4F8YA

Complex structure of nadph:quinone oxidoreductase with menadione in streptococcus mutans
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
196
structure length
196
Chain Sequence
MKILIVYTHPNPTSFNAEILKQVQTNLSKEHTVSTLDLYAEHFDPVLQFNETHKRRDLAKVAEMEKYRDLVTWADHLIFIFPIWWSGMPAILKGFIDRVFVADFAYSYKKVGLEGHLQGKSAWIITTHNTPSFAMPFVQDYGKVLKKQILKPCAISPVKLTELTSIEKISDDERQKLLHKVAQITRNILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH Quinone Oxidoreductase
publication title Complex structure of NADPH:quinone oxidoreductase with menadione in Streptococcus mutans
rcsb
source organism Streptococcus mutans
molecule tags Oxidoreductase
total genus 65
structure length 196
sequence length 196
chains with identical sequence B, C, D
ec nomenclature ec 1.6.5.2: NAD(P)H dehydrogenase (quinone).
pdb deposition date 2012-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02525 Flavodoxin_2 Flavodoxin-like fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f8yA00
1AKRA 5LJIA 1SG0A 3EDOA 1TIKA 4CF6A 1YDGA 3NFRA 3TZBA 2QX4A 1CZOA 2FLVA 1RCFA 3W78A 1ZWLA 4YAOA 1YCGA 4ZVLA 3ZHOA 1OFVA 3ESXA 5F4BA 4ZVMA 2M6SA 1J9EA 2BZSA 1FLAA 4QOJA 1D04A 4XDGA 4H6PA 3KLBA 3FNIA 2BN4A 3ES9A 5FUQA 3OWXA 3NHJA 2Q62A 3TE7A 5TGZA 2FDXA 3FX2A 4LTMA 4M0CA 6NULA 2MT9A 5ULLA 4QOGA 2HNBA 3GFRA 1VMEA 2Z9BA 1J8QA 1WSWA 2V5VA 1OBVA 2KQUA 3LT5A 1D4AA 5B3KA 1C7FA 3K1YA 1AHNA 4J8PA 4YAFA 3KAPA 4OXXA 1AG9A 3FJOA 4LAFA 2HPVA 1AKVA 3FW1A 3OJWA 2RG1A 4PU0A 1CZHA 4U7HA 4Y9UA 2QR2A 1XI2A 4N9QA 4H2DA 1T5BA 3B6KA 1C7EA 3S2YA 2OHIA 1RLJA 1QRDA 4NLLA 3D7NA 2QMZA 3KAQA 2AMJA 2F1OA 2HNAA 1AKQA 3U7IA 3B6JA 4FGJA 1JA0A 2QX9A 4FGLA 3U7RA 4ZVKA 2A5LA 4R81A 1J9ZA 4GR9A 2W5UA 2B3DA 4C14A 3RPEA 1FLVA 3JSXA 3N39C 1QHEA 2XOEA 2MOKA 1FUEA 2BMVA 4C76A 3KEGA 3EYWA 5LBTA 4ICIA 1AKTA 2QWXA 3F2VA 4F8YA 3O73A 3UXEA 4LTNA 1FLNA 4CETA 2FCRA 2QMYA 4ZVNA 3FVWA 1FLDA 1XT6A 3K20A 3NHPA 1BU5A 3OX3A 4D02A 1ZWKA 1NNI1 1E5DA 2Q9UA 1KBOA 3NHLA 4N82A 4PTZA 3NLLA 2X2OA 3W7AA 2BPOA 2Z9DA 1FX1A 4QODA 2OHJA 1FVXA 4DY4A 1YRHA 5B3LA 2V5UA 2Z9CA 2FOXA 4N65A 1YCHA 4NULA 1QR2A 2BF4A 5EA2A 4ESEA 1QBGA 3R6WA 3F6RA 1YKGA 1F4PA 3N3AC 4PTYA 3ESZA 3OVMA 2FX2A 2X2PA 1V4BA 1JA1A 1J9GA 1FTGA 5EMNA 4YQEA 3NHFA 4S24A 5EAIA 3W77A 3O2NA 1TLLA 4FX2A 5NULA 5JROA 2V9CA 3TEMA 1XYVA 4U7GA 4C0XA 1DXQA 1D03A 4FGKA 3UXHA 5BUCA 1SQSA 4HS4A 3NHRA 1CZNA 2FAXA 5F12A 2R97A 4BMOB 5LJLA 1AZLA 3SVLA 1OBOA 3HLYA 2FZVA 2OHHA 2FZ5A 5FA6A 5F51A 3W79A 3N3BC 4U7FA 3LCMA 3GFSA 1AKWA 3NHUA 1KBQA 1RLIA 1CZLA 3QFRA 4C0WA 3B6MA 4DIKA 3L9XA 1ZX1A 2Z98A 4LTDA 3QE2A 4DILA 1H66A 5LBUA 1CZRA 5LMCA 4YAUA 2GSWA 1XYYA 1DXOA 3ESYA 2ARKA 4Y9RA 3NHWA 4LA4A 4HEQA 1YOBA 1B1CA 5NLLA 4QOHA 3F6SA 3GAMA 1T0IA 1RTTA 5LLDA 4BMPB 4QOIA 2FVXA 2ZKIA 1I1OA 2KLBA 3OX2A 4YAWA 3NHYA 1GG5A 3L9WA 1CZKA 3G5MA 1WSBA 1DX9A 2QX8A 4GQIA 3OWHA 1BVYF 1YCFA 4YALA 3GFQA 4QOEA 2QX6A 3QFCA 1AMOA 2MTBA 4Y7CA 2M6RA 2R96A 1AKUA 3HA2A 3F90A 5LVAA 2OYSA 2WC1A 3B6IA 1CZUA 4XDHA 1X77A 2MWMA 3NHSA 5A4KA 2XODA 4QOFA 3P0RA 5FX2A 3OJXA 2N1MA 2D5IA 3NHKA 3HR4A 1H69A 4GI5A 3OX1A
chains in the Genus database with same CATH superfamily
3RS5A 1FOEB 2WSBA 4HFNA 2A1TS 5IH3A 1KPHA 2IOFK 3A05A 4PPQA 4NOKA 3OOSA 1C3JA 3JQ9C 2ETXA 4YGYA 4XPZA 4N8SA 2QN2A 1NC1A 3OPYA 4QX6A 2MYUA 2IBTA 3C1AA 4HQFA 3SHQA 3WMGA 2WG1A 5AD1A 2VG8A 2GCIA 4LZLA 1YXMA 5DYGA 1W581 2HK9A 3NOOA 2YUIA 3OJEA 3L4KA 4BVBA 1Z0SA 1CVLA 3HB9A 2NPOA 4KQCA 2YV2A 1MVLA 4DBVO 1M1XB 1P2UA 2CL5A 3SF8A 4LK2A 2PFKA 3FYSA 2IOFA 1REQB 4TRJA 1QHHB 5AQ1A 4DCCA 4F21A 3DEYX 2P6OA 4G85A 3SBEA 2P6MA 1RM0A 3LC1O 4G37A 4U9HS 3TZKA 2E1PA 4ZVPA 3TNDA 4G4GA 1CB0A 1X86B 1YQ9A 4X6XA 2QVCA 2AHOA 5HF8A 4YWJA 2QTFA 5B64A 4ER3A 4AY2A 4WCFA 2HO5A 3HJRA 2QLLA 3B2EA 3KLBA 4I2VA 3Q8KA 3CZ5A 3N59A 3EOAI 3QFFA 3WJ2A 4BJ6A 4FD2A 4BGUA 4C0SA 3ZQ6A 1F06A 2E3JA 5CH8A 4P5DA 1UBJS 1WCIA 2VJKA 3LKDA 3HCEA 3MJSA 4PGHA 5JNTA 1Y5LA 3AFIA 1RRFA 4UMEA 4YJFB 2BHTA 3A14A 3IELA 4EKYA 2QJOA 5EMLA 3VOSA 2EZTA 2EW1A 4WA8A 3HL4A 4UUAA 3UJ3X 3LZDA 2EP7A 1Z4LA 1O9HA 1XXHB 2NZJA 3TDMA 3DBOB 3LG2A 5DLDA 4KE6A 1YHYA 2QK4A 3REFA 3R9XA 3T9EA 3OQVA 4M7RA 2O3SA 2W90A 2VCHA 4POAA 2FPMA 1CIVA 1QK5A 4D8TA 3QX3A 2NT4A 1K9SA 1RBZA 4CODB 4F5WA 4ZC8A 4B09A 5LUAA 2OCPA 4H7IA 3LK6A 1L6IA 1NI5A 1P39A 3TSAA 4PYJA 1ZMTA 3KV3O 1KJ8A 1NTOA 3GLQA 3BSFA 5C3UA 4CKEA 3ICOA 4TS1A 3AKDA 1CQIB 3RRXA 2Y9MB 2O8EA 4M9UA 3CJRA 3Q9UA 2Q3CA 4U2BA 5CDTA 5IKPA 2FLKA 1WW3A 3HCOA 3C87A 2IWHA 1J0XO 4UCXA 1T4GA 2W2TA 5C4GB 3GP3A 2NPFA 3VX4A 1JDPA 5IT5A 4H77A 5DSXA 1KEZA 1T5TA 4Z9BA 1MUUA 2MR5A 2O3RA 1LSOA 1OXTA 2Q0XA 4BO2A 1NR1A 2LGJA 1JZTA 4MITA 3UH1A 5I7VA 3E3MA 3VTFA 2AH5A 3Q3CA 4GXTA 2FUEA 1TAGA 2JIDA 4MK4A 4CTJA 2FUNB 3ZCPA 4J0FA 1H5QA 4HDKA 4EOGA 5LMNB 2ZSFA 1DXHA 1GUAA 3LY5A 4DFDA 1JHMA 3H1PA 4K9QA 1NBEA 1W5SA 3LT4A 1C4WA 2WDPA 4MQEA 2A58A 4GX5A 1HBJA 4AJKA 3JRNA 2XUZA 4E1AA 4RF2A 3KJHA 3EPHA 2GWHA 5KSOA 4EA7A 4Y1FA 4RD2A 2XI4A 5BPFA 1W93A 1HLPA 5JMWA 1G6HA 1WVIA 4I1RA 3K9WA 1U80A 2ZRIA 3H3XA 1IDOA 3NI2A 5ITZB 1WD7A 4GSKA 2V1UA 3IP7A 2IRWA 5L4NA 3Q6NA 3G0OA 2P4EA 4LJ9A 3UJ8A 3THYA 3U9TA 2GBGA 1JJ7A 1OHHD 3T3OA 1J2JA 2OZPA 5FUXA 5K0CA 4BIMA 4GGPA 2H2FA 3W5SA 5M5BA 4QUJA 3VU3A 1J06A 2ZT5A 4LZOA 1Q22A 3KUCA 1MKYA 4XASA 3DC2A 1U9ZA 4UVDA 3VGPA 3IHKA 1W8IA 3E3AA 1XE3A 3PC6A 2QN3A 1M73E 3HKDB 3QLUC 2BI7A 3AEUB 3DCNA 3FROA 4ARZB 8GPBA 1F20A 1QFJA 3U7QB 4R8MA 5DP1A 5D51S 4BE4A 4DIMA 4RPCA 1KKUA 2YV1A 1NI4B 1A7JA 1FK8A 1QH1B 3MCWA 5DGXA 5JTTA 3S99A 1TT5A 3IBFA 2C1XA 3EGXA 3GA5A 1AZSC 3VHXB 5K6AA 1Y3IA 1E8NA 1X8KA 3KTFA 3PHLA 2ID8A 4Z51A 2I91A 4KN5A 1NQUA 2LVBA 1RJ9B 1BJTA 2F59A 3AUAA 4YIHA 1XU4A 3HJCA 3UHJA 3BCHA 4JJGA 4B4WA 3BB3A 3BWCA 9ATCA 2KLHA 2Y1KA 1U4OA 3GLHE 1LGYA 1QHGA 3ETHA 1Y63A 5G0WA 4RCVA 1AQJA 1UJNA 2ZU0C 4IUDS 1KTIA 1F8FA 1ZOPA 4DUZB 3WLPA 1O03A 3EPLA 4UHJA 4PXAA 3TDKA 3D4LA 5D85A 1Z7YA 3PCTA 3T3MB 1ZUNB 4AJ4A 3TG2A 1KO1A 2R4UA 3RBAA 1D09A 1XDBA 5E4YA 3ILVA 3AT1A 1ZJZA 3B1ZA 2Y2UA 3BICA 3L0OA 4LJ6A 3ROEA 4WOCA 2P9ZA 4WZBE 2MMCA 4XYMA 5CRIA 2IGTA 4YMUA 3OQMA 3UK0A 1AKTA 3RJMA 5IULC 3OT5A 2BGLA 4L5AA 4ZKEA 1FRQA 3LO8A 1CQJB 1VDMA 1W6RA 1Z12A 5EZYF 2OV3A 1KJQA 4ETWA 2DPXA 2ZSUA 2XMRA 5A0VA 4MSUA 2ECFA 3N7UA 2VDWB 5B4TA 4ZYZA 3Q15C 2X6QA 3U2QA 3EVTA 3WB9A 5ARBA 1DC8A 2I33A 5AVYA 3H86A 3G2IA 5DT2A 4GWKA 5FORA 2HWKA 3L40A 3BIXA 2BFDB 3AESB 4BFZA 3A1DA 1BCSB 5LKAA 1NYLA 3DWFA 3NHPA 4IR7A 2O8CB 4YT5A 2A2ZA 3NYQA 5IJ0A 1WXGA 2DFPA 2Q6TA 2CVHA 2PSJA 5J1SB 3GFGA 3GRPA 5HBGA 3O9VA 2WWGA 1S9HA 3PQ2A 3GJZA 2F8SA 1LBHA 3CRMA 1WP4A 4WECA 4D2IA 4EECA 4DQXA 2QDKA 1GQ2A 3ODGA 4C21A 1M76A 1BN7A 3QXHA 4CFSA 4Z1MD 3NAQA 1K6JA 2ZI3A 3FD8A 2O20A 3IS3A 1OXUA 3LGSA 4H4CA 1E9SA 2C2BA 2DWPA 5A4MS 2Q3MA 4BMZA 2VATA 1SKBA 1WUJS 2BPOA 1TX4B 1D2GA 2PL3A 5H82A 1EVYA 2IIBA 3WMRA 5A4IS 3FTEA 1Y8QA 3QEMB 4WZ6A 1UK9A 4TWJA 5K0EA 4BKUA 3ZR4B 1VKZA 2LV8A 4MTCA 3EYAA 4C89A 3KVNA 2EBWA 1RPJA 4ZU1X 1NHGA 1MPTA 4QG7A 5EEGA 2B21A 3REGA 4EB0A 4Z2AA 5IRCD 1MABB 5DYNA 2W37A 4K6MA 1M1NB 5LA6A 3ZK7A 5DRTA 1J1UA 4I6EA 1G8MA 3G0CA 1XAJA 2QTRA 2MSWA 1U2TA 1GCUA 1C2TA 5BR8B 4C4AA 5T4FA 4BN0A 1CG6A 2NYVA 2CLOB 3HJGA 4G6ZA 5DYWA 4C5AA 2XCTB 5C1DA 3JARA 1JQEA 5HRAA 1OBCA 1Z17A 4FD3A 2H3EA 4KXNA 1R0RE 1ODFA 3THXB 3C7DB 3FPEA 3GNLA 5FOTA 4JA2A 4WACA 4WNIA 2Z09A 4QDKA 3T4XA 4DUGD 4P4SA 4Q9KA 4H0CA 4OXYA 4XJXA 2GVDC 2I62A 1A9RA 3ZE2B 1KDTA 1P6UA 1OZHA 3CBQA 5DCLA 5J5CA 3W77A 3G6KA 1PBNA 2HGSA 2GN4A 2R00A 1TLLA 1RLMA 2V7UA 1SOAA 4ISCA 1LWOA 2H0RA 5EZSA 3HXPA 2EIHA 2QRVA 4EPVA 1ZIXA 3SSAA 4DV0B 2D2EA 3QG1A 3GT0A 2H08A 4NQRA 1GFWA 1NMSA 3I6YA 5DM2A 1AV7A 4Z0PA 4EA6A 3GHHA 1MH1A 4IX9A 4EK9A 2C20A 1R5JA 3RABA 1VMKA 2J3DA 3TEMA 2ADMA 1AQNA 1E4YA 1I3MA 3EJWA 1WZ2A 3SXPA 3VPXA 1N6RA 1P80A 2AOUA 1QO7A 5C9ZA 4RTQA 2VPWA 2EFJA 3GJ0A 4U7GA 2AN1A 4A0FA 3CH6A 2OVBA 3L8ZA 5BSEA 4RTJA 3LHDA 4I81A 3PLAE 1A04A 3ZWMA 1SBIA 3TQSA 4YRJA 1VLVA 5AUQA 1XL0A 3UPUA 2LE0A 2QA5A 3M4JA 2A0KA 3FDZA 4KO1S 5G0TA 4B0OA 2XEXA 5GONA 4D6XA 1KDVA 4XM0A 4JI3B 4G0UA 1KORA 4KXLA 3QKSB 1YI8A 2FPGB 4UUOA 4OHFA 4ZRDA 3ZD6A 2GNAA 4JI8B 2P2CA 2ZT8A 4QVKA 1FVFA 2GN8A 4CYMA 1CZNA 3IQZA 3QI2A 3Q3VA 5L7WA 3JYOA 4HATA 4TYPA 1EFAA 4BMOB 1VIAA 4R2KA 2J30A 5CT9A 4B3CA 1JNXX 5CLQA 1VLQA 3JZAA 4E5KA 2F3PA 3SYRA 5K8UA 4V1CA 3AJ8A 4J91A 2GF2A 5F7OA 3IJPA 3RGWS 2XCQA 5FA6A 3BXHA 3WNBA 3D0QA 4KZKA 4R2MA 3KQTA 5L3VA 1Z4OA 1JDJA 3A6ZA 3JQAD 4XWGA 1NVFA 1RIFA 3KLNA 1P17A 4GYYA 4ZYYA 4E32A 1CYDA 1Q7RA 2VPXA 3D5QA 4PYLA 4BX9A 1WV0A 3PFKA 4YMSA 4G24A 5JAUA 3PXUA 4H3SA 3RK1A 2VJBA 4BB0A 4Z4CA 1ONOA 2NO0A 1KI9A 2I6QA 3OKPA 3QVGA 2YHUA 4CM4B 4PFSA 3ZK8A 3EH2A 2PX5A 3EXAA 4I55B 1F1JA 4MGZR 3O5AA 5A5DA 1WSAA 4YJ3B 3SXUB 2ZWMA 4HXFB 3OCYA 5JC1A 3UO8B 2O3UA 3KQPA 4OKNA 1T9KA 3THOA 1RPZA 1CLUA 1KZ7B 1NT4A 1WTCA 2BIFA 4B8ZA 1WQ3A 5LCXA 3IR7A 1BXGB 3PCXA 4OB8A 5T57A 1Q95A 3WE7A 3WWCA 2XKBA 4IJKA 2P3SA 3COJA 2HHLA 3LNTA 4UM7A 2RIRA 3ZG6A 4R1LA 1HX7A 3LUDA 4K28A 4L95C 4OMUA 1WEHA 1OH7A 2NZWA 4CQLB 3A7DA 3GXBA 4UTRA 4DJFC 1QRSA 4BL5A 4AYXA 2RK3A 4CV2A 4DYDA 1WCWA 3HMQA 3NBMA 4LA4A 2MYPA 4MGIR 3A6FA 4BC1A 4BO4A 5HKAA 1MR3F 1KNXA 1KEEA 4IDCA 2ISQA 1MC5A 1Q15A 5AJTA 3OQ6A 1YOBA 1TJ3A 3ZNNA 1XJ5A 4Q1AA 2JRCA 5EKUA 4DJ5X 4C2AA 3UMJA 4JK3A 5IM4A 4FCTA 3WBBA 5HM6A 1Y6ZA 3ZWKA 1J8DA 1ZU4A 4RORA 2VHUA 3QHQA 5FL7A 1XPRA 1HNZB 1DWQA 3NRBA 2DWOA 3W04A 4WZAE 4O1MA 4FDMA 1ZRNA 2CXSA 5IWCA 1Z0DA 2QVXX 2GA8A 2BMDA 3S2GA 1EFUA 3L0DA 3QFTA 3DBHA 4WXYB 1EE1A 3BF8A 5G0UA 1ZIPA 4HFRA 3O74A 1E2KA 3CRZA 3RWMB 3SFTA 3JWEA 4B3FX 1VL2A 2FN9A 2MU1A 2NU7B 4TMYA 3P8ZA 4NBKA 2WFZA 1E1MA 2Y1FA 4DUGA 1PLLA 3PTLA 4HQNA 1FNSA 3WOVA 2ZJFA 2A5DA 3AZPA 5A62A 2YXEA 4KRGA 4M46A 1ENYA 4C9BA 3BRCA 1DARA 2ZW9A 3GWGA 1FDTA 4LGCA 3FCEA 1KPGA 1TZMA 4OEHA 2FPPB 4U63A 4FMPA 3MS2A 3TX6A 1KKLA 1U81A 2Z8ZA 4HX2A 5CMLA 3AVTA 4CMCA 4RZUA 3L18A 5ILOA 3BH0A 4Y7CA 4RPGA 1H1DA 4W7SA 1C9KA 1P18A 1PJTA 3A3PA 1D4ZA 3IDZA 1SQGA 4IOKA 4AL4A 1B73A 1JILA 4EUSA 5TPZA 2J3LA 3PQFA 2BGWA 3WIOA 3UWPA 3HVJA 2XDWA 3R8FA 2UXCB 4UEKA 3GLIA 4PNEA 5TB5A 3MGGA 1BCRA 3DTTA 2Q0HA 4YBZA 1XDGA 4MRPA 4FIZA 2AUNA 2PMFA 4D44A 3DE2X 3FNFA 1B14A 2OFPA 1N1DA 2A86A 1QR6A 2I4OA 2ABWA 4MYCA 4YRRA 1E2MA 4URWR 1XMJA 1EWQA 1PP4A 1QPBA 3DT8A 5EHNA 4J7XA 2QPAA 4NZYA 3DAGA 3IVRA 4Y6OA 1QH8B 2WKRA 