The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
65
|
sequence length |
196
|
structure length |
196
|
Chain Sequence |
MKILIVYTHPNPTSFNAEILKQVQTNLSKEHTVSTLDLYAEHFDPVLQFNETHKRRDLAKVAEMEKYRDLVTWADHLIFIFPIWWSGMPAILKGFIDRVFVADFAYSYKKVGLEGHLQGKSAWIITTHNTPSFAMPFVQDYGKVLKKQILKPCAISPVKLTELTSIEKISDDERQKLLHKVAQITRNILEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Complex structure of NADPH:quinone oxidoreductase with menadione in Streptococcus mutans
rcsb |
| source organism |
Streptococcus mutans
|
| molecule tags |
Oxidoreductase
|
| molecule keywords |
NADPH Quinone Oxidoreductase
|
| total genus |
65
|
| structure length |
196
|
| sequence length |
196
|
| chains with identical sequence |
B, C, D
|
| ec nomenclature |
ec
1.6.5.2: NAD(P)H dehydrogenase (quinone). |
| pdb deposition date | 2012-05-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02525 | Flavodoxin_2 | Flavodoxin-like fold |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold |
