4F9PA

Crystal structure of the human btn3a1 ectodomain in complex with the 103.2 single chain antibody
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
213
structure length
207
Chain Sequence
QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMGVSCTIRSSLLGLEKTASISIADPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Butyrophilin subfamily 3 member A1
publication title The molecular basis for modulation of human V(gamma)9V(delta)2 T cell responses by CD277/Butyrophilin-3 (BTN3A)-specific antibodies
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 26
structure length 207
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f9pA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4f9pA02
1A9EA 3BP6A 4DN3L 3UTTB 1QFWL 4JM4L 3WKML 1RZJH 4BK5A 3WJJC 1LE9A 5L2JA 5I2IB 4S1RH 4PRPE 4PJCF 3W0WD 2V5MA 4PY8I 3KWWA 1U8OA 1V3LA 1V5JA 3SGDH 1ZMYA 1RJLB 5IBUG 1DBBL 3QO0A 1L0QA 3DVIA 5EWIL 4LIQL 1CGXA 3ULVH 1IGJB 1GC1L 3IFLL 3QPXH 1QRNE 4L3EA 1CR9L 2I9LB 1WCQA 1NH6A 4NKIL 2NPLX 1B4JH 4NCDA 3G5ZB 4KVNH 2B0SH 4R7DB 4YBQC 3AREA 1HYSD 4R2GC 1I7RB 3QEHA 4JQXC 2QKIA 5H37H 3DVNA 4X99B 2ESVB 1FG2B 5F96L 4UU9A 3GSQA 4RMWA 1K6QL 4ZUTA 1R5IB 1HSAA 4DZBB 3OB0K 1QFWI 4MVBD 1IGTB 3TJHC 1DBML 5GGVL 5F1NA 3DJ9A 4ONGH 1NGZA 4JRXB 2CGRL 1JPSH 3HE7D 3LMJL 5HGAA 4OUUB 3SEPA 1PX4A 5EPMB 1TNMA 3OF6A 5KVDL 1CVRA 4LK4A 4QRUA 3RQ3A 3QJHB 1LD9B 4HLJA 1S5IL 2FECL 3TWCH 4N0UE 1TPXB 3L3OB 2JIXD 3BPLC 5GIRA 3SJVA 4EKXA 5A2KH 4ZQKB 1R5WB 4R2GB 5KG9B 3MYJB 5E2UL 1C08B 4MJ5A 1JRHH 2R0KL 4JRYE 4TUOA 3MROB 5IG7A 3A6CH 4LDLB 5EOCJ 5AZEL 2NY6B 1WITA 3VWJC 5A43C 4OGXL 3ARRA 4PJDE 1RI8A 2EDEA 3IDXH 5JHDE 2GT9B 4DEPC 2FJHB 4CDGC 4KAQL 1P53A 1J1OL 5HHPA 3TO4B 4JFFD 2YPVL 3VXSB 3O3EA 3NCCB 5CEXA 2VXVH 1RJZA 2GJ6B 3BT2H 2YHGA 5F7EH 3BPLB 2YEZB 1MIML 2ADJA 2YUXA 3NFSL 2FECI 4WV1A 3VXNA 4PJCB 1ACZA 3EHBD 3GI9L 1YN7A 3PHOB 3T4AA 5GRJH 3UZVB 1QFPA 3JUZA 3H9HA 2X42A 3PNWA 4CMMA 3T0DA 3K2MC 3PWUB 5B4MD 4LVOC 1XFPA 4DEPB 3PWVB 1HILA 1HI6A 2D7OA 5I19L 2WBJC 3DMMA 3OKMA 4Z9KB 1UM4H 1TZGH 5GSRA 3WCYA 4TULL 2Z91B 3D2UA 2ZPKH 1JZ7A 3KLDA 4L4TE 1VFAA 5JW4Q 4LAQH 1CE6B 4M48H 5INCA 2PTUA 4LSQH 2BRQA 3MA9H 4GAGL 4P5MA 2QADC 4WFHE 3VA6A 5DA4A 1FIGL 1MFDL 1VGEL 5TQ2H 1RJYA 4AMKL 2X4NB 3UEZA 1MCOH 3FFCA 4MQSB 4ELME 3T4YB 5FGRA 4TYUA 3PJSB 3EOTL 3SJVD 1RUQL 4LVOB 2Y5EA 4F57L 2PTTA 5FYJL 1EIBA 2ED7A 3X3GL 3KNBB 4Y4FA 3P2TA 3UMTA 2WBJB 4OZHA 3KJ4C 1OAZH 4ZS6D 1NUGA 4X6FA 5C0CA 4X7TB 1E6JH 1RFDL 2A73B 4Q6YA 4K7PL 2QADB 5GGSY 4J1UB 2HH0L 4EN3C 5B21A 4PJAE 3EFFA 2DD8L 3VW3L 1T0PB 4U1LA 3O4OC 5ESAA 4QYOB 3SGJC 3VG0H 1SY6A 4G8FB 1QLEH 3O2DL 5IEHB 3D25A 2KUTA 4ZFGH 3AS0A 4GW1B 2H41A 1ED3A 4ZNCD 4EIGB 3J7HA 1NAML 1QFUL 3INUH 5CIPB 4ELKA 1YC7A 3WIFA 1OGTA 4NBZB 2J1KA 4HH9A 4X98A 4FXKA 1D5IH 1GAFL 4IMKC 3ARDC 2R1WA 3ES6B 3KJ4B 4WY7L 5ICZB 2CXGA 3QXDB 1BGXH 1K9TA 5H37G 1FJ1A 1FAKT 4XI5C 2VLKD 4DGIH 5C0ND 5DK3A 4EN3B 1HKFA 2AW2A 5DEGB 3PGDB 5HHNB 4U3XA 1RD6A 5IVXE 3O4OB 4GSDL 1RZKL 2OS7A 3MV11 3LOWA 4HJGB 4M00A 3M8OL 4M6ML 3SKJH 3T0EB 1MFBL 5F9OL 2YD2A 3IDIA 4JM2D 3VXRA 5BS0B 5T1MA 4YFDB 1J8HA 4UNVA 4KQ3L 3IDMB 4PJIF 4NKQB 3O2WH 1ES0A 4PLNC 5IBTL 3NABL 5MERA 2O5ZL 1NCDH 4P2YA 5DC9B 4NSKA 3ULSA 1EJOH 3CFCH 3IU3B 2I5YH 4Q9QH 3VU2A 5JTWA 1V05A 4N8CH 1MWAL 2CK2A 3MXWH 1JWMA 3OKNA 3K8KA 5I18L 3KLAB 4GRMA 4MB3A 1C7SA 1UWEL 2NNAB 4U7KA 3CVHA 4AZ8A 1TVBA 2DQJL 3AGVA 4NC1C 3P77A 3G04A 4G80A 5CP7B 4KPHL 3LKPA 4KK8C 3GSWA 5B8CA 2HTKC 4QRTB 4ELMF 5EU5B 1C1EL 1IEAB 4R4ND 5FDYA 4PJBE 3C87A 4X83A 2DOCA 3I75A 4F80A 4BKLB 3P30L 3ULUL 1NDMB 2JELL 1HXMA 5DHVH 1K4DA 5L2KE 3PGCB 5CIPH 3K80A 3OAUL 2HP4A 5EO9A 1P4IL 2YA2A 4I5BA 4YQXH 4ZFOL 4XNYL 4O51A 1BEYL 1QA9B 4H26A 2AXHA 3I3DA 3IJYA 1HOCB 2BMKA 4HKXA 1P9MA 1IGMH 1OAQH 5DURB 3DIFA 3MOBL 2YKLH 2D31A 3FO0H 1WZKA 4MSWB 3MA7B 1I8MA 1WVZA 5CSZA 1YC8A 1KCSH 5F7KC 4R90L 5M94B 1MY5A 4KHXH 3RKPA 4CADB 5TFSL 1ZK9A 3PP4H 4GW4B 4PGDA 2R1YB 1XF2A 2D0HA 3MRQB 1KT2B 2J88L 5DEFB 4HMCA 3S7GA 3MLVH 5FUZL 3GUTB 3SKNA 1ROWA 2GCYB 1BBJB 1MFEL 4BQ8A 4ZUVA 4IBLT 1MLCB 1TTGA 1FZJA 3FMGH 5DT1L 2NY0C 1IAIM 5HHOB 5L8KB 4NN6C 2C9AA 3TNMA 4NO5B 3M1BA 4P2QA 5MEPA 5A3ID 2VDKL 4PJIB 1LEGA 2GTZA 1QSVA 5IVXF 1T2XA 3QFJA 3JV0A 4LLUA 4OQ1A 4FFYH 2HT3D 1DSFL 3MRPB 4O9HH 4M6AA 1U3HA 4CRPA 1LP9A 1CT8B 1CLYL 2XXCB 2NY1B 4A2LA 3F7VB 2VDQH 4ODVH 3IF1A 1AO7B 2Z4QA 3SKMA 4LF3B 1MAKA 4M43L 4E42B 5JPNA 1CE1L 2OK0L 1MUJA 4JO2H 3CK0L 3REVB 2NY0B 2RQ8A 2EXYC 4NN6B 4G6KH 4K3EL 4NYLA 3FCTB 1MRDH 3P4NA 4BUGA 3FKUS 4JG0H 3MV7E 4M6NL 2E6QA 1H3XA 5FDWB 5DVMA 5KSBE 3AU1A 4PG2A 2A6KA 4RFNC 4KKLC 2PYEA 3FB5B 2QQNH 4NO2B 3LAFA 4LNRA 5DR5H 5F7DA 4M6OH 2ZUVA 3MRFB 1TETH 3CH8A 2YSSA 2CO6B 3MRCA 5IOPA 1IVLA 4H5SB 2GI7A 1YEJL 3QEQE 5T1LB 5CCKH 2VAAB 1CGTA 4HIIB 1FO0B 2NY4C 3ILQC 4U1KA 2W9EL 4CNIB 3HRPA 4POZC 4OD1H 3MNZB 1GZPA 1UA6L 5E00B 1C7TA 3LKQA 3ZLQC 5JXEC 5B3JE 1G1CA 4HEME 3P0VL 3LKSB 4KTEH 5I2IA 4RFNB 2DQTL 2X4OA 1S9YB 3SDXF 1HKLH 2ED8A 5GJSH 5IK3B 2AJVL 3TT3H 3K8MA 1X5YA 2DDQH 5E08L 1JZ2A 3QDAA 3PHQB 2NY4B 3FONB 5GGRY 2I9LA 3AMKA 1KN4L 3VGBA 2C4XA 2HTLD 1PW3A 4JB9L 2Q86A 3RPIB 3ELAT 3G5ZA 1HWGB 3TEUA 1A2YB 1R0AL 2H6PB 2BSED 2V7NB 1IAIH 3GRWH 2QHRH 3QDGD 2GSIB 3NMEA 3O9WC 3BFOA 4JAMB 4ACPA 3WJJA 1I7TB 4QRPE 1OPGH 4ODXB 1S7XB 4X99A 5HI3D 1TNNA 1YUHB 4DGYL 2C3VA 4URTB 1R5IA 1BJMA 2N56A 5EU4A 4DZBA 1DQJB 1IGTA 4BH8A 2X1OA 1G7JB 2OMNA 4F58H 3O6MH 3MACH 3L3IB 3BP5B 3BXNB 2XICA 4OUUA 4ZDHB 3WFHB 3RVTC 4KRPC 5J9PB 1VFMA 1BIIA 2IQ9H 5BZWA 3VFPB 1QUNA 1ZHLB 3HG1B 3VGAB 5EC2B 1M4KA 4ZQKA 1R5WA 5KG9A 2W60A 3MYJA 7FABL 3O9WB 3TZVD 3IDJA 4NQCD 1RK0B 3PABA 1FO0H 3ROOA 1T0NB 43C9A 5J8OA 4MQXD 4UQ3A 2LAAA 3VFGH 1TZIB 2Q87A 3VFMB 4LLQB 2JJTA 2RR3A 5KSBF 5C0AB 3KHQA 1L9MA 5EOQH 2OXHA 2P5WD 4KRPB 3UTTD 3C2AL 2VXQH 5BVPH 4X80L 2HT4D 3FB8A 5D7LB 1R3HB 1IJ9A 4JDVB 3TO4A 1BFSA 1CLZH 3VXSA 2GJ6A 2V9QA 5EO1B 5C09E 4H25B 4HF5L 1FL3A 1FCGA 1RU9H 5IJKC 1P7QA 3SDXB 1F97A 1KYOK 2P8LB 5DF0A 3KYAA 2HVJA 1FL6B 1NUNB 2GTWB 3VD3A 2XTLA 5HJ3B 1R3LB 3C8HA 3O6FA 4PRHA 2DQDH 2BNQD 2R69L 4UBDC 2LV4A 1Q8MA 4G9FE 4Q0XH 4YGVA 2C3XA 1T2QL 5B3JF 4U1SB 2BHZA 4NFCA 4JFHD 5DD0H 5A40E 4MGXA 3EBAA 2E27L 4UT6L 5D5MF 1Y0LA 5CEYB 2WSKA 2AXFA 3D85B 2ESVD 5GRVK 2EH8L 5CJOH 3T2PA 4YBLC 4KGJA 2Z91A 3MLZL 5IGXH 4JDTL 1I8LC 4I2XE 4WO4B 4JRXD 3T09A 4U2YA 3H8NA 2WQRA 4U2ZA 5EORL 2UUDK 1SMAA 3DSFH 2AK1L 4WTXA 2X2YA 5T33L 2XI9A 2VR4A 2X4NA 4HWNA 1LO0H 2H1PH 3T4YA 4OZIA 2YWZA 4HPYH 1H3PL 4YBQD 4RZCA 4FABL 5F7LB 2OX5A 4R2GD 4DKEL 3HMXL 1E4JA 1IC5H 3KNBA 4MXVE 1T7ZA 1RUPL 1NPUA 4JPVH 3HB3D 1DQLH 2MOVA 3MNVB 3HUJA 4YBLB 1FGNL 4Z7UF 5DUPH 3VFTB 2I26N 3TJHD 4X7TA 3R0MA 1X4YA 4HIHB 3WFDL 5KSVB 1GGCH 4JGMA 2A73A 2NY7H 4U1JA 1BF8A 1WBYA 2KZ1B 2YD5A 3QISA 4MA8H 4J1UA 2DI9A 2YD8A 4UTBL 3U4EB 5IB1A 1G6RB 4QYOA 4NO3B 1ZHNB 4NIKB 5IEHA 3EYUH 1A6TB 2ICWI 2EDTA 4PJEE 3UP1A 1JMZA 4D0BB 2CIKB 4F7MB 3NFPB 4L8SC 3UPCA 2VQ1B 1N0XL 3BH8A 15C8L 2MQCA 4OFIA 4M5YL 1KELH 5LBSH 2VDLL 3ES6A 5ICZA 3QXDA 3VWJD 1DFBH 5JOFB 4YPGB 5IMLB 1WEJL 1PSKL 2P24B 4WFED 3MZGB 1YEEL 4NFBA 4GFTB 2QQQA 4XXDA 1T7YA 4JQIL 3GK8H 4YHYC 5GXBB 3RJQB 1QFWM 1IT9L 1AP2B 4X9IA 3T0EA 3T77B 4LCIL 5D5MB 5I1KH 3QG7L 3ZDXF 3D3VE 3GDBA 5MENB 3MOAH 3IDMA 4L8SB 4ZO7A 2MPAL 1XGTB 2VSCA 4NGHL 2ZKHL 1QKZL 4Z5RB 4C56E 35C8L 2A77L 3CLFL 3BE1H 4XPFH 1MAJA 1W8OA 1MCNA 4HSQA 1C5BH 4Y5YC 2ICEB 3X11B 1T83C 3V4VL 4LHUB 4MAUL 2PW2A 5EUOF 5IFHH 2W92A 3ZYOA 5F93C 3DX8A 1BVKB 4YDVB 1AY1H 3FTGB 4YHYB 