3O8OA 5IT0A 3OIGA 4Y6QA 1SUEA 4INAA 3NNDA 4U5QA 4E2ZA 1DZ3A 5C8YA 1M2WA 1U0LA 5FX2A 1OREA 1XCGB 1I5OA 2X3FA 1GOTA 2GCEA 5AK6A 1F14A 1JE0A 2H2WA 4PXSA 1B6TA 3P19A 5TT0A 3OCXA 3ZBTA 2HRDA 3TOXA 3JWJA 2HQSA 5JS1A 2QD1A 5EJ4A 4FKZA 2J3EA 2AWNA 3JQAA 1ZH6A 4P34A 3DXFA 1UFVA 4GI5A 3C97A 1G2OA 3H42B 5DNVA 2J85A 5CDFA 4JWKA 5HDQA 2HHJA 5ALLA 4LF4B 1BWRA 3FRIA 2Z6UA 2IZ5A 4H7JA 3LZ6A 4DCOA 1PQPA 3VHLB 5JCPA 3K6JA 4PYRA 5KREA 4CF6A 1YR8A 3OPYI 4I8IA 1L1FA 2IPOA 5FEUA 3LNCA 3RLIA 3K2BA 2LNDA 5KNBD 1G5TA 1POWA 1HDRA 1N7GA 1ZMXA 4R1UA 4RQUA 5CNKA 3QWHA 3FDFA 2C8VA 1RI4A 3EA4A 3H3JA 4TWAA 3N6RA 5IN5A 1XZMA 1PR9A 1R3UA 2GRAA 4ID9A 4ZI2A 5KINB 4BNDA 4EPTA 2XVMA 4CKCB 5HPYB 1OH6A 4KLCA 2C2KA 1T8TA 1MTOA 1OFVA 1T5HX 4HKTA 4QUKA 2PV0A 1AO0A 3HL0A 4OJNA 2DG2A 4B3TB 3CSSA 2OY0A 4B7AA 1EZ1A 4FHCA 3FUTA 3T1YB 4RGBA 4O29A 4EHFA 1E5QA 3HSKA 1Y81A 3D31A 4UM5A 4ITVA 3VOTA 3WYEA 5HOQA 2VZ8A 1DP4A 1VG1A 5JXGA 1IY1A 5KTYA 4CUZA 1C80A 1XMPA 5A2GA 5CM8B 4NYMQ 1SBNE 3IE2A 3ACDA 3OAAD 4JX9A 4M0CA 1XHEA 4E2YA 5FTWA 3HV2A 4DCGA 5BMVB 4JMLA 3DH0A 4QD3A 3IERA 3ND7A 2YNMD 2KJQA 1K3FA 2OCYC 2YFKA 1KVQA 2JBAA 2VTVA 3BMQB 4LDQA 1JHAA 5CPBA 3ZY6A 4O4LB 4AMGA 3NTUA 1ZCBA 1W34A 1Z7GA 2CLFB 5CVCA 3RSZA 3HM9A 3FBTA 5A4DA 3SE7A 1NIPA 3VMFA 5CB6A 2XNSA 1JJBA 4IO0A 1PSZA 1ZRSA 2PL1A 1R4MB 2P41A 4NONA 4BZXA 5K0LA 3F98A 3FPGA 5AHXA 2WHXA 3UICA 1KDOA 3PDJA 4DLNA 2C8JA 3MN1A 4KO3S 4LVCA 4MJLA 1N78A 3FPKA 1UADA 5EIFA 2DQYA 4NATA 2DFLA 4WK2B 4R3UC 3T7AA 4ZV4A 3IURA 3KQWA 1VLHA 2JI9A 5FPQA 1C0EA 2IH4A 5JC8A 4I1VA 1M6EX 1Z5UA 2OZLB 4I4TF 4YAFA 1I4EB 2JLCA 3JQDA 1N77A 4BMXA 4WTOA 5IEBA 4GLOA 1AG9A 5SZKB 1TO6A 5LOVB 4ZCQA 1V16B 2PGIA 4PPYA 5I5EA 4B3IA 4JBIA 1B00A 1V4VA 3D59A 4ER0A 3R3XA 4P0QB 4JWTA 1ZSVA 4LOLA 5FRDA 2PXAA 2Q1XA 4TYQA 3DVLA 1UDAA 3GBVA 4IDDA 4KH0A 2IZ7A 5I9SA 2J9XB 4KXYA 4QBFA 1ZCZA 5IWAB 3ANYB 3PNQA 4K0KB 2P6RA 4PU0A 4DPMA 1JS1X 1WKBA 3NRCA 3NC0C 2J87A 3F6YA 4PLYA 4C06A 2O2HA 4JI6B 3Q8MA 4B3GA 1LS6A 3IUJA 1E64A 1PJZA 2P9JA 3AXTA 3FZNA 3X1WA 4D0LB 4CLEA 4KRXA 4BXOB 1L3BA 2B7CA 1ZR4A 2IVZA 2OXEA 4E4TA 2FTKE 3K5PA 3S5JA 3F5FA 1PQWA 2XCRB 4CKXA 1QFZA 1LPBB 1NV9A 5IARA 3EEYA 2I4MA 5C34B 3VV2A 1U3UA 4LHYA 1P6QA 1XOIA 3KYDB 1Z0AA 4K9DA 3RFUA 3K1AB 4MO2A 2VN8A 3S7TA 4RUKA 5AVWA 5K0GA 1O87A 1ZUHA 1BW9B 5C0OE 1XX6A 5FKJA 4LFCB 3VO9A 3VPFA 3ICCA 5BQFA 4GHWA 1QVVA 4L9SA 1G5PA 3N5KA 3Q3HA 4HGZA 5EQDA 4M1OA 4DKXA 4RZ3A 1ZOLA 2PKQP 1BA3A 2HRBA 2OSVA 3IALA 1FRFS 3B1VA 1UPBA 4L08A 1D5WA 2HWYA 4FFRA 3ZWAA 3W5UA 4BGEA 4Q82A 1K8QA 1C3EA 1I94B 4X1IB 3U7GA 1TJYA 2P90A 4CEHB 1E1DA 2O1EA 4NMMA 1E59A 1ZVMA 3I72A 4Y2SA 2JLUA 2D7CA 3O0DA 4GC9A 4Q21A 2M1XA 4MV5A 1V48A 4XB1A 1WXWA 2QAGC 2I22A 2IPNA 1QGED 4JASB 4P4UA 4M1MA 2X2FA 1IM8A 1O5IA 2A5LA 3BA1A 3BL5A 4CWAA 3PFCA 2J6BA 4EMSA 1MDBA 4RK0A 3USZA 3GGGA 1XZDA 1ZI6A 2GPNA 3EBOA 5FHQA 3WNDA 5LXTA 3L92A 4D4JA 3B7WA 1WU7A 1FDRA 3EZFA 3N07A 4MHOA 3O0TA 5DTRA 3WZMA 5J2TF 4C6TB 4KQHA 2EJVA 3ZCVA 2XB2A 1KR2A 2EZ9A 2ZCUA 2Y2VA 2QP9X 4FXOA 4CCAA 4W6ZA 3TBKA 3DAOA 4MW1A 2D00A 3N70A 1PEDA 4KEAA 4YB8A 4PX5A 2Y0CA 1WQ4A 2BUCA 3WNCA 3FMVA 4KIUA 1IVSA 1RCTE 3AY7A 3NVKI 4MS1A 1CUWA 2G9ZA 2IT1A 3TGWA 3HFJA 3U40A 1HWYA 1T2FA 2UZ1A 5FOQA 3U16A 4TM8A 3PJEA 3RJ9A 2CKDA 1IOWA 3B70A 4KXMA 4XEUA 1YVUA 4A2CA 4F72A 4DKJA 2E49A 1HE3A 3AEKA 1XB2A 2QTGA 2JI7A 5AK5A 3HKCB 3UXMA 3F2VA 1G9TA 3AW9A 3D54D 3FG9A 2V6IA 1DBPA 4JQZA 4GM1A 3L0BA 2BHSA 2P9FA 3N8GA 3M34A 2JJ8A 1IAVA 1ZKMA 2RI0A 2IXDA 1SXGA 3AG6A 1IN7A 3T35A 2V0CA 4J0EA 1XRSB 5EGNA 2VH2A 2C1EA 2MYNA 3CT6A 3OAAA 2VLBA 4ZVTA 3ZCRA 1XVTA 1W7AA 2YJ6A 4P9NA 2QMYA 3FR7A 3LA8A 4NBVA 1YIDA 3UGJA 4D0NA 4REMA 1PNTA 2MSDB 2P1ZA 4N8EA 2O4CA 3C15C 1WNTA 2C9ZA 4DCVA 4ZYWA 3E22A 1JIKA 4HGRA 2PPLA 4ZOLB 1OX4A 1ZPDA 4D02A 3GJ6A 3P2EA 5A5VA 1R0YA 4OHRA 1I4TD 3AB8A 3GJ8A 2VJMA 1QIJA 1BFDA 3FIUA 2G8LA 4NPHA 3NEYA 2CXQA 4FXPA 2HI0A 3DV0B 1C0LA 5A0FA 3SYNA 2Y4NA 3N5CA 1XPUA 2X2OA 3HJUA 5AYVA 4J7AA 4DARA 3UK1A 4FGZA 3V4OA 1OXXK 4Q3AA 3LPMA 2PU7A 1T29A 2G1AA 4NCNA 3VKFA 1A82A 1QS0A 2QLMA 3QIVA 1IY2A 4Q02A 3V46A 1R8YA 2QE7D 3PNLA 1N5DA 1FPQA 3KKQA 1K9VF 4NARA 3RSOA 2VPIA 3L1UA 4PG4A 2V5UA 4XYGA 4CKWA 5JQGA 1N6PA 4UMFA 4PG8A 1JIIA 2FP4B 4WCDA 2BAGA 1CUHA 1T2UA 3LX8A 2CUZA 4Z4IA 3ZK9A 3Q3EA 2CNWA 3L49A 4MVJP 1YQWA 4O2AF 1QR2A 1KOGA 2QS9A 4IHJB 5U1PA 3OJCA 4ZHSA 5AM5A 2H2AA 3AETA 3HNOA 5JDCC 3PEEA 1P0FA 3QVMA 2BEKA 3OP1A 4DDVA 4LF5B 1JKJA 2PAFA 1SKYE 1E6WA 2N46A 1Y1QA 4OHCA 1I14A 2IYUA 4WD3A 2YX1A 1TK3A 2OXCA 1QTRA 4KQ1A 3R7NA 3K1TA 3QKIA 3ZY4A 3ISJA 3D3QA 1UCFA 1V7CA 4F1WA 2P2NA 2A9OA 4M1EA 1OZFA 1Z26A 3E58A 2AD5A 1UZAA 3V6MA 5L53A 2WQ7A 2Y0BA 3S44A 3TTVA 2OECA 4G0XA 3CISA 3C1UA 3ML1A 4TRRA 2BONA 1PTKA 2HA6A 3AR5A 3KPYA 5DEOA 4C7XA 1NAHA 5C8ZA 2B61A 3C6BA 4LXGA 4F5ZA 3Q7RA 4EHHA 4ZN6A 3TMKA 3D4BA 3TTYA 3LM8A 2OHVA 3KPJA 3NTLA 1XZKA 3F4KA 1KERA 4D41A 1E3QA 1M0SA 4CF3A 2FEWB 5JMOA 3CX6A 3BWYA 5H1YA 4OQFA 2XADA 2NSHA 3R7LA 4HX9A 3MMPA 1WZIA 1FS4A 4MR8A 1Z8FA 4R7ZA 1RLUA 3CLHA 5JEDA 3RS7A 3WGJA 4DJTA 4URYR 2FMUA 1N4DA 3H0KA 4K3UA 2B30A 1LV7A 3W6UA 1D8AA 2Q7DA 1PS8A 4QVGA 1SQSA 1II8A 2P5SA 1VHJA 3ENNA 4DB4A 2GFHA 5A3RA 1DKNA 2CNOA 3HNPA 4C2TA 2RH4A 4HO1X 2GPBA 4KAXA 2EBUA 2VUTA 1I1NA 1WX1A 4D74A 4IJ6A 4FB4A 4JBNA 2YJ3A 4L8VA 4CF5A 1B8OA 1QCZA 3NTOA 2B94A 4ABYA 2VF7A 4K6CA 4BQPA 2R6HA 4JLUA 3B85A 1F0KA 4L7QA 4EB6B 2HMVA 1VECA 3TD2A 1XTKA 3KXKA 1W19A 1XROA 4GX2A 1T1JA 2HYIC 1ZITA 3AC0A 1O97D 5JDIC 1TNDA 2WR8A 4G2NA 3RBVA 4KX5A 3ZCSA 4L0MA 1PS9A 4G25A 3LV8A 2HPHA 4X93A 1W2GA 5DGHA 4RKYA 1N9GA 5F21A 4ARSA 4AKEA 3QOFA 1V8ZA 2Z43A 3CUWA 5EHZA 1KQPA 3EXHB 4OP2A 8OHMA 3JWHA 1FVOA 1EWKA 1TQ8A 3TM4A 2YZNA 2DR2A 3RVDA 1A2KC 3CRQA 2ZR7A 3OZRA 2ISSD 1NPYA 2IOQA 2XVAA 3L8GA 1ZX1A 4N0EA 3S2SA 3GZNA 1EHCA 1WMBA 4UHEA 5ALEA 1F6DA 1JVNA 1Y4SA 2IYRA 3KO8A 1H4SA 1M34B 2WJJA 3I5UA 3TUIC 3K0BA 1TZCA 5FPHA 1XZLA 4GP6A 4L22A 4NCAA 5BNTA 4AUKA 1CDDA 1IN8A 3R4CA 2JAHA 3IIMA 3QBJA 2OHGA 2JLBA 2X4GA 1VIYA 4GO1A 2OA0A 3RB8A 2J67A 1UXGA 5JATA 3P26A 2O2YA 4QU8A 1Z5ZA 3T5MA 4L0QA 4Q9AA 3ZHCA 2W48A 2Q4EA 4PC1A 3R3VA 4HY3A 1P91A 5B37A 1G1MA 3PLNA 2WWXA 1UMDA 1OT5A 2FXVA 2WPDD 1WRBA 5AOCA 1Y42X 1ZRMA 4EF5A 1U8TA 2YIJA 5LZ7A 1X8XA 4MR7B 2R1TB 5L45A 1QH9A 3T9DA 4FMCF 2PWYA 4C43A 2QD5A 1R5BA 1XMQB 2WI8A 2CB0A 3CJTA 4J1SA 2ENUA 4IQ8A 1FC0A 4PFKA 4WT7A 4NBNA 1I1OA 1WMDA 1UIRA 4P7GA 4QTZA 4YCJA 1IHUA 2YH2A 3NHYA 4GF5A 1ZNQO 3KT6A 4L4RA 4QBIA 2FPUA 3VPAA 1V1JA 4EUHA 5BPHA 2UUBB 1ZM2A 2EF0A 3TZEA 2H18A 4XDYA 2IZOA 4C4SA 1PDOA 1ULHA 2CFSA 3GLKA 3WLNA 3LXXA 3OQOA 1F2TB 4TT8A 3AR4A 2PDAA 3PC7A 4FDAA 2NQ8A 3UV3A 1FW6A 3BHMA 1SCDA 1MORA 1O94A 1UOOA 5SY9A 4ZJPA 1E0JA 1Y6RA 2A4KA 2FEKA 2ZR8A 4MW5A 4ZREA 2EFEB 3KYIB 4EG0A 2DVMA 3BTUA 1KAOA 5FLKA 2OXTA 3DNFA 3D8NA 1GAWA 3DE3X 5LP1A 5IT9A 1E96A 2O1SA 2QX6A 4FSHA 4BWFB 2Q5HA 3KKOA 1AZTA 3DTYA 5H5JA 5IBCA 4K0RA 4LXTA 5DM1A 2I6UA 1PQUA 1R0WA 4F2PA 1PL8A 1KZ6A 1PSWA 3EWAA 3CGGA 3CZ4A 3DMFA 1IG3A 1DEHA 3WS7A 1RPTA 3IIIA 1AKUA 3HA2A 2WYVA 3COSA 3P96A 4CTMA 1C1XA 3CY6A 4W8OA 4LBYA 5E4JA 2K6GA 2BSQA 4IUYA 3PXEA 1QHIA 3FETA 3H19A 1QFYA 2X5XA 2XYQA 2XECA 4EA8A 4LMAA 3ZY3A 1VCNA 3BWXA 1OIVA 3LSTA 1T6NA 1E9AA 3JATB 4XYLA 3M5CA 3RVKA 1Z73A 3ULKA 4LV8B 1XQVA 4R8KA 4DSZA 3FUCA 1I8TA 4FEAA 3E61A 3S1LA 3T5TA 4ILKA 1ZGAA 3BRSA 4DCMA 1EVLA 4EB3A 2OKCA 3QUBA 1MAVA 2Y1LA 3D8BA 5KDLA 1U8ZA 4AAYA 4XUGB 4Z8YA 1D2HA 1SA0A 3OM1A 4U9IS 3VUEA 3SX2A 4KKXB 4X65B 5T67A 3R0ZA 3KT3A 3QLUA 4MEBA 5KIAA 4G1BA 1QYXA 4IGIA 4X63A 2NAFA 3GJQA 1J70A 4JC8A 5DF1A 1RC0A 3FWZA 4HVTA 2UYGA 1Z2EA 1EINA 2O5EA 4TV9B 3SM3A 1WLSA 3MTEA 4FVTA 2PSEA 4F8JA 3V8EA 3D4IA 5EKXA 1L6RA 1OTHA 4IX1A 3W7BA 1YAJA 3NP7A 4C04A 5CITA 2R5NA 3TFOA 4Y9SA 2AXQA 4XWTA 5B6JA 1FA9A 1V25A 3ITEA 1V3TA 2Q49A 1EM8B 3HDGA 2BDEA 4HN4B 3EQ8A 1D07A 4KV9A 2IHYA 4IDAA 4D4HA 4DIBA 4YV7A 4EJ6A 5IJ9A 3OO0A 4PC3A 1P4SA 2X1VA 2HA7A 3OLVA 1MEOA 3MXTA 3CNEA 4N6NA 3RM3A 3GA0A 3DVSX 2WFLB 2ODAA 1CS0A 4OGFA 1R5OA 5G02A 1GT91 3ZHOA 2UYHA 3EUAA 1TYEB 2NUAB 1N6OA 4JXXA 2XMQA 3N0VA 5ICMA 2HA0A 1ZC3A 5E7MA 1GPUA 1PG5A 3L1JA 1YU9A 3AF6A 5FWDA 3MJCA 3K4QA 4TMFA 3EC7A 3RREA 3FZEA 5FT9A 5TSDA 1T1GA 4IXTA 1EUCB 2HLDD 4JFRA 1E3LA 1E5LA 4K1LA 4R9UC 4E31A 2YRFA 1ZD1A 2Z6VA 2CLMB 1TTPB 3K92A 2ZRNA 1GTRA 3PC3A 4FFNA 1AY0A 2YWBA 4U5XA 4FB5A 5DM70 3TE7A 4JLSA 1KQFA 3IT1A 4QUBA 1TF5A 6NULA 4PZEA 1NTRA 4QOGA 2EGHA 4EQ6A 5HRCA 1H93A 3SSNA 1Q5PA 4CCYB 3RCBA 3TG8A 1PG2A 3JQQA 4Y2XA 5IAEA 1T34A 3C3BA 1XUOA 1YJAA 3M4NA 2NUTB 1G6KA 4P58A 1VG0B 2GZSA 2KPOA 3TI7A 2AR0A 3UAXA 4LDZA 4AXXA 4BVEA 4TMVA 4QULA 4A2PA 1ND5A 1V26A 2O2JA 2PZMA 3BTVA 1T2DA 1E2EA 1FDWA 4IWNA 1ICEA 2GAJA 3WLLA 2E4YA 4YCAA 2NZ8A 5LYJF 1PTJA 3C74A 1DIBA 1U8XX 1Q7EA 1W1IA 2OK7A 1SU4A 2RGDA 4BB9A 1NNSA 2PJZA 3IEUA 4RHUA 5CK4A 2CGEA 1KSGA 4BQEA 4QVIA 1KJ9A 2ONCA 3DONA 4HTFB 2ZBFA 4J7CA 5IW8A 5CTJA 5EMMA 3DW3X 4BVHA 4QM7A 2FWJA 1KYIA 2WU8A 4EB8A 4FWTA 1EP1B 1NN3A 3PQ7A 1AKVA 1K86A 4MPTA 1GRQA 5HM8A 4MZXA 4XH9B 4W7IA 3WWEA 1CHNA 1OLXA 2ZVJA 3I9JA 3DYVA 4P0TA 4CIVA 1MT0A 1FNMA 3WR5A 4E5SA 5AVZA 3AUSA 2RC6A 3OBIA 3AG5A 2QR2A 2C58A 3E9DA 1G7TA 5ICGA 2V7WA 1EK5A 1JSRA 4S1WA 3VM6A 1W36B 3CZPA 4LMPA 4M0DA 1BAPA 3S1SA 1P72A 3LC7O 3QPWA 1F0NA 4TTTS 3I28A 3I1FA 1YDHA 1ZXLA 5TPWB 3QE3A 2OB2A 3DZGA 4DCJA 1QCYA 4XCXA 3THSA 2P6UA 3KJZA 4DIDA 2FNAA 4PZAA 4QKQA 5FNVF 1G5QA 5G53C 2JIMA 2PBLA 3KR1A 2IEBA 4UJ5A 3Q72A 4LY3A 4KHZA 4EKNB 1QMGA 3Q9SA 4LGVA 4ZGBA 2RGWA 2ZZNA 3EODA 2OILA 1UPAA 3QBEA 3ENVA 4CM3A 4BATA 4W82A 4YH1A 1JDTA 2H0AA 3ZKWB 2ZXEA 2AEJA 1TCCA 1L5KA 5BSHA 3ZWOA 2JZNA 5G1NA 4PHFA 3QUAA 1J8FA 4FOLA 1L5LA 4YAKA 4CZ2A 2W7TA 3RANA 1XRLA 4R05A 3OD1A 4P3NA 3UJ7A 2YR0A 3DQZA 3PT5A 4D9NA 4M1WA 2PQ6A 4WXMA 1CX9B 1QTIA 2GK4A 3PJFA 5K3DA 2O52A 1IXZA 1SCKA 2Q4TA 3E9YA 3HC7A 4Q1CA 1VCMA 4TQAA 5EKTA 3P9KA 3S8MA 1EFLA 2QMQA 2VQFB 3AUYA 4FEYA 2W6CX 3D7MA 1I1HA 1NN5A 5BVHB 1JZQA 1MB9A 3OMLA 3QKTA 5GJCA 4QHSA 2YQZA 3B9QA 1S6YA 3RIYA 3DCYA 3QVLA 1G19A 1XGKA 3GFOA 3N8NA 4LZPA 4XGNA 1ORVA 1FUUA 4WZZA 4EY4A 3GLVA 1XEXA 5JTUA 3BH7A 3CVXA 4XFDA 2OCAA 1QFMA 1X15A 2JBWA 3AOEA 3DBLA 1E9VA 2D5CA 4JNCA 3C70A 4KXQA 4IGEA 1CR0A 3NX4A 3IE1A 3R40A 1FP6A 1OOEA 1RAAA 1YKSA 1OI3A 1JZSA 2ZBUA 5F3RA 1AT1A 2G5GX 2J9FB 3H5AA 2IHKA 4DLRA 5ABPA 3WXBA 4RL4A 2QVZX 5GVSA 3E2PA 2A9KA 