03A 5KOIA 2WZQA 1M2EA 3UAYA 3RPEA 1BZYA 4IJMA 4XRRA 4JXXA 4PRYA 1LNSA 4A0RA 1JJ7A 3V4LA 4C7OA 5EJGA 4GRIA 4ONEA 4CCYB 4DMGA 2IELA 1EJ6A 2IGTA 4LVOA 4DV3B 3ZCXA 4W1SA 4EUKA 1Z9BA 4MZXA 4Z4EA 1E3SA 1EGHA 5E7QA 1L3CA 4YB8A 4RO0A 3MHPA 1C4KA 4H7PA 5LA6A 1Z4IA 2E0IA 4RH0A 4FYJA 3ORSA 1QM5A 4QOHA 5ITWA 5DXAA 1U7UA 1SC1A 3NR2A 1SQSA 1BG6A 1X8JA 1U3TA 3CVUA 1WMEA 2H1WA 1FVOA 2DFKB 2OQRA 4NE9A 1VP9A 1IN6A 3F3YA 2VRNA 1JBEA 1KKMA 4KQJA 3LT1A 4E13A 2XADA 2QE7A 1W96A 1VHTA 1DFHA 1X7GA 3SJUA 2WIBA 1K98A 2WVHA 2OZLA 3KKNA 1FUEA 1KYWA 1RQGA 3G2JA 1EG2A 4J4BA 1R6BX 1JJAA 4LE1A 2QP3A 2AR7A 3BRWD 2H7XA 4IV0A 2PWBA 4B3MB 1DB3A 3THWA 4CR7A 3OD5A 2J5KA 3E03A 3WGQA 1YJ5A 3QWBA 3BA1A 4KODA 1OXBB 4RQAA 1Z6TA 4C2AA 5CYGA 4QA9A 1TK2A 2UV8A 1IHDA 3FVTA 3KTAB 4FBGA 4MVJP 2C2GA 3IAHA 3QIAA 4L72A 2AJLI 3PFBA 1AKRA 2O0KA 3A6DA 3O1HB 4YN3A 4X8HA 5A5EA 2DLNA 1ZOPA 4UUAA 5JJCA 3OCCA 4WCVA 3UTDA 4FMDF 4M1YA 4EUSA 5B6IA 4JH0A 2WQZA 3E3MA 3U5ZB 2VPPA 1BN6A 2HN9A 5AKGA 3SEAA 5DN6A 2PWAA 3BL6A 2Z9CA 3S0JA 3CCCA 1X87A 3UANA 2W2PA 3DBVO 1JZTA 3HKEB 5ALQA 5DOVA 1NJFA 3HB4X 2BEKA 4BWFB 4C5AA 4DJAA 1E6WA 1YQWA 5J5VA 1UXIA 4RSMA 1Z0DA 4XD2A 1FDIA 3ZZMA 3PIRA 3O7MA 4LGCA 3ND7A 4AICA 3DPIA 3KL4A 3L6UA 5C7OO 1LI4A 3GCWA 1F12A 4DCSA 1MA3A 2ZJYA 1E60A 8GPBA 3NDBB 1YL5A 4ZEWA 1E8MA 3L0BA 4BQRA 2JIPA 1Q16A 2E2WA 4GO1A 4HUQA 4FFWA 1UZMA 2QD1A 3H42B 4KN8A 2YZ2A 3L7MA 3JWIA 5FTNA 2Q0XA 2E85A 3DVSX 4FIDA 2XWSA 1JILA 1O97C 1MIOA 1LD3A 2TECE 2Q99A 1F5SA 3B85A 3IIMA 3LT2A 1HZJA 1WZUA 2X1HA 4UM7A 3S2IA 2QD2A 3AY3A 3OPYA 4CJXA 2F1OA 4XM1A 2AJCA 5CB4A 2VNIA 4LYJA 2HFKA 5IJ9B 1VG9B 2EKDA 5HS6A 4I1SA 3VZQA 1KWKA 3VYSB 5CEJA 1IATA 2FEWB 1U63A 2DXIA 2VDQB 4UJ3A 5T8KA 3LMKA 3DFZA 3WJ7A 4XOUA 1P6UA 1TRKA 2P4HX 4TS3A 2XE8A 3IJEB 5ESDA 3WMRA 5IEJA 3GUCA 2GQ0A 3P26A 4HHEA 4F2PA 2P67A 3GRYA 3NB0A 4N49A 4RE5A 1M33A 5AKIA 5GIPE 4DY4A 2ZRMA 5KU7A 1C0KA 3K4HA 3AIIA 1LRJA 3ES9A 3B82A 1YNOA 2UYOA 3F98A 4L8VA 1DTWB 2IP1A 2PSFA 3ENVA 1QPGA 3G2KA 4EEZA 4GC9A 1YS2X 1FXWF 1RQ2A 2GN0A 3QTTA 5EJAA 1YQXA 2D2XA 3V1TC 4C04A 1L5WA 1KPGA 4QHSA 5K45A 3QLUA 1J07A 1U2EA 4PC3A 4EMUA 3GNSA 1Y0BA 2WAXA 3D6TB 3DH0A 4CM4A 1CKEA 4YACA 4RK5A 2CDRA 3P9CA 4XZ3A 3COSA 3L8FA 5LDGA 1Q0UA 3R7WB 2BEJA 3NZEA 3GVXA 1SCUA 3Q3VA 5LC1A 2V5AA 4CMKA 4HQ6A 3HFGA 2FN9A 4QUIA 2R6ZA 3BWVA 4I55F 3V1LA 1INLA 1M0WA 1W76A 5CXQA 3RC8A 2ZT7A 5DYGA 2DULA 2EBUA 1U0HC 4H0NA 2DH6A 3HLTA 3KDSE 1CR6A 2Z9DA 4KR6A 4EG0A 4UE2A 4F21A 2ZBGA 4AN4A 1DQSA 1L8AA 3SIPA 1SR8A 2XJ9A 2J5XA 5D6OA 4PC2A 1XI2A 1SC6A 1Y1PA 2IUEA 5ALOA 3M83A 4JUCA 4P5EA 3ST7A 1P44A 3JQ7B 3QE3A 3S8YA 2Z2KA 1LW6E 3B1KA 4M0DA 2KX7A 2CY0A 3PZRA 1UPAA 3GVPA 1N75A 3PUWA 3QEMA 4LY0A 4R3NA 4RXTA 1OYOA 4BYGA 5KTMA 3AM5A 1W2HA 3RG2A 5CB4F 1Z0AA 4P34A 2RMKA 2GSWA 1JAZA 3M9XA 5EIBD 4HK4A 2RGWA 4PHCA 1IEVA 3GA0A 4A6EA 2JD1A 4I81A 2XI4A 2AI3A 5F73A 1X2EA 3P0HA 4IW3B 5EQJB 2AG5A 1FLVA 3M49A 1RE1A 1WXWA 4I8IA 3KXDA 3U49A 1VL5A 1D6JA 4L28A 1THZA 2J3KA 2ZUTA 4OHVA 3CXRA 3ZW8A 1WF3A 4QXMA 5I4BA 4RXMA 1UH5A 2FZVA 2CLEB 4M8SA 4NOJA 3K6JA 4PV7A 1RWMA 3PWZA 1VSTA 3GJ6A 5DWVA 1ZK3A 4ZC1A 7AT1A 1TUBB 3JWEA 2PS3A 1E59A 4K1XA 3KPVA 3PPWA 2A8YA 4MGYR 3PNYA 3SXJA 3ZI0A 1B93A 3EIXA 2B4RO 4FGUA 4HQOA 4IFBA 3B5JA 2FEAA 3LGXA 3OQ6A 5CX4A 5AKLA 1ZJ5A 5DX0A 3UHJA 1TW2A 2OQVA 3NBFA 3HL4A 3VTFA 2DUNA 3EQ6A 2ZTLA 3BD8A 2NTNA 4AUEA 3AKYA 3ZLBA 4CUZA 2FU5C 4RK4A 2E1PA 5G0VA 2WIKA 3PKJA 4YWHA 4MPDA 3TZ6A 4MKGA 5K3FA 4CUJA 3AFIA 2IE8A 2C2ZA 3UM9A 3OEYA 3K0CA 1QVVA 2QQEA 3UGKA 4ARSA 1QHGA 1E98A 2ZWAA 3CLSC 5KYXB 1T4MA 1EDZA 1YFZA 4DDTA 1FP1D 3JAMA 3MQ4A 4F6RA 4EG6A 1NW9B 2UZAA 3ILVA 2FMHA 3JYQA 2V4MA 3FWYA 2PL1A 2O7SA 4MWBA 1E0SA 1XZJA 1DXYA 5FPSA 1L9KA 1MQAA 2OM6A 4IJKA 4KN6A 4V39A 3IVGA 1X39A 2OCPA 4C6HA 4DSUA 1DJMA 3PC8A 1P5HA 1P77A 3NBKA 4MP3A 2H0RA 3GGPA 1YDFA 3EVAA 2VTBA 1KEEA 3JCZA 1LC0A 3G8AA 3AESA 2QPAA 4OREX 4GKVA 4MTLA 2Y1KA 4NCKA 5L3QA 2RGCA 3IP3A 2M2IA 4C2BA 4W5RA 4QUBA 1A88A 4M0EA 2C2MA 5ALKA 3UMRA 1K1EA 4BN4A 2RBKA 3H2SA 5IAKA 4E5PA 4NCBA 4DIFA 2C88A 3IV7A 5H59A 3IX7A 1D8AA 3Q10A 4IDFA 5IF3A 1V5FA 2OB2A 1LQTA 1DEKA 1EK1A 2Q7XA 1RHKA 2A5LA 2SKEA 1QGUB 2XJ4A 4N6OA 3PRKE 4UNQA 4MW7A 3CUSA 4R5HA 1WDKA 2O2EA 3ETJA 4K9MA 1QCYA 1N2GA 3D6FA 4MRSA 1MB3A 3R44A 3L1HA 4OFWA 3ZE7A 4DGSA 2OGSA 2P91A 2R2AA 2R8XA 4HCJA 1J0XO 2QW1A 3BCRA 4JUAA 5DI3B 1QRDA 4OGWA 2QORA 2R1ZA 3GRUA 4ZCIA 3O4FA 5HF6A 1YMUA 2ZAMA 1R7RA 1ORVA 3H75A 3MOIA 4KWTA 5AR1A 1AV7A 1DKRA 1CUDA 5LJLA 4C3OB 5EJ7A 3P2JA 2JLYA 2Z3ZA 3JQ8A 5I4KA 2P3OA 1I3MA 2R9VA 5AESA 1XTUA 4JYAB 1Z6PA 3KRTA 4QJ4A 1EAYA 3WE7A 4AY6A 1Y9ZA 1AF7A 3T1OA 3JQEA 2HA7A 3B3GA 2PGAA 4OK3A 4JIGA 3TXXA 1HXHA 4GX2A 1PT5A 5I7RA 1VG0B 