2YNMC 2MR6A 3NDJA 1ZQ9A 1KJWA 4ICIA 4J76A 1NW5A 2HLDA 4P84A 4BIIA 2ZROA 2ZUDA 3C43A 3SLRA 1T3LA 1U1DA 1ZSNA 4OHXA 3U5ZB 2AV6A 3UUFA 2X1MA 4YV0A 2JJMA 3URKA 4F8YA 4S05A 3EQ2A 4JL8A 2W6JA 1X74A 3RV4A 3G89A 4BQQA 4X54A 4EF6A 5JNLA 1FYWA 4KN9S 1WHTA 3U09A 1Q1BA 3NBYC 3QH4A 4KYUA 1UBTS 1HLDA 3I37X 2ZWOA 4MPPA 4U2KA 1U11A 1KP2A 1MU0A 1XT6A 2HA3A 1FFBA 1K7CA 4HJXA 2G9UA 3G82C 3H2BA 3MCVA 4KV7A 1BU5A 3E8XA 4IRUB 4LWZA 2F67A 3EOZA 3RF7A 3BL6A 2Q28A 2H59A 3CIOA 3LLCA 5HIIA 1Q0HA 3O9ZA 3SYLA 5CG2A 4GKKB 2IS2A 3QNUA 2AFRA 2IUUA 1P1CA 5LQKA 3IOEA 3AXSA 2WFAA 5FUMA 4V3CA 5FOUA 4N1AA 2VDOB 4YCCA 3M6FA 3ELBA 4MYHA 4YXWD 2K5UA 4DA9A 1GNPA 4NK5A 2QNRA 1FJXA 1TYDE 3U62A 2HMWA 1EWYA 1RZVA 2AOXA 2FJPA 1NOIA 1YULA 4MYRA 5H3HA 3W7AA 2VQSA 4JODA 1VE5A 4LCJA 2HK8A 3M7IA 4B3MB 1MOSA 3TLGA 2Y0DA 4K5QA 3DZKA 1T3ZA 2XT9A 1FVXA 4F71A 1E61A 4GT1A 5CTAA 1PV1A 1X92A 1JFTA 3DWEX 5BN4B 4B3BA 10MHA 1L8AA 3VBCA 3IAM1 3BD9A 1Q44A 1ZINA 4X1OA 5F77A 1W4CA 4RTNA 1PKXA 3HP7A 1E18A 2JAWA 1TZKA 4MJ7A 2J5BA 1DVRA 1O0SA 1Y4ZA 1N92A 5L7TA 1QK4A 4FMDB 5HTOA 4Q01A 4NY1A 4E2FA 5AVSA 1VGQA 3QBTA 2C5SA 3BJRA 2O8DB 4C2BA 1AN0A 5J1TB 3CNQS 4GUAA 2JGRA 3C6YA 3FRJA 1KZGB 4EFNA 2Y1EA 2ORWA 3C39A 1MBZA 2TS1A 3NVAA 3DEIA 4PTYA 2J3IA 4WN9B 4YFYA 5JWHA 1L5YA 1MFPA 3KUKA 4UZEA 1FB5A 1U3CA 4J1NA 3GO4A 1ISSA 3TIIA 2PH7A 2DY1A 4C01A 3HU3A 3QPAA 2K4MA 1T25A 3AFOA 4AZ3A 2EYUA 4CKEB 4LJRA 3EW7A 3IKMB 3L6UA 4GGMX 3DTNA 2CJWA 3N2GA 1N2SA 1YDEA 5F35A 5C8DA 1S8FA 3RC3A 1QGOA 1KEKA 4PZPA 4I5DA 3BAZA 1X1BA 6YASA 2IBSA 4WFQA 4HGYA 4AUEA 1Q17A 1EQUA 4KR2A 1RYZA 2BFWA 2I4IA 3C16C 4LJKA 4HP8A 1ZVVA 4JNKA 2HQ1A 1C3XA 2Q99A 2NSYA 2XRFA 4RK6A 4TQGA 4CM6A 2W2MA 5BWLA 1LUAA 4EFMA 3CN7A 2WF7A 5E95A 1R00A 3GUYA 3QZUA 5FBHA 5B36A 5IM4F 3KFLA 1N36B 1OPXA 3CW2A 1J99A 2GKSA 4LCEA 4MMZB 2O2EA 1DJNA 4PS1A 4DNFA 2PL9A 4LWPA 4AJHA 3KYCA 2GH1A 3B3AA 1NW9B 2R66A 2XWSA 3NIWA 3OM9A 3KUDA 1FTNA 4RY2A 3V8RA 2CFCA 1W59A 2I3DA 3GHYA 3PIDA 3QNWA 4HAOA 5LR6A 1COZA 1EK0A 3ACCA 3UXHA 4DXHA 3AF5A 1U0GA 3DOUA 1E98A 1UOEA 3MELA 4GRAA 1TRHA 5J5VA 2HSGA 1FTYA 3N74A 3OEEA 5EIEA 2BRUA 4KNYA 2CJFA 2FFJA 5F12A 3GI1A 3PFBA 3HB4X 2R97A 5C35A 1M6VA 4Y2HA 3ZV6A 1R15A 1ZK3A 1ZMBA 3KEQA 1Z4JA 4B9EA 3H1EA 1H4VB 1MX3A 4CXMA 2H9AA 2NAPA 4MCIA 2LCIA 1SOUA 1I9GA 3HYNA 3L6BA 2C7QA 2FZ5A 3HUDA 5CBPA 5F51A 2PXHA 3WHIA 1EHYA 5EMHA 3ZVRA 2O07A 1ZBQA 4AJEA 1JHXA 4LYYA 3A0UA 1VJGA 1NJSA 1N8KA 2XRMA 2FF5A 3FKQA 3G9TA 2R60A 3QOWA 4CM8B 1TD9A 1DRWA 2FFRA 1ZD3A 4LPKA 3JQBA 3UMCA 2I99A 2YHAA 3RV3A 1D0IA 3EQZA 2I80A 2WWIA 1X1CA 1T6YA 1EX9A 1VE3A 4RTMA 3F8TA 1UIMA 3R20A 1J56A 3AHFA 1KJIA 3QTTA 3C3EA 3EZ7A 4O4HA 4XOUA 2DOKA 3LCUA 3T0IA 4Y98A 3FZQA 4JLWA 1FDSA 1QK3A 2HV8A 4BJ1A 3CRW1 1D2NA 3AP3A 1L5SA 2MINB 4OL9A 5CX1A 2G63A 4BCBA 2DFVA 3TH5A 3DB1A 3AZQA 3SEAA 3TIGA 2FKNA 2AK2A 1UJMA 1P29A 2Z98A 5BSWA 5DTJA 4LTDA 1HQDA 5I8WA 5JNRA 1JG1A 1J23A 1PJ3A 3O2JA 3F96A 1OC4A 2QMOA 4ND7A 4A8TA 2IBMA 4G0PA 3UPTA 1XYYA 3L5OA 1IPFA 3AY6A 3N2KA 4CLOB 3NEAA 3MK31 3T52A 2PUVA 2D1FA 4RY0A 1QP7A 1FDUA 4RHCA 1XZJA 4DCNA 4IMRA 3ENQA 4Y9RA 1QF9A 4QYIA 3G5AA 1JIVA 2FRVA 3PDCA 4IV8A 4MDHA 1Q3TA 1XF1A 4BTLA 1WA5A 1TI7A 1X1RA 3M6WA 1YZKA 4KOEC 3WGZA 4F2DA 4YXWA 3UFXA 3SOZA 4BB5A 4FI3F 2Q5CA 4UXIA 4DWOA 4A9AA 4NBTA 3M6LA 1G21A 4B4VA 4NZOA 3V8PA 4BNNA 1S8AA 2IDKA 3VNBA 1LTKA 2VWQA 4YGXB 3RG8A 4AYWA 1DAKA 1NX9A 3PNBA 4PCVA 3PUJA 5ECYA 5KX5A 1YB7A 1FF9A 1UJ4A 1IBKB 5ADWA 1YJ8A 5L3QB 3OD5A 2JATA 4KWCA 4WGFA 2J32A 2W2LD 5TQ0B 3ECSA 2X9NA 3E5RA 2GD1O 4D9GA 3C5HA 3HJNA 2A0XA 3IUPA 1NWCA 4ZI5A 5CG1A 4JKYA 3IXLA 3BJEA 1E9FA 1OSNA 4D0GA 4HVLA 4Q12A 4QUGA 2XBLA 1KO7A 5DO9A 1L8LA 3VKHA 1UC9A 5ALWA 1K2WA 4B4UA 3HHEA 3M1YA 3M9LA 1C81A 2GN0A 4CJXA 3ESRA 3HKBB 2CNKA 3KAJA 4LSZA 1ATZA 2WHPB 1PJSA 4FLMA 1T1EA 4KLAA 5CB4F 1JG3A 2HSEA 2W6ID 3L6CA 4GZLA 4HDRA 1O6FA 3D8HA 4J03A 1XJQA 2GBIA 2B82A 3OZGA 4ZGGA 5LQAA 2RHLA 1HETA 3PUWA 4CIXA 1DKQA 3EB9A 2C9BA 3P27A 3D6UA 5T5QA 1NUQA 2E5LB 3Q87B 3RVRA 4H7PA 2FW8A 3REOA 3UHPA 3VR2A 1IPEA 2YWGA 4KAAA 2B4YA 4QGBA 4A6XA 5I7EA 1PR5A 2Z58A 3MWEA 2C42A 3G79A 1R66A 4H7KA 4LOAA 3ZJUA 4JJFA 4PCUA 2DT8A 1KO4A 1PLJA 1VE9A 3HTXA 2GYVA 3CIFA 1QCCA 3E7DA 1E0SA 5DDIP 3I6QA 1G98A 3R7SA 1GA4A 5B57C 3AH8A 3DZIA 3JTEA 3PC4A 5TEVA 3QXSA 2XKAA 1P4JA 4UUPA 1U1GA 2GB4A 4RWZA 2QUIA 5FA8A 1XVUA 2BZ1A 3V4LA 4I14A 5A6SA 1IEWA 1NM5C 2DYKA 2JGDA 3WJ7A 5CLHA 1NDUA 1JDUA 1I6LA 1X77A 3LVFO 4RETA 1KI4A 4UNPA 1N0IA 1SKUA 3OY2A 4OBWA 4H3HB 4L74A 4OXRA 4F4CA 3SE0A 5HS4A 1VL1A 5GZ1A 5TGTA 3BJIC 3L8HA 3AHDA 3BMNB 4IIEA 5KTPA 2WZBA 3JYQA 1N9ZA 4TSFD 2D1YA 1Z6YA 4K9PA 3B60A 4OCZA 1BDMA 1TUIA 3EQ7A 1JBQA 5D3QA 3RASA 3PF9A 3U13A 2VSXA 1SUBA 1S3IA 3OJXA 3K5IA 2BKXA 1FYDA 1XWWA 2QTLA 2CFOA 4IF4A 4CDMA 2VFAA 3PR2B 4EG7A 2NU9A 3CB2A 2PS3A 2IDJA 4Q00A 3GLFA 3P9CA 1GDHA 4JB0A 1NGSA 1FNBA 2EW8A 2X1LA 2ORYA 2QAGA 1BMQA 1YDWA 3LBYA 3ZE7A 4XVUA 3OY7A 5AXCA 4KJZA 2PZJA 1DEXA 4YJKA 1K97A 1QCDA 3C0KA 4HRXA 3A9TA 5GGYA 4HDAA 3V2HA 3OQJA 1UAYA 4FYVA 2AFHB 1QYWA 5LJIA 1AA6A 1U2QA 4BBJA 1MO5A 1OXBB 1UXKA 1QV7A 1X80A 4AJLA 1BVRA 3ZWXA 5EY5B 5AM0A 2C0PA 2C4KA 1FMLA 4CKZA 4UMDA 3PGMA 3UA4A 1XEFA 3CG4A 2WG0A 4RH0A 3SZ3A 4ZCPA 3WB2A 2D1TA 3UKJA 1HGXA 3ET4A 4GMFA 5HCIA 5I7HA 2YW2A 5I9LA 1OI2A 5KNLA 4RU1A 4GOXA 2Y1XA 3R7FA 1RQNA 1N7IA 2CXXA 4WDRA 3QMPA 5J40A 3KZOA 4W8GA 3CT4A 3TKLA 1UBGA 1F9AA 4CRWB 3K35A 4NCKA 4ZVLA 2W98A 2HWWA 4UPEA 3CG0A 1LH0A 2GHTA 4UCFA 5JIBA 3KSAC 4X9XA 1Y34E 1SVUA 3C3MA 3SQOA 1TJPB 3IAAA 4PN7A 3AHJA 4CMBA 1BA2A 1XZEA 3HRKA 1K5DA 2I8LA 2VT6A 2WYHA 3DNPA 3KTAA 1QX3A 4KB5A 3TXYA 1FLAA 1RKBA 2PS0A 2UAGA 3K1ZA 4TVBA 2OESA 3D5TA 4OHBA 1GWNA 3Q12A 2HCRA 2OGUA 5E9QA 4IH9A 1VBFA 4B44A 1UKYA 3HRIA 5M29A 1DAGA 3W05A 3GAZA 3P0HA 1SK9A 2C61A 4L8FA 3RAFC 1DV1A 2ZTUA 4J1TC 2NLOA 5ULLA 4ZEVA 1EJBA 2J0UA 4XQ9A 4IZIA 3OQBA 1VCOA 1W0JD 3NJRA 3PTZA 3A9VA 4LQ4A 3NATA 4HQRA 1E3MA 3WRXA 3GFRA 3OPYB 3CKLA 1RM5A 3DMGA 2WZDA 4HV4A 4MZDA 1YZQA 2FPWA 5LLTA 4IXMA 3AUUA 4C03A 1UWLA 5LXTF 3LT5A 1N9KA 2Y1WA 2OV8A 1U02A 3SF8B 1KMHA 1OY1A 2QQ0A 3B1YA 1EBBA 2WM2A 3TINA 3OZWA 1PT5A 3M1LA 4EMTA 5HKKA 4NJMA 4AP5A 1DBIA 3S1AA 2ZR9A 1VKNA 5TY0A 2W6IA 4B6RA 1QIKA 2DSTA 4FN5A 2NXEA 3QU5A 4I5GA 4X00A 2BR3A 4WCFB 3WV5A 4FFBA 1NY5A 4Y9TA 5KTSA 5F9FA 2QIOA 3ZXIA 3PLRA 2ZZKA 4FX5A 4DR5B 1FQKA 4HYQA 2A92A 1WCIB 4BNXA 4FIDA 4AJ9A 5LLSA 4D4MA 3WTCA 3VSDA 3CNOA 4DDWA 2WOOA 3M81A 5DIZA 2WM3A 4JVOA 3ONWA 4NZZA 4DNQA 3B36A 1G3MA 4ND8B 3SLGA 3M3DA 4H7DA 3D8UA 3MPOA 4U7HA 4DM7A 1A9XA 3OQPA 4GPEA 3CZQA 4HQLA 4B80A 1WE2A 5EWMB 1CT9A 1FW8A 3R23A 4RW0A 4GVPA 3H7IA 3ZGXA 2NP6A 2P9CA 3HHPA 2EHJA 1KMMA 2P30A 3IAUA 1L7PA 4Q34A 1U7DA 3R9XB 4TTQA 3OTGA 5HWSA 3M49A 5CA1A 5HZKA 1MQSA 2XF2A 4HWGA 1MZVA 3PRJA 4X3PA 2JNWA 3K5HA 4OKIA 4TKVA 2CCGA 4YMGA 4ZOQI 5FDFA 2BZ0A 3AP2A 5J4HA 5JUWA 2XNHA 4QJ5A 3FYUA 3UMYA 3H9UA 4LJLA 5CJ2A 4G4JA 4EEZA 2ZAGA 2BBTA 2G1KA 4RVOA 4MVJM 3PP8A 1J8YF 2WVJA 3E9MA 1LRJA 1FP1D 4GMXA 1PUXA 4TSFA 2GRUA 4MINA 4NLLA 3ZWBA 2O8EB 3QP9A 3NDPA 2H6EA 2JH8A 3M6AA 5F98A 2QROA 2GILA 2REQB 1UP7A 3JYNA 4ZT5A 1EAMA 3ADBA 1K8ZB 1DMRA 4NKRA 2ZK7A 4RAQA 5KVSA 2WSMA 1B7GO 3QWBA 1YDFA 4K6HA 3SGLA 2BM1A 2XIQA 4X8MA 3K9GA 3SHVA 2Q9AA 4IAOA 3ETLA 2O0JA 3SZRA 4JGIA 2ZYTX 5JQGF 2J4FA 3Q3IA 1BFUA 2AR9A 1XEWY 3A8TA 2XXAA 3W5HA 4QQFA 4F4DA 5J4KA 2XD9A 3OI7A 4Y9DA 4ZVKA 3WBKA 3C6ZA 2GPAA 4XWKA 3KZMA 2H7CA 3JZIA 4H6WA 4MQEB 5KYUA 1IPHA 1KYQA 2O2IA 3JAWA 3KSZO 4KW7A 3U9LA 4C6SA 1S1MA 2PD6A 1ACMA 2EDAA 5JJBA 4TS4A 2B3DA 5FR1A 3RUAA 3ZDXB 1MGOA 3NC4A 1DDIA 1BRMA 3QK7A 3IRUA 3ENZA 2Q1TA 2W43A 4FZ5A 1R9JA 1TQ2A 4ZCTA 1YVDA 1ORTA 5JDIA 4YP5A 5LB4A 2V4UA 1UPFA 4DMRA 1VL8A 2L2QA 3GRAA 4R1OA 4AECA 3CNLA 4BBZA 5K05A 3L4JA 4TKUA 5KYKA 1JMKC 4BTVA 2I6TA 1J0CA 3K0AB 3T7CA 2BDUA 1UBEA 1QGAA 3SF0A 4HAZA 3DZDA 3OPVA 1YZLA 4US2R 5AW0A 3VISA 3K05A 1RWVA 1UFQA 3NWPA 2B4RO 1VE7A 4GGOA 1K1EA 2AJ8A 2QU8A 4GBJA 4I1YA 4HMPA 4W5HA 3N9IA 1UWVA 2IJGX 3AYZB 4IIDA 5AIAA 2POCA 5IZCC 2ODQA 2GF9A 2W2VA 3DQPA 3F1LA 3QVTA 4RTSA 2BGGA 4L8WB 5HF6A 4CVNA 5ERGB 5EVJA 4OQZA 4Y2GA 1PUIA 2R3SA 1RQRA 2RBGA 3HYSA 4BN5A 4TVKA 1W76A 1TT5B 1Z18A 4LTNA 2YVQA 3EGXB 1RWXA 3LUBA 2M2IA 4JYCA 2ZJ5A 3L79A 3SP1A 721PA 5EUMA 3ZXYA 3HCBA 3DZCA 1W0JA 1M1YE 4GZ6A 3M6IA 4PZYA 4I1PA 5HW0A 1MX5A 4MWOA 2VWGA 4LYFA 2Q3HA 1YRQA 1J24A 1KC3A 5AW3A 1U8UA 1ES9A 1V7QA 4QJIA 1Z8DA 4C20A 4RJTA 2VPPA 2GKGA 4FNMA 4ZGWA 1WZNA 3B5IA 5CH5A 1SD5A 4U7JA 3REQA 5C51B 4GYJA 1LDNA 3LX5A 3MM4A 3BPSA 2O6HA 3G3EA 4KQWA 1M0EA 4Q5IA 1E9CA 1ECJA 3ETCA 3CXUA 4IOLA 1R6BX 2COKA 4OQ4A 3KJQA 2CE2X 3N86A 3SSOA 4XM1A 3VVMA 2MHCA 3CH4B 3PQEA 1LQUA 3PUZA 7MDHA 1Z5WA 2WIGA 3C5EA 3C1OA 4YMHA 5IAAA 5JNSA 1MAHA 1W75A 2Z9DA 3C3YA 4NCXA 4PCAA 3V80A 4IIXA 4B2LA 3MWYW 1UK8A 4KI0A 4PNPA 3T3PB 3PR1A 4FE3A 4L5YA 5SICE 5B3LA 1JEQA 2IS6A 4MLZA 2PMBA 2R1VB 4FJ1A 4N3NA 4NBWA 4DA0A 1FXWA 3N2LA 4P38A 3EXG1 3RUHA 4C08A 1WIWA 2PNJA 1SEPA 2YW9A 2A9PA 3BMCB 1KSJA 5AOAA 5EERA 2E6UX 2VT2A 3PE6A 1P7WA 4TWBA 1E3SA 5LL6P 2WJWA 2FDCA 1JBKA 3GGDA 4I5IA 1LPOA 1QBGA 1R6XA 1USKA 3CLUC 3LLSA 4GDMA 3J80A 2YC2C 3R44A 4C78A 1P0PA 1Y5IA 2IYSA 2FRXA 3Q5GA 4RVDA 5IJ0B 2XCIA 2L17A 5FADA 2RI6A 5CX4A 2VR1A 5L4LA 2OP1A 1OW3B 2XDQA 2ZWAA 5C31A 5L9AA 1KA9H 1CIJA 2OEPA 2E4ZA 1EVIA 1XRNA 2JLQA 1RZUA 2IODA 2EJTA 2DRIA 2R2AA 2WSSD 1TKBA 4GMDA 1VJ5A 2YHBA 1WB6A 2YMLA 5EAIA 2EZ4A 3TK1A 5TV2A 5KKNB 1RMQA 1KDPA 1XU7A 1YA8A 1H0HA 1NLFA 1ZI8A 3G5LA 4FWBA 3S70A 2HHAA 1HMYA 3RSHA 2FYTA 3X44A 4RADA 1C14A 1GSOA 1PKEA 4FMBB 3T5BA 1FSPA 4K87A 1I2DA 1U0FA 1Y8QB 221PA 2WTMA 1YK1A 3M70A 1P1IA 4Y67A 3FCCA 3QF4A 5B1IA 3V4ZA 2QUKA 2ZJ7A 1QOQB 5COBA 3GLIE 2QQEA 1TFRA 5H0IA 3I6MA 1J7JA 3EY9A 5HUHA 3NS7A 4KODA 1YBVA 4Z4EA 2NU6A 4L4XA 5FD8A 1L0BA 1X1TA 2AB0A 5HMLA 3SZLA 3TQQA 1M83A 2IV2X 1FU8A 3RVPA 3PXCX 5LA6B 2I5PO 1XYGA 5JPCA 4YP1A 1A7UA 1KZ4A 2G80A 1QIGA 2AG1A 4MW9A 4UULA 3U3XA 5CYGA 3TKYA 2PUAA 5LSAA 4TMZA 4HNQA 1AOXA 2HC9A 4ZXFA 4AQDA 5BUCA 1SD1A 5AR1A 1PVOA 5LP6A 2Q5QA 5JD3A 1IRIA 4QFMA 1V6CA 3FKJA 5EJIA 4A03A 5JPDA 1LK0A 2XOXA 2V1XA 3H87A 1E4VA 2C3YA 2YWEA 1T0UA 1T0BA 4K9NA 3HS3A 1IULA 2FUG6 3ZE8A 2D62A 1WABA 2RKBA 1UEJA 1Z37A 4JBGA 2LCQA 1J39A 1UPCA 1E62A 2R6ZA 3ETEA 4HS9A 5IG2A 3L7BA 1QLJA 2CF5A 3QUQA 3T3EA 1PFYA 1OZGA 1U9CA 2E48A 2QRVB 3A1SA 3HMKA 4C4PA 4CGYA 2QAIA 