2PSEA 4URZR 4ZVSA 4P4NA 5BWOA 3A26A 4QYSA 4B45A 2XRYA 2JS7A 3SZGA 3L46A 3JATA 1A7UA 4RLFA 5DEIA 5H0IA 2WUFA 1IOLA 2OYSA 4TSRA 1KRWA 3IPXA 3O74A 4UQPA 1U90A 1P9RA 2E37A 2NXJA 2PGNA 3LC0A 1SXHA 4RDHA 1ES9A 2GCEA 4MWZA 3IALA 3KOXA 3RWOA 2AMFA 1U9YA 4Y1GA 5MGBA 2IOHA 3JAKA 3RDPA 2D2VA 4D3ZA 5HM6A 1FJHA 1UEXC 2IZ0A 4X3CA 2BCGY 3WK8A 4FHCA 5K3DA 3Q1KA 2AWNA 1ZKMA 1W4BA 3PA6A 3WGTA 3PI7A 4B4VA 4BZXA 5C5IA 2I0FA 1H8EA 2G9QA 1LPMA 1A9ZA 2I87A 2VQSA 4WV3A 2WMDA 3IURA 4GMGA 4I1VA 3UCFA 5F2KA 1G19A 1J6UA 1ZCBA 1BFDA 1NQ5A 3D7LA 3T9AA 5HX7A 5IN4A 4FILA 2HXGA 5EKDA 3FNFA 4DLBA 4DXHA 4ZV7A 2H85A 4PAOA 3QU4A 1Z6QA 3CWQA 3EXAA 2R8ZA 3W04A 1SCAA 1E9RA 1PJTA 4ALJA 2GPSA 5EJMA 1TZJA 3P52A 5K6RA 2PUGA 3HYTA 1OTHA 3KOWA 1KVUA 3VYTB 3VR2D 1TC2A 1SAYA 2JDID 2WM8A 2ZBEA 3F2IA 4PLPA 2OY0A 4W9MC 4KQEA 7MHTA 2ZIXB 1KZ6A 4KQWA 1TKAA 3WL5A 5JXIA 2MSCB 2QYTA 3L4JA 1T43A 3ER8A 4P1ZA 4TV8A 3SS8A 4GDMA 3V1MA 2ZI4A 2BT4A 2WKWA 1T2AA 4W8GA 3E5MA 3CLSD 2AUMA 1NLYA 3IODA 4KX3A 2CV1A 1OZAA 2X8AA 3P27A 1V8BA 4FMPA 4Q93A 5JAUA 1OYWA 5A7GA 4E5DA 2C5LA 1QHSA 3HUDA 4UHCA 1DIHA 2RG7A 2ONJA 5K51A 1ZJ4A 2WSMA 2WHPB 3NWBA 1LK7A 3TZCA 4LCBA 3RRXA 3WIDA 3QXGA 2NMVA 2QT9A 1HTTA 2CUZA 1P18A 1VSQA 3VV2A 2C9MA 1U0LA 3JU3A 3LDUA 3GJZA 5E4JA 4QT0A 3A6GA 4MA5A 1SUIA 1M34E 3GGGA 4HVLA 4KKXB 3DKVA 3BILA 5JRDS 2XR1A 1T5LA 3P71T 3LH5A 3WAGA 3W9BA 1B16A 4P81A 4EF6A 1RYEA 1Z38A 2Q50A 2WUVA 3DV0B 3STTA 1Z88A 5EP2A 4NFSA 4U7PB 4AO7A 4L74A 1DEAA 1M1YA 5LOVB 4XX0B 3KSAC 1OFUA 1M34A 3UXEA 1N34B 3DNFA 3O2QB 5JVDF 4V0SA 4BVKA 4ICIA 1WUJS 4PFJA 4J8PA 1DBWA 1Q74A 5EWJB 4HBZA 3HO6A 3OZRA 3MFQA 4F45A 5FUYA 1AVTA 3KQKA 1SCBA 4HP8A 4MIYA 2V65A 3OFNA 3W9SA 2RSLA 4OD0A 3TMKA 1JIVA 2O1EA 2ONCA 4KYTA 3UAWA 2J3EA 3K20A 2P1RA 4ETMA 4F56A 3QENA 4W8OA 3QUTA 4IQ4A 1NMYA 2JNWA 4ZOLF 3V4VB 1PJRA 4XVHA 5KYYB 2LP4Y 1CUBA 1KEPA 1N2EA 1E9FA 2EATA 2GZ2A 3KJXA 2YJ6A 3N8IA 1ODSA 4UASA 2XCRB 4IZ6A 4RJKA 4XARA 4NYIQ 1BE0A 3HXMA 4FYKA 5JEEA 4DSOA 4BJHB 4BJ1A 1ZESA 3ZQUA 4L4XA 2CXRA 2O3SA 1E9DA 1YNSA 2R47A 3AKCA 4Y2RA 2QVLA 5BVGB 4G0VA 4NJEB 4RVCA 2O8CB 2PYIA 1TO1E 3MUFA 1Q22A 721PA 4X90A 2WUGA 5E9WA 5CLLA 2O48X 1G5FA 1U8XX 3C41J 2IIQA 2PR2A 4O4IF 1KU0A 1OGIA 4OYHA 4PHHA 4P5PA 2RGAA 4XUGB 3W3AD 4TVSA 1SEPA 1MF7A 2P77A 4U63A 2Q2WA 3EMDA 2R8EA 4PZ0A 5TGTA 3EF0A 4YCNA 3KAKA 2EZ8A 4JJIA 3K8OE 2P3QA 2B1QA 3F1KA 3AVTA 1FBTA 2YJ4A 2JFXA 4XTCS 4EG3A 4EY4A 3TGLA 3NNDA 1KVTA 4JMLA 2XCTB 3JSXA 1MX3A 4MS1B 3S5UA 1P1RA 1V3QE 3FLBA 4WIAA 1X7YB 2X2OA 3WHKA 2YDYA 3DZKA 1Z4LA 4C21A 3M6AA 4ZPJA 2HW8A 3NP7A 2H2DA 1EBUA 5HKBA 2JGAA 3ADOA 3CW8X 3NHZA 3MRTA 4AZ3B 3F8WA 1Q95A 2BHRA 1FY2A 4FFBB 2RONA 3G7NA 4ALLA 4DANA 2WYHA 4CCAA 1XTKA 1GSOA 2ZYGA 1TVMA 3GFQA 2EGGA 3K9BA 1KTVA 5F3RA 4EVSA 4O2AB 1G6KA 5J2UF 4N3AA 3AP2A 3EIOA 2I3ZA 3N8GA 2O06A 4D46A 5C5EA 5K7SA 2FEMA 2P9QA 4LZNA 2AH5A 3CMMA 1I3CA 1M0SA 3FW1A 3IQXA 1RJ9A 2VTEA 2HRQA 1XCBA 2LRHA 4CCSA 3NXSA 4XASA 1EBFA 1EHCA 5ALLA 3RYHB 3ANTA 5AJZA 3I9OA 3D1VA 2LIVA 1ISSA 3E7DA 5EEHA 3AUYA 3ADCA 3LS2A 4UD6A 3DCYA 3KLMX 4BNHA 4N6NA 1BCSB 1K7SN 4WCDA 4DMFA 2GZ3A 5AM0A 3P1JA 2YRWA 5FKJA 4DUPA 4WVLA 5D1NA 4LC1A 4YRDA 1CV2A 5SV2A 5K8LA 2QUKA 4H59A 4F4HA 4HLNA 2Z8ZA 4ENQA 5DT2A 4ZYYA 4KDFA 3PDIA 2O7VA 2C5HA 2HPAA 1OX4A 2Q41A 2XH8A 2FFHA 4TMXA 3BXPA 4IX1A 3I5UA 3KZMA 2ATEA 4MOWA 5DSTA 2VNKA 2EIHA 4WOPA 5JISA 2PRJA 4PX9A 4QWMA 5B53A 3U9TA 1OH7A 5E8JA 13PKA 3QM1A 4IJUA 1XDDA 1RM4A 3EZFA 1ULTA 3DP7A 4IZHA 3RUPA 4B8YA 5E4TA 4RESA 3QPDA 3A58B 2FK7A 3G5MA 4GQAA 3GYGA 2Q3LA 1L5ZA 1TOAA 5EI5A 4N5LA 1IHXA 4FQ7A 1U99A 3TWOA 4CN8A 3H2HA 4INJA 1AZTA 1Q84A 2JLWA 1Z4OA 1L7NA 1M5UA 2CMHA 4MGIR 4B6QA 4O4HF 4U5QA 2VDOB 3W7VA 2F3TA 1HEIA 2BLNA 1NY6A 4LHYA 5ISMA 2AG6A 1OOEA 4EDFA 3BXHA 1M72A 3DXXA 5K01A 2P9GA 1SU7A 1WO8A 2FWIA 4U00A 3WRXC 3K9LA 4ZK2A 1KTIA 4CFZA 3DCNA 5A7HA 3S2YA 1XDZA 3WXMA 1NI3A 1WQ1R 2JEOA 1RPAA 4E7PA 3QKRA 1NQTA 2HFJA 2OBBA 1NP6A 3O31A 1B2RA 3HUFA 4NBLA 3DBRB 1R4NA 1WEHA 3FWPA 3A31A 3BKWA 4YWJA 4RY9A 1XXHE 5KQMA 1D2GA 2ZWOA 1GYRA 1H5UA 5SYNA 2IZZA 1R0YA 4YMSA 2IRWA 1MO6A 3QF4B 3HACA 1GNPA 1PR1A 2BDUA 3LUDA 2FFJA 1T0IA 1O9HA 1USKA 2WTAA 5LA6B 3U19A 2O57A 3ZYZA 3WHLA 4QYWA 1I4LD 4BKOA 1XX6A 5A04A 3QVUA 1SEVA 3OFKA 4RZUA 4YV2A 4OHUA 1FTSA 3E48A 4V24A 2W48A 5A9SA 1ATZA 1AS2A 4DTCA 4YHHB 1XWFA 3MPOA 1DQZA 4RJIA 4XQCA 3ZNNA 4DQXA 5FPQA 5KOJB 2R48A 2OZKA 2CE7A 2TMGA 1ZGJA 4M1OA 2BE7A 4FUQA 5M29A 4G1FA 3VOSA 1L5VA 3BSWA 1R64A 2D8AA 3EWIA 3TFQA 1EQAA 3OIGA 4MGKR 4NZNA 3RS4A 5JG7A 1BA3A 3NH6A 3THWB 4DIUA 2ZUVA 3SF8B 2DPYA 4DPKA 1QNLA 3HUTA 4YRGA 4XSHA 5EE0A 4ZAGA 2QLNA 1LBEA 3OAAD 3PGA1 4H08A 2B4AA 1B0AA 1W9MA 5E9QA 3FJOA 4CR8A 3A04A 1TIKA 4DRXA 1XAHA 