2CVOA 3HO8A 2B2NA 3BFPA 4X1KA 1I3NA 4TTJA 4DMHA 3BD6A 5K7SA 4C0KA 3NHZA 4NNJA 4E5UA 1Y4DE 2XGGA 4IYRA 4RNCA 1N8TA 4UCWA 2QU7A 4H0FA 1FSSA 4B40A 4W5QA 1IQRA 1DUVG 2AOUB 1ECPA 4HZUA 4B17A 4M3NA 1GTSA 1NHWA 1N2EA 2FSVC 3O7MA 1P60A 2CNLA 4H7EA 4KMMA 2GMWA 1JB1A 3D2BA 1CZLA 4F4FA 1JG2A 1LVUA 3H5VA 4L4YA 3HUUA 4S1NA 3A2MA 3T3GA 1RXUA 2J9ZB 4XVHA 1VKJA 5EQJB 3A27A 1HH4A 2XB8A 5M2QA 5CVDA 3Q88A 4B4DA 5I7AA 3ZCQA 4D9JA 3FDZB 3PIIA 4R16A 4BLTA 2IHJA 1LC3A 2JGLA 5F1YA 1QH0A 1GKYA 5GONB 4Q6WA 1ZXXA 2CMFA 2HDHA 4IO1A 2WAMA 2WT9A 1YQQA 2XKKA 1ZJWA 2ZSKA 2TMGA 1PGQA 3TN7A 3PYMA 1X13A 3F5DA 4JUAA 1CY2A 3D6MA 3VKUA 3W90A 3O8RA 5H7XA 1G4HA 1RT9A 2BKAA 2P2GA 1R6DA 1XAGA 1EYZA 4LHEA 1ZVJA 1HE1C 2GZ1A 1O1YA 5H4GA 3GLUA 5I7OA 1NUTA 5JSKA 1Q2UA 3K15A 3M5WA 3QVUA 2Q1UA 1YVEI 2VLIA 4R1NA 2PA3A 2Q6VA 2QZZA 1P0CA 3MW8A 3W2IA 3OU6A 2W6MA 4RULA 1C4XA 4BNGA 4MW7A 1XFDA 3A4YA 1U7ZA 2VH1A 3KHTA 1RWBA 2YIDA 1RZ3A 3HDYA 4CTNA 4RTRA 2YASA 5AICA 1E58A 2GEFA 3QVGB 1JR3A 4U39A 1J42A 4BO0A 4EO4A 1BS2A 3O4VA 2ZRPA 3DP9A 2XE8A 2ZYIA 3IAFA 4B3RB 3AR2A 1RQPA 4ENQA 5ALRA 3BK2A 4RZ2A 4G26A 2BGRA 4CIAA 3F6EX 1GSHA 4IBOA 4UVHA 5IDVA 3GT3A 4EJSB 3FOFC 1XBTA 2AQHA 2R5FA 4UARA 2QJWA 3H5LA 3DLTA 4PLZA 3Q5EA 1VB5A 3L9WA 3GDFA 3PJDA 3QE4A 3W8RA 4DWJA 1YJ5A 3ZDCA 2A3NA 2R9VA 3LPNA 4GZMA 2H1IA 3R3JA 3QELA 4EGCB 3IHTA 4CIWA 3GK3A 3KB2A 4QLOA 4UU0A 1TAQA 3EVNA 3D0RA 1PZXA 5KJEA 4ZANA 1JYSA 2QUJA 1NU6A 2H8KA 5JZSA 3OLQA 4OQXA 4X45A 3IHWA 3K09A 1BVYF 1KEEB 2B83A 1L7BA 1J0BA 1M2HA 2PX3A 4EHBA 1EUZA 1G8HA 1FDVA 1NVXQ 2YVKA 4K9LA 4I3GA 3VO8A 5ALKA 2D6FA 2VF2A 1L5OA 2ALJA 3AKZA 4AJ1A 4R2LA 1GJRA 3DLBA 1A9PA 3ASYA 1SY7A 2VK4A 3MRTA 4N5MA 4BLUA 5BNZA 1ZR2A 3P5BA 4TT3D 5K2OA 4R6XA 3KZ1E 1SMKA 4OB7A 4P92A 4UAGA 3V7YA 3JQ7A 3FCXA 3LHIA 4TQ9A 4LWOA 1N2ZA 5FWYB 5DHFA 2H4ZA 2DSNA 4HDSB 3BXGA 4MRSA 4QTXA 3GCDA 1E89A 5EIBD 3EQ6A 4GNRA 3B6IA 4LYHA 1VSTA 2ORED 1VMAA 3BQ9A 1L4LA 4OA8A 1EGVB 1TW2A 3PNYA 4DT1A 1KU6A 1YFLA 2AXNA 2WAYA 3HWSA 4BECA 3NIFB 1CQWA 1HSZA 4UBNA 2GZRA 3RYTC 2PJUA 3H1AA 4J2OA 1CSEE 2CHEA 1JJVA 4N5IX 4MGHA 5EN4A 3ZYCA 1W88B 4AZTA 4NMLA 2WYUA 3AR9A 3M9XA 4J6EA 2NU8B 1USUA 4IWYA 2DUMA 3CS3A 2HW8A 1GZ7A 5C4MA 1EZ4A 2ZRBA 4LQLA 3RVBA 2PGDA 4Y6RA 1IY9A 5ESXA 4ZJZA 1S8NA 1A9SA 2PCLA 3AUXA 5JANA 3GP5A 1GVNB 2D5IA 2WLTA 3NETA 3H9QA 3PNKA 4Z54A 1H2YA 1TIBA 1PR2A 1OVGA 1EE2A 3F67A 3K8ZA 5ER9A 4LFAB 1NF3A 1JDVA 2D13A 2PBFA 4AI6A 5TMDA 3RSQA 1LFDB 2EFYA 5ALXA 4E21A 1H69A 4HGQA 3QITA 3O7WA 1RJEA 3S0JA 3UGKA 1CUUA 4GI1A 2VJDA 4MS3A 3N05A 5IBRA 2ID7A 3BWEA 3QMWA 4QSHA 3WIVA 4B83A 2YJNA 2Y76A 3NC1C 1PBTA 4OG2A 4YRIA 3LLUA 3H2JA 1V71A 2ZETA 3OLXA 4FCCA 4FCVA 5EHXA 5LNK1 3FZYA 3TZBA 3ZOKA 1BCRB 2E21A 3DKPA 5LYYA 2P5TB 3DEZA 1CZOA 4LY0A 4PZDA 1HE5A 1ZMOA 2A7QA 2FLVA 2ZVQX 4LWQA 3OCCA 4XSVA 4DLYA 5IEJA 5KPDA 5KKAA 2VCYA 4X66B 1GPMA 2QP3A 2VTKA 2RGCA 3DR5A 3O8OB 4XLZA 4KSCA 3FN4A 4TUYF 3N87A 3IKLA 3RSGA 5C8YB 2Y1OA 3CEJA 3DV2A 3MS4A 3OT4A 1U3WA 4P80A 2WT4A 1NXSA 5JARA 2FEXA 4K8RB 3ZU4A 4WOJA 3QXJA 2H9IA 2D74A 2GJ4A 5ENZA 4TTAA 1WUIS 1NNUA 3T5CA 1QORA 2FOLA 2EJBA 3E1SA 3Q0TA 4CG1A 5A9SA 5KZMB 3JQAB 3LUCA 3A28A 1KVTA 2PX0A 4PYOA 2ZUVA 3QX8A 1J0EA 2P77A 3UWOA 5DYIA 2P2ZA 2Q27A 4DR3B 1P2GA 2QYOA 5GJVC 1V9CA 5E4FA 2WJHA 2GJ9A 3IP9A 3C5CA 2I6SA 5L3ZA 3IP1A 1H9BA 1XZHA 2FDXA 2ECPA 3MUOA 3R09A 4R41A 4E33A 3G02A 5H9WA 3GLGB 2C78A 5SYMA 3K0FA 5BT8A 2VQ6A 1BEUB 4RL6A 1L5MA 1U2DA 3BXZA 3OUZA 3PGA1 1FFCA 5AKJA 1L7RA 3TFWA 4GVXA 4BNYA 1DAIA 4EI8A 1WHSA 1OB5A 4RESA 1EIZA 5ALPA 1G5RA 1T9BA 4QEZA 3RROA 1FEZA 3DT6A 4RPIA 2C54A 3BGIA 4LRWA 3NM5A 5TQ2B 1WCYA 3L4EA 4KLRA 3RARA 4P7KA 4PPNA 5CFQA 3E48A 3H2YA 4DBLC 5JH7A 5FUBA 2CLIB 4XGQA 4KPYA 1Y3CE 3SQMA 5JT1A 5E38A 3ZDRA 2O7VA 2GM9A 2DZDA 4FINA 4GOJA 1YL5A 3FKSA 4ND6A 2WIJA 4O59O 4U2CA 2JZOA 2VNSA 4J2HA 4DLLA 4TL8A 5BN3A 1NUUA 2I1QA 3N0WA 4R83A 1OYVA 2A1UA 2KYRA 3ND8A 3OZTA 3HB7A 4BP1A 4Z7NB 4BNTA 5LFAA 3KL4A 1JQLB 4YONB 1ZL2A 2O3QA 3U3JA 1WJGA 5BN5A 2D2FA 5MDHA 1FFXB 1UP4A 3ESDA 3KQOA 1KTVA 4YYEA 3FW1A 1AB5A 3PFGA 2Y05A 4I9GA 3SQXA 3VNVA 4TT3A 3K73O 5CT5A 2OPBA 3I30X 1YS7A 1WTAA 4RV9A 5CCXA 1B76A 1A5BB 2P0AA 4Q3NA 2J0QA 2J3MA 1K75A 4R40A 1M6YA 4D3XA 1KI1A 3W1VA 2XIJA 4CT4B 2W83A 1P5HA 3VHRA 3IJRA 2QYHA 3KXLA 3B6KA 3OTQA 1E9BA 4B3HA 5DNWA 1V1MB 5BWCA 4JBLA 3D0OA 3TTUA 4O02B 1V5IA 5DI3A 1ZKDA 5E9AA 1T4DA 3P9XA 1CEXA 1L1RA 5EJEA 4PYIA 3SHOA 4BEBA 5FUYA 1JHZA 3TD6A 3EA5A 4I50A 5BWMA 3O84A 3JQFC 3DDOA 2P4SA 1ATIA 2ZBVA 3OQ1A 4WLFA 1GXSA 4WXHA 1Q57A 4HSGA 2IW3A 2LP4Y 2JFUA 2QQFA 2R2GA 3JQ8B 4HH4A 2DFTA 1PFUA 4TPKA 3SC4A 1UQRA 4TLDA 1W87A 1P45A 2IA5A 2J5RA 2IGBA 4L5IA 4D9MA 3GFVA 5T7BA 2AMJA 1A8IA 2WU1A 3QFSA 2QSUA 4H18A 4J1QA 2HNAA 5H3LA 3AWDA 3U31A 4Q7LA 2PUTA 3TKAA 1AKQA 2VZLA 3TL3A 2D7DA 4JI1B 4K46A 1DAHA 1E3DA 3LUHA 1X8LA 2XWBF 3F5MA 3P0EA 4WNYA 3B1XA 4D8XA 1FSFA 2VPYA 1VI5A 2V7QA 5JFOA 4PX2A 3ZE0B 2NYUA 2QPOA 1WMEA 4UFPA 1UDXA 2V96A 3O91A 3QW4B 3DMYA 3QU2A 4NS4A 5E6UA 1Z39A 5IYZF 3A1VA 4PC6A 3G8BA 4P1ZA 1E1KA 5JADA 4BVFA 3OA2A 3V5NA 5K0ZA 5KEIA 2ENWA 5DX1A 4TROA 1XNGA 2R8YA 4OXQA 2YICA 2B92A 3PQ8A 4HLQB 1AGYA 1SXJC 3MRVA 5JAIA 