1YK0A 3W9UA 5KC8A 1K4KA 4BDSA 1SUPA 3VYWA 2GPNA 4IHJF 4Q9AA 2EARA 1RZRD 2CVZA 4YRKA 3E8MA 1MA0A 1GZ5A 2LCFA 3VRHA 1X7WA 4RS4A 4EJ6A 4MI6A 1V5EA 3BMXA 1O89A 2FPGB 2H2GA 2X6QA 2Z2YA 3AEYA 3J80A 5IC5A 5K8CA 2Y1DA 3LCUA 1CZHA 4CLRB 5CR9A 5JUWA 2B4KA 1ZSVA 4FMCF 1XGKA 3UV7A 2CE2X 1EFLA 3HYLA 3BTVA 4NS1A 5I8WA 1H5NA 1TJNA 3DDHA 4NOKA 4YJ3F 1AM4D 4XW2A 4FFNA 3PUYA 3ZK7A 4CL3A 5IVHA 1SKUA 3ASZA 4X6YA 1QC5A 1G5QA 1H1TA 3LPMA 4LIPD 2IITA 2XF8A 3R3VA 1N1DA 1ZNQO 4NH0A 3IUJA 1BD3A 3MCVA 4O0LA 4HUQB 3ZJVA 1P5RA 1VECA 2AL7A 4HDSA 1AK9A 4AIIA 4IP0A 4LX8A 4TLMB 1XIVA 4G24A 4L3VA 5CLQA 4S1OA 1YOVB 4R6WA 2EFJA 1N6HA 3D9QX 3D8TA 1U3VA 4U6SA 4YAUA 1BH6A 4MVJA 2HY7A 3T7AA 3BCSA 1XEWY 3OCJA 1NXVA 2H4XA 5FBZA 1WCIB 1R6VA 2G09A 3ONNA 1W5SA 4JP2A 5NLLA 4YK7A 5AJUA 4NE7A 5JT1A 5ALFA 3X1DA 3P2KA 3TLZA 4RLQA 3Q6IA 4NYMR 1O96B 4ISBA 3NBUA 1E9CA 2D7JA 3ER9A 1NBMD 1RLUA 3PFHA 4OQXA 4XJXA 2XUDA 4KBGA 5CIQA 4YI5A 1NT4A 3GJTA 2A7QA 4D45A 1W1WA 4OXXA 3TH5A 5CMLA 2IWRA 4X65B 2QF7A 2A5YB 1CZKA 2ZJ2A 4IQFA 4WI1A 2WU0A 4HZIA 5LQMA 3JZMA 1JWAB 1Y1TA 2RGXA 1BCRB 1N5OX 1UPCA 3ANNA 3RAJA 1QU2A 1JFVA 3DEYX 1YU6A 2UYYA 3FSGA 4YC7A 2HCJB 1AA9A 1L4MA 4FCCA 4IG4A 2XVMA 1RZRA 3TOSA 2POCA 3AUSA 5BXQC 1AX9A 621PA 2C4TA 1C0EA 4L07A 4TYQA 4EPRA 4HDNB 4ZJPA 4PPFA 2W8BB 4FSHA 4JBLA 3ZCTA 5BMOA 5JJBA 3AUFA 1SVSA 4G5XA 3EVZA 4UDNA 1BW9A 1XQYA 2C96A 3TTSA 2P9JA 5C7YA 4N1AA 4EGSA 1E2BA 2BM8A 4LYGA 4NC9A 4OP3A 1PS9A 1LSSA 1WJGA 1MJNA 2JHFA 3FRJA 4G01B 1CNMA 1JWLA 3RYIA 1G98A 5IDQA 4EMSA 1PFUA 2BFWA 3N8DA 4H60A 3A3YA 3CLUC 5TT0A 3WMGA 3TR5A 5FBHA 3J7AC 2KHZA 1VIDA 4RF5A 1RCTE 1QZ3A 2GBGA 2HK9A 3QEMB 2Q3JA 1YZKA 2WT8A 4BLQA 1TIPA 2CLFB 5JSUA 3MINB 5K2MA 5E2AA 1ZVVA 2C84A 2C3MA 5A6VA 4K1LA 1HNNA 3FD8A 5AM4A 1XZKA 2V7TA 3NRBA 4C30A 2PXCA 2PSHA 1S2DA 1IJFA 1PBTA 3ZDQA 3FUVA 2DFPA 3PR3A 2JLZA 3OT4A 1TZBA 1U02A 4YP7A 4V3BA 1KQNA 5CA1A 3JQBC 4RC9A 2GLXA 3GGOA 4LJSA 5IFKA 4CDNA 1BS2A 1P6QA 2AD5A 2B36A 3SYTA 4AJ1A 2GXAA 2ZOSA 3GZNA 4A0GA 1TK3A 2PS9A 5H16A 1HO3A 1D4AA 4J3JA 1JXAA 4ACBA 3IAUA 1UFQA 2P4QA 1XEXA 2HMVA 1T1SA 2OHFA 1U2GA 3KYIB 4L8FA 1R10A 4U4AA 3TPZA 3W6NA 1SXJC 1R16A 3A8TA 4S3MA 1VKZA 2A9FA 3PS9A 4QNMA 4E2YA 3MMSA 1EFKA 2V03A 2JBWA 3COYA 1J1ZA 1RKVA 4NATA 5AJWA 2ADOA 2DYKA 2B8WA 1XF1A 2QK4A 2IK8A 2QMQA 2VQ6A 4BLWA 3K1ZA 4I36A 4FZJA 1N5KA 4C06A 4KQ6A 1EX9A 5DNUA 4ZAWA 3IUMA 4GI2A 1XQXA 5CLIA 5GAJA 3UXHA 1XPUA 1E5XA 1G3UA 3BQNB 3D2LA 4BNDB 1Z0JA 4OV6B 1X7XB 2QZ9A 3QLJA 2XRMA 5AP9A 1QH1B 4I8DA 1XD8A 3V7YA 3ZJ4A 2ZUEA 4EJSA 3MUEA 4HNUA 1E1DA 1WXQA 2NQ8A 1EX1A 4BO8A 4PRZA 2YIDA 3AI2A 3EXFA 4GXNA 2PPVA 3DMTC 3KQLA 3R6LA 1PL8A 3TQOA 3GDWA 5TF4A 3QVGB 1XMJA 5DM70 1PZEA 5THXA 2OOSA 1CQXA 1D9ZA 2R62A 2H7YA 5FT9A 2D6FA 1Y37A 2VDNB 3EGIA 3I52A 3GDFA 2G36A 4RFSB 5F78A 2GJKA 4WD3A 4H4CA 1FSZA 3EF1A 4R8SA 1XVAA 2BMWA 1JS1X 4OJKA 1FP6A 4XX1A 3SBDA 2UAGA 4CN9A 2OXCA 2XDAA 2J9XB 1R9MA 2GETA 2WLTA 3KFLA 5DASA 3P9XA 1H3EA 3WIVA 4F5EA 1JEQB 3VC2A 4ZJUA 1ORWA 1H2HA 5ALVA 1RWOA 2H0AA 2RGDA 4QYIA 1PWZA 1QORA 1KZ9A 2P3LA 4JOBA 4E2ZA 1XL1A 2NACA 2X23A 3ETGA 4H0CA 2J3QA 4MRAA 3ND9A 4L27A 4NEQA 5CHEA 5ALZA 4LNAA 4Y2GA 3C5EA 2AMYA 1W4ZA 3DC2A 3GEBA 3A10A 3ZK8A 1EVEA 4OXRA 5ENVA 3TZHA 5FNVA 1QFMA 1ST2A 2R6GA 2ZB4A 1TA4A 3EYWA 2RGBA 3CN9A 4RJ2A 4M6WB 4X1YB 3R75A 4OB8A 3ORHA 1UOEA 3ETNA 2YWHA 5A5FA 2HA2A 4BO4A 4JC0A 2GXQA 3K4PA 3PYMA 2J32A 2XGOA 2YOHA 2HA6A 2P41A 4KXNA 1TQ2A 1YOBA 2C7VA 3MQFA 5BOSB 2EP5A 5DF1A 2FW6A 3ASUA 3F9CA 1WOYA 3LPNA 1JLHA 4X1KA 4C4RA 1LPBB 1Z0UA 4Y0VA 3ZE6A 4EGJA 3B3FA 4GD3Q 1GAJA 3R76A 2ORWA 4OX9B 3I1FA 4JBIA 3W8NA 4BCBA 4OHYA 1NJSA 1CLEA 3GMSA 4IFTA 3FZEA 1Y5RA 4LI0A 4ZI3A 3R40A 3WK6A 5KDDA 4PX3A 5BSTA 4IV5A 2G4VA 1RE0A 3QKWA 3FJ1A 4UBLA 3TXYA 4E51A 4ERNA 5BUZA 4E46A 2ABWA 1P7YA 5GGYA 3MQ2A 1NWHA 3IKJA 4UTNA 1JR3D 4BJ3A 1SHKA 1L1EA 4C01A 3MTIA 1ZUIA 4HPJB 2COEA 2EKBA 3PGXA 4V0OA 4MQ4A 4RKQA 3QTBA 4AXXA 3WDSA 5LQKA 5KNDA 2I7CA 4OK5A 3AJRA 1A2OA 2NXCA 1PTJC 2L17A 2XITA 1OX6A 4YREA 5AVQA 2WIJA 4KPUB 5GVSA 5LDDC 3EK2A 4MKZA 1OCEA 1WF6A 3DE3X 1W4AA 4HNRA 3K73O 4FJ2A 3TR0A 5HPYB 1JEEA 5KOYA 3F6PA 4PIPA 3ME5A 1DARA 1P2VA 1PJAA 1XN4A 3G02A 4PPNA 4BEBA 1RBYA 2MTBA 1VLHA 4X84A 4K2AA 4NOMA 4F9FA 1BKDR 1O95D 3OUUA 4UUOA 5EIAA 2FSVA 4BCDA 1EFPA 2GCNA 4R1NA 4RS3A 1MFPA 1IOVA 1V3UA 2PZAA 2ZCVA 3IQGX 3A14A 4MR9A 4H6WA 1PK7A 5FOQA 4LF7B 5KYTA 1B23P 5DHFA 3ZWBA 1TVKA 3GN1A 4Q00A 2XQFA 1PSWA 4HI0E 5JY6A 2GLTA 2WG0A 4WECA 3EIWA 3RIXA 4B7UA 1T29A 2F9LA 3VZDA 1FDVA 4F9TA 1B41A 2V58A 3U4IA 1EUCA 1HQKA 4GL2A 1SCNE 1HY3A 1ZONA 4GM0A 3ESCA 1ZXBA 4TXMA 1IZ0A 1DAHA 1XZCA 4M36A 1RYYA 3K0BA 4URFA 5DI9A 2AZXA 3ZXUB 2JLQA 1AKVA 2HNAA 1KAGA 2AN1A 4YJGB 3W78A 4IIJB 2WJ4A 2YJTD 2A14A 2JJ1D 5FWXA 2GN2A 2NZ8A 1YB6A 3UXMA 3ID6C 2J59A 3CRQA 4KOAA 3E9NA 1A8UA 3ENZA 3K5HA 5TVKA 1G8YA 1XT6A 4HNQA 2A4MA 4YR7A 4B3GA 3RTGA 2P5TB 1ISMA 2QP9X 3HCDA 4HYEA 5JBQA 3O75A 3OLCX 5JAZA 1EGVB 2HPHA 3SDZA 1OH5A 1NW6A 4P32A 1XYYA 4LCEA 5B3JA 4PHFA 3ZHYA 5C2JB 1M34B 1NG1A 4QECA 4EHLA 1Z6GA 1CQIA 2DPLA 2GRJA 2Q8QA 1FSGA 3JVUA 3N58A 5J2UB 3SS7X 4JI6B 4BNZA 5I48A 1XCOA 1G21E 1CQWA 1KSHA 4LMPA 1IN8A 3ZEIA 1WSBA 2SKDA 3TSZA 4DLLA 2RHJA 4DLPA 4EW2A 1YZLA 2CBGA 2MYUA 4DCNA 3AKDA 1ECGA 3GLSA 3ROMA 3TINA 5CYPA 3GCXA 1W49A 3OWHA 5JFGA 3W3AH 4LG1A 4EDHA 5KYYA 1U0EA 2VEOA 3IAFA 4L4RA 1CX9B 2WD9A 3ZLUA 4JUIA 4L6AA 5LP6C 5FLXA 1F2TA 2H5EA 5KNLA 3VPGA 3QFSA 4BNJA 1F8YA 1S7CA 2NTEA 2BFDA 3D8SA 3P0IA 4TV9F 5IMSA 5DNYB 4GT1A 3U9SA 1IY2A 4A8JB 4CI0B 1W59A 5TE9A 1TJ5A 1QYIA 3B7WA 5B3KA 2RC6A 3NKFA 1S4MA 1QP8A 4F7DA 2QMYA 2JI9A 1I2DA 1GG9A 2GCGA 1I1NA 2CZQA 2DPXA 2MHCA 3N2LA 3OM9A 4IXWA 3TDNA 3WMFA 4EVIA 5B4VA 1SKYE 5IRCD 3P9SA 1P3Y1 1YAHA 2O8NA 3N1UA 1AQYA 3IJRA 4C87A 1D7AA 2DBQA 2P5YA 3SZLA 3U7EB 3KZXA 2CHEA 4XD7D 3OI7A 3ZD9A 4IF4A 4ZYUA 2C1ZA 1P33A 1SCJA 1P1FA 2XHEA 3VAYA 3GGDA 3CNOA 3PWKA 5C9ZA 2FUG6 2ZIEA 5DKFA 1WBDA 1QYDA 2FPPB 5I9TA 2PX2A 4YRPA 4HX2A 5TF0A 5K6AC 1WKBA 3EIHA 4GECA 1LEHA 3PQDA 2X9GA 2EYQA 1R6DA 3MD0A 1K7YA 2G9UA 1H66A 3QUAA 2XT9A 4ZMRA 5TQ2B 3M3PA 3B60A 4AN0A 1TO6A 1UJNA 1K86A 2I67A 3BDIA 1ZJZA 1BGVA 3SLKA 3EAFA 3H04A 4ML3A 4MV9A 5FORA 3HJNA 5IAAA 5IZCC 4OHCA 2JBHA 2GEUA 2YJNA 4UTOA 2ZM5A 1DNPA 2FLKA 3IH5A 5A06A 2CBXA 2JJ2A 1T0PA 4KR2A 1YE8A 1N6KA 3DZ8A 4NU8X 4FTWA 4BRZA 3IVRA 1X7HA 2H9YA 1HEUA 4LWQA 3TW0A 1XMSA 3CNEA 3GD5A 3GQVA 3IBFA 1NJ1A 2JGDB 4LNUA 5TIIA 4HQ0A 6GPBA 5GZ6A 4YT4A 3RF6A 5DOZA 1RWPA 3LG2A 1ECFA 3MCAA 3SHOA 2GK6A 2Y67A 3I30X 4RPKA 4HATA 2XOXA 4W1RA 4YT2A 4EKDA 1LBSA 4BZPA 5JVDA 2VT7A 2GN6A 1YB1A 1BD4A 3PUZA 1E18A 3FPJA 3QX7A 1L5SA 4M1EA 1QV6A 5GM2A 3PNPA 4MVJM 4Y9RA 3I6IA 5C1OA 1MAHA 3QKSA 4GZLA 4JOQA 2P6UA 3ASVA 2FZGA 1RAFA 3MTEA 4TPKA 1RQLA 3E27A 4W5TA 2XCSB 5AM3A 2IEBA 4FOLA 2OGZA 3C3WA 4K9LA 1IBRA 1Z5GA 3W5AA 1TT5B 1OXXK 3A9SA 5I7SA 2RIRA 4C0SA 1G6Q1 4Z4FA 5DFAA 3K0AB 1E9EA 5EUMA 1OLUA 3I23A 1LU9A 4UUNA 5D87A 2NUTA 5KYVA 2Q45A 5E9JA 5JD4A 1IWBB 2ON6A 4XIFA 5ULLA 4P3PA 4EZIA 5FHQA 3Q7PA 3E5RA 4JLPA 4DOMA 4AJNA 4EKIA 2ENUA 1RJFA 2HMUA 2DLCX 1ML3A 3KOZA 3RW9A 2ZSIA 5HCNA 1I6WA 5J9FA 4L75A 3DAHA 3AR2A 1W29A 1FMTA 3NWOA 4J0KA 2HX1A 5IZCA 1Z4KA 4LV8B 4LBYA 3NYRA 3PKZA 5HUJA 4XYEA 5KX5A 2I4NA 3NRCA 5I3ZA 1AO0A 5JZVA 1S2LA 3HKBB 1EXDA 4ALNA 4PBRA 4HLDA 1E1CA 2GN9A 4DQVA 3MK31 5C3MA 1NV8A 2P7HA 2PIDA 2BFFA 4YRMA 3HJHA 3GMIA 2BHSA 4GBED 3K9WA 1ABBA 4GNRA 1KSJA 2GF0A 3WNDA 1CZOA 2IYFA 1KJIA 3DBHB 3QF4A 4DWWA 3NHMA 2PKWA 2NO9A 2HGZA 4FZ3A 2R4QA 4KO3S 5LUBA 2WTMA 3W34A 4QXRA 4B73A 3SBOA 2IY8A 2GBCA 3JQ9A 3VNUA 3JZAA 1RC0A 3BIJA 3R5HA 1ZD3A 4KVAA 3HA3A 1SJ9A 1JSCA 3PDUA 2XD9A 1IVYA 1JIIA 2L19A 3ROEA 2HMAA 5BUCA 2NSLA 4LJ8A 3NONA 4PZDA 1UEJA 3GZ4A 4HQLA 3UW3A 5KOJA 2ORIA 2XNJA 1T5HX 1QKJA 1FFXA 1B1CA 2IT1A 2X2PA 3KYDA 1BE8A 1IY1A 1DIRA 2ORYA 1H65A 3U6BA 3DYIA 2V0CA 2Y9MB 3IAEA 4PZCA 1TL7C 3RU3A 4G8CA 4UATA 5UKDA 2OBFA 1JIQA 1V9CA 2NSJA 2AN3A 3NHSA 1TEHA 4O2BF 4GF5A 4DCPA 4LC0A 4EW3A 1GFSA 3SAJA 3PUVA 4DRXB 2AX3A 1I01A 3IR5A 4F4JA 3V8EA 2DX7A 2WF6A 1XZPA 4P4SB 1QRAA 1PG5A 2F90A 3U44B 4LPKA 4ZQCB 2GT1A 2XPCA 3H05A 2IPAB 4BFTA 3A28A 4NBRA 1EPUA 4CQMA 1ENYA 4OKSA 3K5PA 2GKOA 1XLUA 2ONKA 3UOWA 3EH1A 3N74A 2JFGA 3LXXA 3Q3JB 4Y6RA 1GKYA 3UKDA 3WGHA 3ZWMA 1ZU4A 1ZRNA 3R7FA 2LUOA 1ZOLA 5FJJA 5K4GA 1JPJA 3E58A 4N4AA 4WFKA 1DVRA 3VU0A 4ARIA 1H6AA 4K28A 3R7NA 4ARBA 4S04A 1P2FA 1WOMA 2JZCA 3WLHA 1NQOA 4JEIA 4KP7A 1M6VA 3EPHA 5H68A 2FV8A 4KO2S 4C5CA 1JECA 4OSEA 2X2EA 4TWBA 4PLGA 3GUVA 1Y3FE 2E1RA 3MIIA 1QC5B 2JGEA 1BHJA 4FT2A 4JIMA 4ZRDA 2CDAA 1RI4A 4YAEA 4PPYA 1M5TA 2ZIGA 3A9CA 1A3CA 1MAAA 1SUWA 4ZMSA 1XZIA 4OO3A 1FFEA 4WXMA 3O21A 2Y0EA 4Y1RB 4DADA 2QSZA 1YS7A 1N3LA 3WV5A 3I8SA 3CBQA 4R1QA 4COOA 5KNBA 3QPUA 4R2XA 3PTZA 4OSOA 4WXYB 4AX4A 1KMHA 3D6VA 5JO0A 1U4OA 2CLMB 2OPBA 2X0DA 1ULHA 2LWIA 3BSFA 2C59A 3GW8A 1OC4A 4RH1A 2B2CA 3PJRA 2W6CX 3COPA 5E6RA 3PUHA 1OIVA 4NKRA 3VXKA 3V9AA 3RK1A 4R2IA 4YR9A 3U60B 1OZFA 2PH7A 1WPGA 3H5TA 3W1VA 2VOEA 3KU1A 3IKTA 1R1DA 3SJ7A 1T6BY 3LCMA 2DFDA 2PX3A 5A9TA 1USVA 2AFHA 2C4MA 4KR3A 3ICEA 5ITZB 2AHOA 3P4YA 1JEYB 4DQKA 3PK0A 4KXMA 2O5RA 1UQTA 3HDHA 2HJRA 4LCJA 2QN9A 4GX1A 4MW9A 2YWFA 3ILHA 3AL2A 4OM7A 2J0UA 4ZQGA 3X2EA 1EK0A 3H9JA 4WEQA 4P3OA 2NO6A 1H6CA 4OQFA 1T4DA 4HVTA 4O4LF 1FYDA 5LLDA 3LOQA 4DNOA 1P72A 3BSYA 3DA8A 5EZ6B 2ASEA 2HHAA 2Z56A 5DBHX 4KI7A 1QS0B 2CXTA 4XH9B 3AEQB 2V4UA 4DV0B 3FETA 1HF3A 4WY8A 1QP7A 1RBQA 