4R9RA 1SBHA 2GWRA 4P4LA 4EGQA 1Z7EA 3VJKA 5TR9A 5U4XA 5HGXA 3LKZA 3D3WA 3V8VA 3N39C 3T41A 4Q9NA 1P4RA 1R6UA 1Z2CA 3GLHA 1W6UA 5EJ7A 4UUNA 1G38A 2L82A 4URZR 1XNRB 2YFYA 1T2CA 4GKJB 5HF5A 1CUFA 1KXJA 3SHTA 4EPWA 2IYYA 3K72B 4N01A 1Z63A 1OLUA 1RXVA 1N6IA 3Q9LA 5DGCA 4NIMA 3OURA 3PQ4A 2GM5A 3C8HA 1NVKA 3W2HA 4AWBA 2M6LA 4DZRA 3CQ9A 1V3UA 5AVUA 3WDKA 2GBPA 1KPIA 4JJKA 4NAHA 1FSZA 2AZ4A 4WOBA 3RFCA 3PKZA 4Z9AA 1JKIA 1XSEA 4FZ3A 4WZBA 3U3RA 4ZEWA 1CULC 2IU3A 5BQXA 2F2TA 1S96A 4U9UA 1SUAA 4HWKA 2PIDA 4II2A 1BD3A 3O73A 2E4WA 3CLKA 5EEHA 1OFTA 4CF4A 1NJ1A 3LWZA 2IS4A 3EG9A 4X62B 4FOSA 1JWAB 3CO0S 2XMPA 2FGJA 2NOAA 1HQKA 2O8NA 4PBRA 1M2NA 4A1FA 1I80A 5F3DA 4F97A 4CHTA 1IZZA 1SWWA 2A9VA 4ZQIA 1RWNA 1AQIA 1QQAA 3HN6A 2XWQA 2R1ZA 4V03A 3T0GA 3L7IA 3EDYA 2NUPA 2Z6QA 1DBWA 3WHKA 3RJ5A 3ZX4A 3G8CA 5JSUA 1NBHA 2QW1A 2WIKA 3UBMA 1WXQA 2IYAA 4Q48A 3IPAA 3GRYA 5DEIA 2QIPA 5EE0A 2PT5A 4N82A 3RFXA 4JJEA 3SQNA 1KXZA 4AO7A 4ZTZB 1OXKB 1MQ9A 5FXMA 4G2TA 3AQ4A 2DFKB 2Y67A 1R6VA 2UZ1B 3A7EA 5JFTA 3I1IA 3W5BA 3ZBUA 1NXWA 1JIJA 3PNOA 1XTZA 2JAUA 2HEIA 2C4NA 1NYQA 4JD5A 1DIHA 4QODA 4AWXA 4DC9A 4UD2A 1CJBA 4DG8A 3U44A 2VS1A 4DDTA 2J3KA 4FQ7A 1Y4UA 2IS1A 1M7HA 1KZYC 3ODPA 5C4IA 2IUFA 2ZAOA 2FR1A 4IDOA 3Q7TA 4EGFA 4PZCA 1Y5NA 2EL9A 1IHPA 2UZ3A 2YINC 3TBFA 3BUSA 3X43A 4N6GA 5E9JA 1H94A 4XCQA 4K03A 1N1MA 1TKAA 2YIVX 1JFVA 1NLUA 2UKDA 1R18A 1IK4A 4Q4JA 2ZYDA 4FN4A 2RJOA 4JUCA 1TB4A 1XN1A 4R8LA 4UHHA 4G4SO 3ESZA 4WHMA 5AVTA 1R0BA 2NXCA 1B74A 5I8ZA 3HSYA 2XYVA 5GPBA 1P31A 3KU4A 1QHFA 1LX7A 2J33A 3L4BA 4OHOA 4OU4A 4DDMA 4KQKA 4ZAYA 1J49A 1SZPA 4Y3UA 5F64A 2PLWA 3FOBA 2B1JA 2GN1A 4IJUA 3S8YA 2VJMB 4YJ2A 1PR1A 3LBHA 4Q3LA 1SN7A 4DR7B 1D5CA 5EHGA 2W6QA 4H0NA 3MWGA 1KDRA 3EVCA 3THYB 1H0KA 2QXTA 3E82A 4ENVA 4TWIA 4NQZA 5JALA 1AUOA 1POXA 1GAEO 1ZD5A 2GCOA 2ZSJA 2XT6A 3DE5X 3FUWA 1QS0B 5ALMA 1GGJA 1ZI9A 5K8VA 2AWOA 1NRIA 3QLJA 2NV2B 1EJ2A 1H3NA 1UXIA 1YR6A 2VI5A 3VR4A 4CKWB 5IBPA 4DEVA 1B93A 2W11A 4RH3A 4JXKA 1CE8A 1XEWX 4XE5A 3DCIA 3PPIA 3RSFA 3A3YA 1L7QA 5HOEA 1G63A 1YRYE 1RQ2A 2HRCA 3FH0A 1ECLA 5CW1A 1D03A 1I3CA 2NTVA 1FP7A 3KLOA 2V3WA 3L4SO 4HNVA 3SWWA 1FE8A 1GPH1 1NV8A 3WL4A 3ZXXA 1CR6A 1U3TA 3IMGA 4QZVA 1GZHB 3V7WA 1MXFA 3UMVA 3TR5A 4RXTA 5HZHA 1WKVA 2DUWA 4AIRA 3AJRA 2DR3A 2V5AA 3C3PA 3OWOA 4UE2A 5DN9A 4RV5A 3GAAA 2RGXA 4Q4AA 2PLFA 3ME5A 1KAMA 3PPXA 1YNSA 2DPMA 3SVTA 1AURA 2XYGA 2YWHA 5A2QA 1DJOA 2XWPA 4EY5A 2GXUA 4JAVC 5B58C 4TSKA 3AIOA 4S3MA 3R3HA 1RRKA 5H80A 5MFZA 5HS6A 3TTTA 5I9TA 2LRHA 3GVHA 3QQPA 3R0IA 3R77A 2EL7A 2PHZA 3FFXA 3MJDA 3RC8A 3ZQ4A 3EEOA 3LRTA 1BX1A 5ITVA 1KBQA 1E2IA 2C59A 2Q4RA 3RRYA 3GGOA 1R0SA 4MKXA 2EX0A 3P4YA 3M2TA 2JPDA 4C30A 4EUNA 1U6KA 4HNSA 1MENA 5LZ2A 3RYFA 1G41A 2F3SA 4YRFA 5EZQA 3FCAA 2FX3A 1JWBB 4L4ZA 4M0UA 4RD4A 1AE1A 4DMMA 5KNBA 4AO6A 2RH5A 3BIJA 4ZVQA 1USWA 1G3QA 1B2LA 3RTDA 1JAZA 1O3YA 4E5MA 5G40A 3ZNQA 5ESDA 1MQ8B 1WD5A 1AK1A 1II8B 2HBQA 1TC1A 3CINA 4B3DA 4BLQA 1VC2A 2WF6A 3E3LA 3GEHA 4MX8A 5M34A 2DCMA 4UUQA 3PNMA 4INZA 5EWJA 2N0SA 2H1CA 3NB0A 2VCEA 4JB3A 4M9CA 2H4HA 4LZZA 4ZCLA 1MMFB 3L7DA 1SU7A 3ESYA 2VVTA 4HOYA 3ZJ4A 3NHWA 1Z6QA 4UDOA 5AKXA 1ESEA 3DLCA 2H31A 4OYLA 1YBHA 1TL7C 4BAGA 2AG8A 1G2IA 5AMXA 3TWOA 3FNRA 3KFXA 5DYTA 1C3OB 1YGYA 1HA3A 3FNQA 4PQGA 2II6A 4M0FA 2BEJA 1NA5A 2I7CA 1D2AA 4BGVA 1H8HA 4WL0A 1FJHA 1Z22A 2MDTA 2C5AA 1MTZA 2IYZA 4ALKA 1JIQA 2H5LA 3LQRA 1D2MA 4MPJA 2C4WA 2PTGA 3DOJA 4CUKA 1FYFA 3F2IA 3KHSA 4U7TB 4LHVA 4O25A 4JITA 2BBWA 2WSLA 1Q0LA 4K9RA 2ZKIA 3NYIA 3COYA 4C05A 4TKLA 3DR3A 3NDRA 4QOSA 4Q3KA 4YAWA 5LM3A 1LBSA 2J1LA 4M8LA 1XAHA 3STHA 3OE5A 3WGIA 2JFFA 3GZNB 1B0UA 4BUZA 3IV9A 1OFUX 3T7KA 2IELA 4RY8A 2H4YA 1GG5A 3PB3A 2LD4A 2VTEA 5FEMA 3I2HA 2HT1A 4BO3A 1KC1A 4H1TA 2BR5A 4C4ZA 2ZSDA 1VA4A 1VPTA 1DTWA 3ZX5A 3GGCA 4QDXA 3WGTA 2CY0A 1DHTA 1SNYA 3I4FA 1DEKA 1PZNA 2H2HA 3RIXA 1Z28A 5FOWA 1RYFA 4RS4A 2QGFA 4QQRA 1CXZA 3HI6A 3KT8A 5DGDA 2G1PA 3VR6A 2YWDA 2C9OA 2RB4A 3SM9A 3KVYA 2JJQA 2OFOA 2KX7A 3RQSA 2ECOA 1UMDB 4PVDA 2W8BA 3QSYA 1CV2A 2WHQA 2AJDA 4I8XA 4YV2A 4ZT2A 4KI7A 4TWZA 3ZHZA 5A03A 1C9DB 1J21A 2BHLA 1JFFA 2N75A 2BI8A 2DPLA 2QN6A 1GUYA 1V43A 4GC5A 4MLCA 4PO8A 4R69A 2MTBA 3WKCA 2QEQA 4KO8A 4O4JA 1CFJA 2JGMA 3G5TA 2R96A 5DBOA 3Q6MA 4MQLA 2B2XA 1VMIA 2D1SA 5AKIA 4IEFB 5ELMA 1X14A 5K0FA 2JHAA 4EPYA 4AN4A 4L9AA 2RKOA 4QGSA 3KD3A 5FOSA 2P4UA 4PYQA 1ZL0A 1F4LA 2WJ6A 1HOXA 1D9ZA 1R1DA 1X7ZA 3S5UA 2H52A 1NF9A 3QF7A 5E2AA 4EKEA 5HJ5A 2E6KA 4OHWA 3DL4A 3WLSA 3N8HA 2DWQA 3CMCO 1ONSA 1XVAA 4F9FA 5HX7A 3D8SA 2GEKA 2B5OA 4GPD1 2LDBA 3C6KA 3JD3A 4CEIB 2FPIA 1SQ6A 4E1VA 4O3FA 3UIEA 1Q0UA 2GN2A 2TYSB 2YZKA 2OGZA 3GRUA 2ACVA 4E94A 2C5FA 3T3HA 2D2VA 4A8HA 1PFWA 3RJZA 2AJCA 5BW4A 7REQA 4DLBA 4O63O 3VSAA 3IBTA 3I5XA 5BORA 1XLTA 4FFPA 5C1IA 4XJVA 1KJNA 5BWNA 2QSJA 2P2SA 2ZE6A 3D43A 3VU8A 3G0IA 4LF9B 2HD4A 1G8FA 5SYNA 3SJCA 2PL5A 3QRWA 2O1WA 1P1JA 4BAZA 3PHIA 1ESCA 4G5SA 5PGMA 2DHRA 3GJ5A 3WSTA 1FQWA 4C3ZA 2JEOA 3X1XA 2VNHA 2QDXA 2WJGA 2FWIA 3CX4A 4OL0A 5B5SA 4B5LA 3VAAA 3DM9B 5I9BA 1C1XB 4QQKA 1JEJA 1RWPA 3FY4A 4LF6B 3AI2A 2P91A 2X0EA 1WPRA 4RK7A 1TAHA 1GYQA 4OAQA 5AKZA 3HU1A 5DLPA