1NDHA 2VP5A 3N7TA 1B3RA 2A9RA 1QB7A 4F5WA 1UF9A 1ETUA 4BFYA 1DKUA 1YFLA 2WTEA 1FLNA 2Y2VA 2IHBA 3H83A 2WE8A 4L1KA 3SXUB 2VQEB 3JY6A 1X70A 1F9AA 4UBJA 2HF7A 3TRFA 1WUYA 4XM2A 3GV0A 5HF8A 1C9JA 3CH5A 1VE6A 3QUSA 1TEXA 2GAAA 3VZRA 421PA 2R1VA 5EJ8A 1QE3A 1Y5IA 3HXLA 1QGAA 1MT0A 1FRFS 2ZWPA 2FHPA 5AK4A 5JSFA 3SWWA 4KEAA 1XRPA 1LLUA 3R7AA 1S9HA 3IVCA 4DBLC 4B3CA 2C9YA 3LLVA 1KS2A 3FPSA 5DYNA 2HPVA 2VDKB 3G2MA 2J3LA 4Y2JA 1WL8A 1EX6A 4LRTB 5CDFA 3ZBUA 3QPBA 3OIWA 2GS9A 1YRHA 1JG4A 1JHZA 2DBRA 1LBTA 2Q5LA 2ZRQA 3PRYA 1ENPA 1WUTA 4PGHA 1KEKA 1N9ZA 1EUDB 2V1UA 4EYEA 1WZIA 4EKYA 1U9ZA 3BICA 1YA8A 3ZLTA 4DNFA 5JZBA 1L5FA 1LS1A 3CF4G 1XEXB 2IGBA 4HJRA 3ZE1B 1KDYA 3OPNA 5FOTA 1I94B 1II0A 1DE0A 1O77A 2WSBA 3O1LA 1PLKA 5F33A 3FX2A 5I7UA 2PQ2A 4DREA 1E4VA 1L6IA 2NO1A 4Y2SA 4H1UA 3DHVA 4HWTA 1S5PA 2FJ0A 5BSMA 4EKGA 2BPOA 4ZVKA 1HG1A 3ROPA 4X63A 2W2QA 4L7QA 3VNVA 2ZRBA 3IUBA 2JFOA 1BA2A 1N6OA 4LWOA 1TUGA 1K27A 1USUA 2AV6A 4PZEA 3H2BA 5IT0A 1BGWA 4Z4QA 1XNHA 3W7AA 1LLDA 4AP5A 5IT4A 5LSAA 3O1JC 4G0NA 3PC2A 2BSQA 4JBXA 1GN8A 2HNBA 1NVVR 2HPZA 4TMTA 3OEHD 5C46F 5K9ZA 2WKQA 5AOVA 5FCDA 1WPXA 3TUJC 2C9ZA 4RIIA 4B1FA 3DOFA 5JQWA 2VJPA 5EXXA 1XZMA 2IYUA 1DCKA 2PZEA 3I73A 4M1SA 1LGYA 4F3RA 3U3XA 2B99A 4MVXA 4D9EA 1C30B 1Z74A 3GJ5A 1ULUA 3I5AA 5AW5A 2O1XA 2O8DB 2J08A 4MYUA 5CXSA 2X5KO 4HYTA 1FZTA 2FPUA 4PGMA 3SNKA 4P36A 4I50F 3UC5A 4CIWA 4M1QA 4WOKA 1I7NA 3UUEA 1QGYA 4X91A 1OIWA 3DZHA 5B37A 5DTQA 5DYWA 5IKEA 4RY2A 1P81A 5JZ9A 5A5VA 4L5AA 4MB0A 1UDCA 4II7A 3W4KA 3OJWA 5JW6A 4WNAA 1Q7RA 1XZQA 3UB3A 1PIWA 1U0RA 3L2OB 3QJYA 1P62B 5LBUA 5J2TA 2FW9A 5DDIP 1C0IA 4BX0A 5A2QA 4J94A 2PLRA 2EGUA 1BC5A 1KI2A 3GEGA 3JS5A 4G84A 5D7NA 5EQDA 4JGGA 3STVA 4DFDA 1H9CA 2X3YA 2MDTA 1GA1A 1X7ZA 2P2LA 3HJAA 1TEZA 3WRVA 3BWMA 2IYQA 4I50A 5CLGA 1A2QA 3E1GA 1RW4A 1NMQA 3EVGA 3N7UA 4B8ZA 5J4YA 4I1YA 2GBFA 5T41A 1AJEA 2RHRA 3DEHA 5FNVB 2VA8A 5LLTA 1HDGO 4ZJYA 1P0FA 1N8TA 2AG8A 2X4LA 2X9LA 2ZB7A 4Z8YA 1XZHA 4D9KA 3USES 3O8OA 4G1BA 1J9GA 1HMPA 1Z5OA 1U1GA 2CFOA 3CC8A 2ZYRA 4P38A 4DLXA 5KKAA 1UXJA 4CYMA 3UWOA 2Z83A 2YVAA 1VHJA 3I5MA 4P3YA 3PCTA 2C5GA 3C3XA 3RQIA 1PDWA 2A9PA 1JLMA 1SBNE 3VM6A 3K4QA 3ZTYA 3SQMA 1QQAA 2N42A 4HG2A 2PL9A 1RQNA 4JB3A 1HETA 3W5SA 2V45A 2XDQB 2ZQYA 1S0UA 3E4CA 4YJFA 3G2OA 4QTTB 2P62A 2ID9A 4FGSA 4HX9A 4TLDA 3R6WA 4UVEA 1C3LA 1NVXQ 1DCTA 2GAOA 2D2EA 3HNRA 3MS2A 1IXRC 1P2BA 4ZU6X 4AKSA 2QE7D 5C5CA 3E0XA 3DTVD 4JJ6A 2ZUFA 2XTZA 4PO9A 3Q8WA 1EK5A 1MJGM 2PSJA 1L7AA 3WLFA 1F4VA 2WSIA 2XY4A 5ALTA 1KZHA 1Q0SA 1FJGB 5JJIA 3LF2A 3FVWA 1XCLA 1Y3CE 3D6UA 3I28A 5DCWA 1ZVKA 5L3SA 1EB8A 1G63A 3BEOA 4MI3A 5A0FA 3I53A 4KK4A 3WK4A 4O33A 5IUJC 2Q6KA 2B8TA 1E7SA 3QLTA 1YVPA 1U8UA 2IV3A 5AUPB 1VMIA 4G63A 4I9GA 1F17A 3QE2A 3AONB 3IAM1 3I4CA 5EJ4A 2ZK7A 1SG9A 1MAVA 3FLAA 1EU1A 2QRQA 3PNQA 3CPSA 4GWLA 2XHZA 5K8JB 4BMCA 1XAIA 3I3OA 3BSSA 4TUYA 4G5SA 4PZ9A 1JSRA 1W5EA 1XKXA 3DJFA 5CBKA 2O8FA 3A4YA 3DDZX 2BTQB 3EDQA 3WGJA 4D02A 1HPLA 2CB0A 2PO5A 1J21A 1GRVA 5E0OA 2NP7A 1K08A 4N5HX 3WJ2A 3ONVA 2PNJA 1GQFA 4E4RA 1NDUA 3GCZA 1B26A 2NU7A 1RRMA 1N0WA 2BYTA 1Z5ZA 1RI5A 3GFVA 3GT0A 3OQMA 3MBIA 4R0VA 1EIZA 3RF7A 1RWXA 3UWPA 3WGNA 5GJBA 1FFAA 1PNQA 2VFAA 5JNVA 1HZZA 4NMWA 4TMWA 5JYEA 5DXJA 4AQDA 3QUQA 5JARA 2XB4A 3GLIB 3V1YA 4DJEC 3KD2A 5B64A 1DAEA 3MNFA 4IWYA 3T99A 4IHKA 4Q9HA 3FNIA 3K8ZA 2UUOA 3WYNA 3VV3A 8ATCA 3SQOA 4DMKA 2OCIA 4BMPB 3OZXA 1NVEA 4MW1A 2XD4A 2NVBA 3RJ5A 1V6AA 1E2DA 4HNHA 4GR5A 1XF9A 3WY9A 1L7BA 2I33A 4DAEA 1DV1A 3WLIA 3NI2A 4LWPA 2JJYA 4JUFA 1HGXA 1TFRA 4YECA 4ZOQI 5JDIC 2DR0A 2IH5A 1FU8A 1EK2A 2PX5A 3IP7A 3S2GA 4TTPA 3A6FA 1YQ9A 2Q1UA 1GNSA 1Q2XA 3IXLA 4MJ3A 5B12A 4QJBA 1RMYA 2I29A 1D5CA 4MAAA 3EFOB 3ZDAA 1Z35A 1S2IA 1WKVA 2ZJOA 2W6IA 3ABIA 1I7DA 5F9FA 1RDFA 1J20A 4RJJA 1XRSB 3GDHA 4B6SA 5EIOA 3D3EA 1YJAA 5C32A 1PL6A 3ANMA 1QKKA 4KO8A 3LE8A 4LJKA 3OESA 3F9IA 2WWTA 4QICA 5CTJA 5DP2A 5KTKA 4UCWA 4EA9A 1P73A 2TMDA 5JAHA 1M1YE 2FP3A 3C43A 5G1PA 3OZUA 3UJNA 2D5BA 3DMDA 5FI1B 2YR0A 3CN7A 3DAPA 3DKPA 1WHSA 1WR8A 5CFOA 2K5UA 3BH0A 2Z8XA 4RA6A 5H4GA 3EWSA 2O19A 2W2KA 1J7KA 4N3CA 2XUPA 1SZPA 4MW4A 4BBAA 4YUYA 1Y3IA 3QLVC 1UPFA 4K03A 5D84A 5HJEA 1J8MF 1U3UA 5ALRA 3IHKA 3AY7A 3FHTA 3DD1A 3NM6B 2RJNA 2YXEA 3ET4A 4HX5A 3T54A 1PCXA 3GEIA 4V1CB 5LMNB 3G5LA 2W6MA 5F21A 2J6IA 1GKIA 3FBGA 4B80A 4Q9NA 1LA2A 1KEEB 1E2QA 1QCCA 3H1GA 4N18A 4L5IA 4R8LA 1R15A 5DRYA 5C34B 2DEUA 1KK0A 1ACMA 1JMYA 1GVNB 1UT6A 3FBWA 1VE1A 3AF5A 3ZE9A 1J5PA 1EUYA 2Q1SA 4H7DA 1TCBA 1CB0A 2MYNA 1E0AA 1YWGO 4RW0A 4HRAA 1CRLA 4CMHA 3TN7A 3QP9A 3KTDA 5L3RA 1P5FA 3V4OA 4ENUA 3IOEA 1W0JD 3M6FA 1SKYB 4EX6A 1OWOA 4KWIA 2F1JA 3PFKA 3ZZNA 4RK1A 2HQ1A 4HNSA 2JG3A 1UPBA 1H2EA 1T8RA 2P9BA 1AN9A 2DUUA 1PKEA 4MVJD 3UF0A 3W5JA 4CCWA 4JKYA 3QBTA 5CBPB 4Q12A 1YS1X 1GKUB 1YCDA 1UINA 4H3SA 4LDRA 3VBCA 3EQ2A 4AT1A 1CEEA 4Q9JA 2ERCA 5GV7A 4U6NA 1L5HA 4J1TC 2AB0A 2DR2A 1DG3A 1OBFO 1W5AA 2XMDA 3GQBB 3HEMA 1ZUNB 3MJRA 1F3OA 1FRVA 1ZUWA 2BGMA 2BGRA 3OPYI 5TEVA 3S68A 1OH6A 1NTRA 1OJ7A 2HDNB 5DBOA 1SQ0A 1TD1A 4DCCA 1C5KA 3I62A 3VJRA 3RIGA 1NWCA 3K5WA 4AJKA 5BR8B 3HR7A 5I9MA 1HRKA 3D4IA 2D00A 3Q2IA 3QNMA 2VG8A 5FOXA 4IIYA 1U7HA 3N2YA 1N8NA 3UFXB 3IV9A 4L9RA 3UK0A 2FMKA 3ZE2B 2AF3C 2PD6A 4Z4CA 5ALDA 5CVUA 3JATB 3VX3A 1JBQA 2AC4A 3G9UA 2H11A 5KIAA 1IQ0A 1DUIA 1NGSA 3MJVA 3VHQA 1TT5A 4M37A 4ZEOA 1MABB 2G82A 2I9PA 2RCYA 1K6IA 3EZLA 3GH1A 4YRNA 1TF5A 3OZCA 5EP1A 3KR1A 4MS3A 4HDOB 4KDEA 4DCGA 2HQBA 4TV9A 1QGDA 4RVOA 5FUBA 1I3NA 3NKLA 4ND3A 1YB7A 2YX1A 1G3MA 3H11B 1PS0A 5JY1A 1W0CA 3TLYA 4BLUA 4KQIA 2GEBA 5BNTA 2PUTA 1OLSB 4P83A 3JR3A 2XMPA 4A26A 3ZS8A 2MMCA 1X92A 4DLRA 4GP9A 4BUJA 2AZDA 3D5EA 1JT9A 4JVOA 3WLKX 1U8CB 3QFHA 5REQA 4W6QA 2XCOA 4EF5A 5C31A 2IXBA 3PE6A 2X0EA 3ZQJA 5JAMA 2V74B 4UM8B 2BGJA 4ISCA 1CY2A 4REQB 4YIHA 4N7MA 3U3JA 5C8DA 4GVLA 5FLKA 2FPMA 4H6VA 3ICWA 5JS8A 3DKKA 5KTNA 3M2TA 4W6ZA 4BP3A 1LNQA 1ZITA 3BRQA 3TPFA 2I6TA 1QF9A 2BFFB 1QYVA 4KNWA 4G86A 1KJNA 4RVSA 4A5SA 2Z6VA 4UBMA 4N7RA 5CDUA 3AM3A 2ODPA 1RJEA 1PYGA 3KQQA 3QXJA 4IOMA 3ZI7A 3P9IA 4AYXA 1SD5A 2IY9A 3JVDA 2REBA 4NMXB 4BMZA 1K9SA 4OA5A 1KJYA 3T5DA 3G8YA 4JQSA 3OZ7A 4KXLA 1E32A 2XZPA 1HQYE 2HF2A 5H82A 3QY0A 3HVKA 3PCRB 2I1LA 3DDWA 1AURA 3K1AB 3GNTA 4U7GA 1VDMA 2I3BA 3GLRA 1QGED 1XDGA 2COKA 4FDMA 1GEEA 4E09A 1QO0D 3ZD6A 1UBMS 1WM1A 1G9SA 1KZ1A 2QAIA 3DUFB 3AEKA 4BQQA 3L6BA 3ZKAA 4P7KA 3ETLA 3VTAA 2ZQZA 1FVHA 1SA0A 2JVIA 3I12A 4RZXA 3UYLA 2ZBQA 3V8NA 2FUKA 3RH0A 1ODTC 1OR8A 1LDBA 3A2LA 2XZTA 2BZSA 3I9FA 3LO8A 4MITA 1A4UA 4LRSB 4ZIRA 3PDWA 3ND6A 1CQJA 4EY6A 3WGIA 5J47A 3H2YA 5EWJA 3B2EA 3DMGA 4PEVA 3I1JA 1GPDG 1QYWA 2VF5X 3FNGA 5F2EA 3VHLB 2RE8A 4JR1A 4DNPA 2QL6A 3H0KA 1BMQA 4WCFA 4Y9SA 4MUXA 4NZPA 4XJTA 4CKXA 4PO8A 4PO3X 1TCVA 2JASA 3K30A 3P94A 1KOLA 4MMZB 3F7NA 1B8OA 3BAFA 1RJDA 3FCCA 4P7FA 4HZGA 1N5RA 4NZMA 3MJSA 4XGIA 4YJKA 5BW6B 4TYWA 2X4DA 4NBUA 3IKVA 2Q1YA 3QVOA 5BN4B 2VCHA 2YZ7A 1S8FA 4Q02A 1Z7GA 4N0DA 3HN6A 1Z73A 1GEGA 2ZQ5A 1RRKA 4Z2AA 1S6YA 1VJ5A 1FS4A 5IANA 4HH3C 4XQEA 2H4YA 2IW1A 5D3MA 2OZVA 2XLCA 3ETDA 5THQA 3RTDA 2HF9A 5AVVA 5JMTA 4LF9B 3OOWA 1UPXA 5K5EA 3F5FA 2NXNA 2F3UA 2DP4E 4CV0A 5JCJD 2CK3A 1ONSA 3LQ1A 4WNYA 1XKLA 4HDCA 1PFVA 5F35A 1XQ9A 4D3XA 4WBNF 4Y1RA 5T57A 2DR3A 2NU6B 1OWLA 3PQFA 4NFYA 4JNCA 5GZ3A 4N41A 2CYCA 4ND5A 3ZR4B 2GM5A 5HQJA 4FX5A 5HG0A 3TG2A 5AVSA 3H2ZA 4P93A 2VYVA 3F46A 2WZDA 2KI5A 2KMLA 1JYEA 5G3YA 5IS2A 1JIXA 2A94A 4LC9A 5BN3B 5LQRA 4PW0A 5AM2A 2FFQA 1OAKA 5FLEX 3V3KA 1KI4A 3EUEA 4O08A 5E6RB 5L7YA 2C5SA 1NQUA 3Q3IA 3ZHZA 1IUOA 3AINA 3C14C 3MWKA 3EPLA 1BQ4A 2V55B 3JQFA 3N76A 3D7KA 3FYUA 3QWAA 4MV6A 4EB6B 3QEJA 4TVKA 1MX1A 4LRWA 4IXDA 1CNEA 1CJVC 3V7WA 3CSUA 4D44A 2H1OA 4DUGD 2IPMA 1B43A 2Z2IA 1BJRE 4UBKA 2O20A 1C9EA 3DMPA 4J4TA 2G28A 4KMSA 3QNUA 5H83A 4EO7A 4IDCA 1F6WA 2A1IA 2B21A 5CLHA 5B6JA 3CQ9A 1WUIS 4FC7A 4I9FA 2K87A 5LIRA 3N6VA 5A5DA 3M1IA 1T36B 1S3SA 1VKRA 3KKMA 3MXOA 4R5MA 3GLGA 3NVKI 2FDRA 1MNQA 1AU9A 3MRSA 3T3OA 1ZIOA 3OQJA 4FDTA 4GWKA 1U9IA 5CH3A 2YWDA 1UQRA 4IDEA 3ESXA 2C2WA 5A3JA 2R66A 1PNRA 1ZIYA 1TQHA 2MYPA 2ZT8A 4JLDA 2CSUA 2BCJQ 2V0GA 2O2HA 3NASA 5DM4A 4AJ9A 4J49A 3PU6A 4TXLA 5JDIA 3DLPX 1CRQA 1E8DA 2NTYC 5HILA 5TARA 1TA9A 3VR6A 2A9KA 3NHWA 3KSZO 4YDRA 3K8YA 4TZ6A 1NVUQ 3STXA 4MO2A 5SZKB 4MKIA 4OB6A 1EJ0A 2O2GA 1P91A 4LHVA 2CB9A 5CB4B 2D5IA 4EHAA 2OECA 4JBYA 1KE1A 5C7LO 4FINA 3T0GA 2NP6A 3EDCA 5C0OE 1IHOA 4F5ZA 4J0HA 5JS6A 4OI0A 9ABPA 2FP4B 2WM3A 5BMVB 5C8YB 3WDLA 1DXOA 1W4RA 3E3LA 1E5DA 1TYEB 3RTAA 2Q46A 3L01A 4GM4A 4AKIA 2CEKA 2RI0A 2WHYA 4ZCTA 1V39A 4K8OA 3RRBA 4W7IA 4FMDB 2R5NA 4A9AA 3TD9A 3HHEA 1X1EA 2HJGA 3O8BA 4DV1B 3HCEA 5NULA 3ZVMA 2UUBB 1S2NA 4L4ZA 3AM4A 1E6MA 1MX9A 2HV8A 2C03A 3ZY5A 5I7HA 2HBQA 4D82A 2H1HA 1HUQA 1PO7A 2GFIA 3F47A 1SBYA 1F14A 4CIVA 4PCVA 3EZYA 3NVDA 4NXNB 2R8BA 1J70A 4QTZA 1V8ZA 1KO7A 1TECE 2H4FA 2FWMX 2W2MA 2E4YA 2ZRLA 3HXTA 3L40A 1YULA 4JVLA 4LWZA 4OXKA 5GGXA 5C81A 3ILSA 4L3OA 4TL6A 4ZU1X 3HRKA 5ETJA 3H13A 2QAGC 1V9SA 3LGSA 4LTMA 3RSLA 4DZZA 5JCOC 5LKAA 2UXCB 3I05A 4S0ZA 1JG7A 2CV0A 4CV2A 2OMKA 4EUHA 1OZHA 1XFAA 5TMDA 3DDSA 4B74A 1AHPA 3U1BA 2YWBA 2VJAA 1HYBA 3ESRA 5H7XA 1PQUA 2WM9B 1QHHB 4HTFB 5AVTA 7MDHA 2OO5C 4F0JA 3GEEA 4Q4JA 3ICOA 1IWPB 3C97A 3OJOA 3GFSA 1DL5A 4FHDA 3ML1A 5LKRA 1WABA 2YICA 3WB2A 4GOKA 1X8XA 2AMVA 5ARBA 4LXGA 1NW5A 5BSHA 2X3UA 5DLDA 5FI3A 2KLBA 3QITA 3QV2A 3P32A 1OUMA 4PR0A 2AEFA 2R8OA 1GRNA 2VT6A 4NX2A 4OBEA 3ZV4A 1K4YA 4EG4A 5LYYA 2VHTA 1Q44A 3FZYA 4ZAZA 2EAUA 4I1UA 1KNXA 1SVKA 1WMDA 1FMFA 5K0CA 1YI1A 4H18A 4NAUA 3HBLA 1QIKA 2AJ8A 1GG2A 4ZTUB 3HGQA 3ZHVA 2FZKA 2JFHA 5CITA 1RU3A 3GDOA 1GDHA 1RPJA 2PA0A 1DO0A 4PRKA 4EMBA 1WAMA 4GL4A 1T25A 2WAMA 3IQDB 1ZWLA 3AR5A 1G5RA 3H9GA 3KEQA 4WNAB 4V0LA 4YMIA 1OXVA 2QLBA 4C7KA 1ZD8A 4D9MA 4EY8A 4M1MA 5KOHA 1M6YA 2OV2A 2Z3VA 3EVBA 3SC2A 4DJFC 2X41A 2I9KA 4MKXA 5CDHA 4L5JA 2GXSA 3RTCA 4RTPA 3L79A 4ZZ1A 3GIWA 3MZ0A 5AK6A 5LU9A 2G06A 5KVQA 3EUAA 4UHEA 3ZPXA 1I9GA 3IP8A 6LDHA 8ADHA 1A72A 1QIDA 3D0RA 4B4KA 1TTTA 3RRMA 1N4AA 4QLBA 1V25A 2BLLA 5MFPA 3EC2A 3IT0A 1FX1A 2RJOA 3UJ6A 4FYWA 1WY5A 3A4MA 2FMFA 3VR0A 4DL9A 1HQDA 2RAUA 1UL1X 2ZIFA 1O9GA 3OCWA 4J2OA 2F3RA 4RQUA 5LMZA 2WAAA 2B0JA 3DZCA 1KPHA 4ZZ3A 4R6XA 3EPKA 2XVXA 3H4IA 4HXFB 2PBFA 5EZYB 4PC1A 1GU1A 3CJRA 2VTKA 3W7BA 4QKQA 1TKCA 1U5CA 2Z08A 4NH4A 3EWAA 2YYAA 2QG4A 1IEWA 1W8IA 4G4GA 2P5UA 1S02A 2VXBA 4NMMA 1UBTS 5AI4A 3F90A 3TQRA 1GDDA 4C0KA 4BB6A 2BVNA 2FEOA 1Y4ZA 1UMBA 1OILA 1GZ7A 1OBOA 4XGQA 2OAQ1 5SYAA 2WJGA 3G85A 5IC6A 2WP8J 1JFLA 4MIOA 4QXAA 1TXGA 1Z2AA 1FL9A 3JQBA 3NKVA 1YB5A 3FNRA 3LBYA 1N7HA 2XB9A 4PAGA 4Q3KA 3QIVA 4NBTA 2VJMA 3WRYA 1JNXX 4PG4A 4BB9A 2OZPA 4WZAA 1QTNA 5KNCH 3DFFA 4WOBA 1UFOA 2BV3A 2FSFA 2OE2A 1WSDA 3BDVA 2JKZA 3L06A 4FFPA 2F1RA 2P27A 4X8OA 1PZFA 2FZEA 4KBYA 4X8LA 2EP8A 3LY5A 5CA1F 2YWJA 3GXOA 1TM7E 4FNGA 3T12A 1RMTA 1ZZGA 1RFLA 2V7EA 1N8SA 3K94A 2A9VA 3HR8A 4HEJA 3SDSA 5DE3A 3ZZ1A 1SXQA 1R37A 4ZODA 4XXHA 1MMFB 3BPSA 3FDZB 1JPVA 2BFOA 4FYYA 1GTL1 3MD9A 3JYOA 3LUGA 4G0PA 1ZA1A 1JF8A 3CNHA 5ES3A 1X0VA 3CG4A 3UZUA 3QEAZ 1IY9A 3PC3A 4KQHA 4F4UA 3VO1A 2BM9A 4TL9A 4YRRA 2QL9A 3DONA 3BMQA 2JFZA 3IUNA 6Q21A 1YCGA 3D8RA 2ZVDA 1QR2A 3D3KA 1YVDA 1QK3A 3CLRC 2G71A 4HJXA 4K9PA 4Q7LA 2WU3A 4KGZA 4F60A 1X80B 1FNMA 3CX7A 3FLEA 1FRZA 5B7GA 4BY9E 1JZSA 1T24A 4OXIA 5U9CA 4E3WA 2H5LA 1L4LA 2BMVA 1EKXA 2JGJA 3CZRA 4PQYA 1GUAA 2AEEA 5K3BA 4L4UA 2QUHA 4QPPA 4B9AA 1AT1A 3C3PA 1WW2A 3GGCA 1PKXA 5CTAA 1Q0ZA 5KYNA 2L69A 4KXYA 1Y82A 1M8KA 3PXUA 4HN9A 4D9IA 1UAYA 3K16A 3ZWOA 4HV4A 4N5NA 2HU2A 3CJTA 4UVHA 3BGOS 1NSTA 1WVIA 1NHWA 3EWNA 5E1BA 3KLBA 1JHPA 1CR4A 1FNNA 1IB0A 3LHSA 3KHTA 4L3WA 1DKMA 3SQXA 2YZMA 2WHXA 3AJ9A 3GZNB 4AJHA 2OHHA 3CY6A 3IP5A 3UJAA 1NBMA 2VVTA 4EOGA 1E0KA 4X71A 1NI4A 1R0LA 5CU7A 3EFOA 1OYYA 4P86A 2LE0A 1DC8A 3AUJB 1T5BA 3PLNA 4IZOA 2H54A 1U2DC 4OUKX 1ST3A 1WA5A 4OHXA 4RMJA 4RE6A 2J41A 4PS1A 1AZLA 2GJ9A 3P9PA 4JL6A 4TV8B 3EG9B 3EXHA 3ONDA 1SFRA 3SHQA 4OB7A 1Q3TA 3U3KA 3Q5DA 1QFYA 1V7ZA 1M1UA 2VQDA 3MGAA 2XYGA 4RQTA 3X44A 3HQ4O 4V02A 2Q5OA 1HDEA 1G4HA 4JGBA 4ME6A 1HTWA 1OYVA 3I61A 4C7VA 5IXYA 3PYLA 4JY7A 4AX8A 4K0KB 2BIFA 4RZ2A 4HC4A 1O95C 1QE5A 1U0OC 4V0ME 1E94E 2XBLA 3RD5A 2DTXA 4D9NA 4DUYB 4II2A 1G1AA 1R0SA 1JTEA 5FF9A 1U3WA 3BGSA 5F9HA 4KTVE 5H9VA 1P2UA 1V96A 2VJCA 1DAMA 1L5RA 1TI7A 2C9OA 1NSYA 2WF5A 1NW8A 2JLAA 1UBNA 2ZITA 4LZAA 3SOPA 5K0ZA 2F48A 4AXBA 1J7JA 3DLBA 2GEKA 2WJYA 1WUHS 1ZNWA 4EI7A 3QMPA 1V6CA 2QM3A 2Y1OA 2NIPA 1SNYA 2OHXA 3I0ZA 1HYEA 4P92A 2ZZKA 5HRUA 2WTUA 2PZGA 3IBTA 3B1FA 3BFPA 5L4SA 1RMQA 2BI7A 2DJIA 3O82A 4O2AF 1X74A 3O4JA 2C0QA 1ZSNA 1N0HA 1NBIA 4HDAA 4NNJA 3ZN2A 4WNCA 1VPTA 4KO1S 1K3UB 3VPSA 5HCUA 2APJA 4MR8A 3QPWA 4DV6B 2HWKA 3RKSA 1Q1AA 4DCMA 4Q3LA 2WM2A 2ECFA 3UVEA 4H15A 1K7FB 1EBBA 3O0TA 1GL3A 3VOBA 1FTYA 2A0UA 2HLPA 4D81A 3V8RA 5H5JA 1AKYA 1YIOA 2B3DA 3PEWA 1X94A 3N0TA 3JRWA 4MYHA 1WDWB 2C4KA 3M0EA 4M87A 2Q8NA 1X1BA 3N8NA 4MAMA 4XIIA 1KDRA 4N3GA 1TE2A 4PLHA 4QEZA 4MW2A 4REMA 4MDEA 2QB5A 4FUTA 4X1YA 1WHTA 1N2OA 2VPIA 3VMMA 3DZBA 5T3UA 5IVIA 3UJPA 5EKSA 2HYIC 3WR5A 2Y1LA 3GQBA 3TGPA 2GTIA 3L8YA 3GLKA 3LWZA 1ZWKA 5CFQA 4CR6A 5M3BA 3EE6A 3A25A 3NOOA 4HZUB 1K4MA 4WBSA 5KQGA 3M6XA 5MGNA 3EXIA 2EYUA 3FVQA 4ILKA 4D9BA 1ZXXA 2YN4A 3WMXA 5AW4A 2D7DA 1MO2A 3ZBTA 4CZ2A 1Q1NA 3BF8A 3BFKA 2YUIA 4BFUA 2HJWA 4MICA 3SSOA 3KYCB 1M1XB 1VXRA 4KIGA 4EA8A 2PWYA 4ZI7B 4U7TB 4KE9A 1KGDA 1LSJA 1OGJA 2D3TA 2Y4OA 2D1TA 4L08A 1YR1A 4YEDA 3PICA 4F1WA 3OD1A 1M2VA 5HKKA 1H05A 2VO1A 4OHFA 5TR9A 4YJ3A 2UYQA 3D6HA 3H87A 2A3RA 1PEKE 2JAOA 2R4UA 4V0NA 5TMEA 4NESA 4EFLA 5LYJF 4PYOA 3NXKA 2GVDC 3EVTA 2B37A 3QYJA 3X0DA 2MCFA 2CMFA 5FTWA 2WWVD 4BNXA 3K7EA 4WESA 2AHRA 3W2EA 3QU5A 4ZZ2A 3UGTA 1DRKA 4BTLA 3AV0B 4GKAA 4NECA 5KO2A 2BI8A 2E5LB 1P7PA 2GJSA 5FXMA 4BKRA 4FD3A 4CTKA 2GNOA 3IP6A 5CEFA 221PA 3LQ4A 4XDZA 2X2FA 3G1WA 3LJKA 5DHUA 5A3RA 3QVJA 2IIBA 4QG7A 5HEKA 2GZAA 2PT6A 4EHDA 4J9UE 1NX6A 2Q4TA 1O5TA 2Y2UA 2GZRA 2G3YA 3D3NA 3RV3A 1GTVA 2XKAA 3G89A 4O4JA 4RY0A 3LVQE 1YDWA 1JP7A 1VOTA 2Z30A 3PQ3A 4J1QA 4ZVUA 3B20A 4BNGA 4F6LA 5FWDA 4B48A 2EF1A 4JL5A 3NANA 4KUHA 2Q7DA 1YV9A 2MMGA 2VRWA 1XDWA 1GZDA 3FTCA 4OLHA 2VYQA 1N5LA 1R18A 1XU7A 2Z1MA 5DHAA 3DLIA 3T5MA 4L0QA 4K9OA 3C39A 3S5JA 3EQ9A 2J9FB 1JJVA 4Q01A 4MV4A 2IQ5A 5G2OA 1PSDA 4ES6A 1JJBA 1PNOA 1U9CA 2HLDA 2J7PD 3MJTA 2W2LA 1JHYA 1PWYE 2AWOA 4YLGA 2QRZA 4YBRA 4ZA2A 1RHMA 1EEHA 1XK7A 3FWHA 5AI5A 3OT1B 3C5WP 3RVLA 5CT5A 4X44A 2GEFA 1LTQA 4FR5A 4RIHA 5ERGB 2QGNA 4TYNA 1TQ8A 1JT2A 3UAVA 4IH9A 1EQ2A 1TYAE 4AUKA 2QBYA 4XWGA 5B1IA 5I8PA 2EGHA 1DO8A 3HVIA 3U1VA 4M0FA 1QBGA 1ZMBA 1M2GA 2AC2A 3DD5A 3AEUA 3DDNA 4FLMA 4RTLA 5BWLA 4HDRB 4YVFA 4LHSA 2B1GA 3QGMA 4JASB 4ZQIA 1M2WA 3IVXA 5AOCA 4UCQA 1HDOA 2OFWA 5HXAA 4NFHA 1ZR4A 3PPXA 4CF4A 1DJLA 2AOTB 5FP0A 2QIPA 1Z45A 5B7QA 5E6UB 1A4XA 2DZDA 1S8AA 3RUAA 2BEWA 3F5QA 3F74A 4U02A 3OOEA 1BN7A 1IK4A 3IDFA 3B78A 3RVNA 4JEHA 3ZHUA 4COKA 4KMMA 3IIJA 3QVWA 4UAUA 2D0DA 4I46A 4M49A 1IBSA 1SWVA 2HT6A 2P0YA 3AR7A 4QOSA 2UYHA 1MJGA 5D2CA 1EFAA 1ORRA 1XJ0A 1DAOA 2VK1A 2A1TS 4FC6A 4Y9TA 5G4KA 3BB1A 4Q1AA 4BQIA 2G77B 3R0VA 4CEHA 2WMYA 3UMSA 4N9WA 4X95A 3B5EA 1PUJA 1BQ3A 3RBXA 1GFWA 3E8XA 4R7GA 3G17A 2X7XA 2WWRA 3GT7A 2ATCA 4RA9A 5LYJB 1E7WA 1Y5MA 2G7MC 2O5VA 2EWMA 4ZYVA 3CEPB 3KXLA 4QTYA 1LBQA 4GPTA 3EOZA 2BFDB 3SR3A 2AZMA 1I5OA 3A4NA 1JLKA 5EWLB 2NU9B 1YQEA 3JWGA 2PGLA 4OQYA 4FYPA 3D81A 1UOQA 3FMGA 4PLZA 3TLBA 4DLNA 2WR8A 5JS1A 1X13A 2NSHA 2ZSAA 1AD2A 3HJCA 4I5FA 1G6OA 2JKYA 2BY4A 1C1HA 4H3KB 4KJZA 2KW5A 3JTMA 1PUXA 2DJ5A 2HK7A 2DY1A 5IJXA 1YL6A 3F3SA 3QHQA 5JJLA 1U7XA 1DG9A 2P3SA 2RH4A 2CXQA 1U4NA 3CR8A 3LRPA 5BVHB 1FNBA 3PE3A 4TVOA 1BFUA 2PQMA 3EPPA 2J6CA 3OSZA 4TQAA 6AT1A 1PD1A 1M73E 1W25A 3HJTA 4R41A 3S99A 4D5GA 5BMVF 5C8YF 1N2XA 2REQA 2PMWB 1HX7A 1NVMB 3HRHA 5CT8A 1VG8A 4RM3A 4D4MA 3OIUA 3DP9A 1ODLA 3WWPA 1JDJA 1Q3HA 2I1QA 4KLRA 2FSGA 1PG2A 5IP5A 1ZGGA 1E6KA 4R7TA 1MVLA 4CKEA 5BNWA 5D3QA 4J0CA 2P9HA 5TEWA 1Z0ZA 3JD0A 3OKAA 5L3SB 5DIFA 3FFXA 1KSGA 4LTNA 1CNFA 1GHTA 4HS4A 3PSAA 3QNWA 4Q48A 1VJDA 4GPD1 1E99A 2VDRB 4BX8A 1EWYA 2ACEA 4TWJA 2KBFA 3ESBA 4PSUA 1K5HA 5C1IA 2DF8A 3SFVA 1K5GA 3W06A 4E1AA 3CNQS 1E2JA 2DOKA 1TK9A 1YZGA 1Q19A 3A4TA 1FPQA 3GLVA 4UHFA 4MQFB 3INYA 3OECA 3H0CA 1V8DA 3OLXA 3U1TA 4AM8A 3N0RA 2FOLA 3P9KA 1ONBA 2JAQA 2PSSA 3CZ9A 1UKEA 4MUBA 4N8EA 3VR3A 2MINB 3R3SA 4H1HA 3ZHQA 2ZIUB 5DVZA 1CEQA 3UXYA 1PR9A 4PCUA 1IY0A 2O3UA 5HKOA 4ZVLA 1MH1A 1R8YA 2X0IA 1M54A 3EASA 3M89A 4MUIA 4WGGA 5AJVB 4HXYA 1UBLS 4XJVA 5KSZA 2V8OA 1BMFD 1N8KA 1ULZA 4HB4A 5AW9A 2C1EA 4Z54A 4HDSB 2EFHB 3H2KA 4XUEA 2FRDC 5AIBA 2AQKA 4I4TB 3ZQ6A 2GVNA 4X20A 4CMEC 4B40A 2P9TA 1XV5A 2V6MA 4BQNA 3FTQA 1N1GA 5CDYA 1ZSYA 1WDMA 2JJ8A 2VPYA 2H29A 3VJMA 4NSNA 5H3CA 1UCFA 1ZIPA 3TQIA 4BIIA 5DIZA 2C3PA 5KHOC 1LDMA 2V7UA 1E4EB 4C1BA 1YDHA 4TRMA 1JQKA 4E07A 4WJKB 4KYVA 3Q11A 3RWBA 1AMNA 2OG1A 1CK4A 1RLMA 3SZMA 5C8YA 5BMVA 3PHCA 4CQJA 4J7AA 3KXKA 3ZWAA 2EIXA 4BNYA 3NAQA 1TAHA 3Q3GE 2EL7A 1K8RA 5SICE 2H08A 2I62A 1Z5VA 1FSSA 4RD3A 3N39C 1VA5A 2AK2A 3RI3A 3ZH9B 1TGVA 3QYFA 5HJ7A 4M0PA 2VSOA 2G72A 1X8KA 3CKYA 3LX5A 4DLSA 3W2IA 5LB2A 2H4JA 2OB1A 4RORA 1G2PA 4EL0A 3D2CA 3F6BX 4UTRA 4L16A 2NZ2A 3SN6A 4ZCRA 1C3VA 4LSMA 5JROA 2AQ8A 3CEMA 5KX5B 3ACBA 3G13A 2OAGA 3TLCA 4PRLA 4NBWA 2CV2A 2NVOA 1EE2A 2YWXA 2KS6A 2AA3A 2ENWA 1TYBE 2RGNA 3G0IA 3BJEA 4ZD6A 1KH2A 3L93A 4YT8A 4O8ZA 3C98A 1R27A 1YA6A 1VKHA 3T5BA 3W5VA 1B3BA 3ZDRA 5KYUA 1UPTA 4PNPA 4AAYA 4NZ9A 3IPCA 5E1DA 3WGVA 1KORA 4BOYA 2JB9A 1AK1A 3FMOB 3I2IA 3LI2A 2WICA 4Q4JB 5E0KB 5HZKA 3RUFA 3QW2A 1IJBA 1K9VF 1Q83A 3BXXA 4KX5A 2FRDA 1R0XA 2QTRA 3QHPA 4BNWA 4UC0A 4QQKA 2JIZD 1JHAA 5JC1A 1SHLA 1XD2A 4GLOA 4QRIA 1ZN2A 2R7NA 3CKKA 4IINA 5U4QA 1YR7A 3U7QA 1GL6A 1T6NA 3MYRA 3IVAA 1QBKC 7ADHA 4F84A 1GQOA 3AR8A 2ZTHA 5CUQA 4TQGA 4F2HA 2X9NA 4CKWA 3WLOA 3PXGA 3D43A 4D3YA 1XNQB 2YJ3A 4AU1A 4C7MA 3C8UA 3EIUA 4I55B 1DOHA 4OL0A 2H3HA 2B8EA 1SVMA 1DQNA 3PGKA 2OGUA 3M81A 4CM9A 2FX5A 2Z4SA 5LQJA 2BGIA 3MT9A 3V7UA 5EGNA 1J99A 1K6JA 4WAUA 1HFKA 4EI2A 2YIMA 3OX2A 2QKYA 5CJ2A 5EHIA 5B4TA 4Q3OA 4MGEA 3PI6A 3FVVA 4NG5A 3SLGA 2QLFA 4XCXA 1GPAA 2EJBA 5M04A 1BX3A 2F1IA 1GPWB 5BT9A 1I2MA 3C4QA 5IM5A 1ZCZA 2I6FA 3IMFA 2A6PA 4X9XA 1MB0A 5F1YA 4ZANA 5U1PA 3C3AA 3G6KA 3QE0A 4YNBA 2JK1A 1HDZA 2UXDB 4Z86A 3TLJA 5IKXA 5CA0A 1YC2A 3MGCA 2EU8A 5AK3A 3WLMA 2HUPA 2WZBA 1NIPA 4IO0A 3NFRA 5K0JA 4RTSA 1F8FA 1M8JA 2XKBA 3G9QA 1IEQA 4KVZA 5DNEA 3DEFA 3EGXB 4R05A 3WA7A 2L82A 4GPAA 3O83A 4EPTA 1QH1A 1DWOA 4D3DA 4E5YA 2I6XA 1DEOA 3OBBA 4KYUA 2V6FA 2OTCA 3DT8A 4OQNA 4Z0NA 4KIJA 1NUHA 3KT3A 2KBEA 2I7XA 5A03A 1ZMTA 3SJZA 1YUNA 4X54A 2OK7A 4WQMA 1Z2DA 4D8YA 3O8NA 4YFVA 3D4BA 8ABPA 3ZWKA 2Q2NA 2ZU0C 4DMLA 5LQAA 1P9LA 2FWBA 2NX2A 3U4QA 1ZJ6A 3CX6A 3LLSA 1XHLA 2PN1A 3AP3A 3NUZA 4FHZA<