3U9UA 3JV6B 2WBJD 4O2CA 4GQ9H 5C0BE 1MHEB 2BNUB 2EH7L 2E8YA 5IFJB 4L8CB 2CKNA 3MBEC 1RUKL 2XQYK 2ATPB 3VXMA 2FH6A 2P45B 4PJHA 2NCMA 3UTSE 4Z7UB 4UMGA 3W2DH 3TM6A 4YHIB 3RX5A 1ZA3B 4NQDA 3GBNH 4J4PA 5FCUH 3IGAB 1AGCB 2JCCE 4XTRD 5L9DH 4BKLA 2ARWA 4Z7VB 4HFUH 2E5EA 1T5XA 3VGGA 4PIRF 1Q9WB 3TFKD 1VPOH 1JYNA 4GAYB 1A7PL 1PG7L 4RMRA 3MBEB 3QDME 2XN9B 1OGAB 4V1DE 4YDKL 4EN3D 2XZAL 2ORBH 1WFTA 4CADA 4U49A 1GHFH 4Z7WA 5TPWL 3MRQA 1KT2A 4HK0B 5HY9B 1XR8B 1SJHB 1ORSA 3C2SA 2ZZUT 5BS0D 1MLCA 5CINL 2Z92B 3D0LB 3KYMB 5HHOA 3RZCC 5K59E 1A21A 1UH4A 1EFXD 2P8PA 3ARDD 1QRND 4XMLL 4GLRI 2G60H 1BOGB 5ESVB 2VQUA 1KCRL 5FGBC 4DN3H 3MRKA 3KLSA 4LQFL 4XI5D 4HCRL 1QFWH 4JM4H 3GHBL 4O4YL 3WKMH 4UILL 3MRPA 3WEXB 1P2CB 4O5LL 5ALCL 3RX7A 5E7FA 5EN2A 1WC7B 2ATKB 5EU6E 3WNPA 4N5UA 2A74B 5T3ZL 1AO7A 5EUOB 3TH4T 3QIWD 5KTEL 1FSKB 4E42A 1DBBH 1D3CA 1KNOB 3VWKB 2R4RL 5KVEL 1ZHKA 5SWSB 5EWIH 6CGTA 3BN3B 4LIQH 2UZYB 5MEQB 3IFLH 3REVA 3NCFB 3QG6A 4XNQB 1VEOA 2EIEA 3RZCB 3O0RL 3TPUB 1V3MA 3QIBA 4NKIH 1CK0L 3S5LB 3LEVL 3HPJA 5GRWA 3UYOD 5FDWA 3MZTA 5FYKE 4PTUA 4ZSOA 2BVYA 4CVUA 2KL6A 1Z0MA 1T03L 5F96H 4KI5C 2EDHA 1H5BC 3DHMA 3FB5A 4JRYD 4NO2A 3O3BA 1DBMH 4PJ9C 5DURD 5IF0B 3MRFA 2ZCKH 3TN0A 1OT2A 4HGWB 4UNTA 2YPLB 4H5SA 2CGRH 5I0ZA 3LMJH 4I18A 4UOW0 3QDJB 1RUAL 3MLSL 4HUVA 4PGJA 5KVDH 5ILTL 5C7XH 2F15A 1T21B 2JCCF 2VAAA 4KK8D 2O5XL 4HIIA 4PY8J 3VXUB 1HHGB 4CNIA 3FT4A 4NQUA 3TBVB 1S5IH 1IM3B 3GKZA 2K9UA 4CW1B 3BO8B 3IFOA 3PWPB 5E7BA 1FNGA 1IGIL 1CFSB 4G42A 2R0KH 2VXUL 4XGZB 5H35A 5ANME 5KW9L 1MF2L 3CFBB 5AZEH 1Z9LA 4OGXH 3WD5L 1LO4L 4PJ9B 3BZ4A 1EMTL 4GH7B 4OUOA 3SDCC 3SE4C 4G8IB 5E1HB 4M61B 1DZBA 4DCQB 3ULUF 4KAQH 4OF5A 1RHFA 1J1OH 1RZKC 2YPVH 1A7NL 1A2YA 4HZAA 1MIMH 3CVIL 1X5FA 3NFSH 1MCEA 2GSIA 1NAMB 1WIUA 1S7XA 3DRQA 2NX5B 1YUHA 3ARUA 2NY0D 1BQUA 1UM6L 2VLJA 4HIEB 4OZ4B 3IT8D 3OBAA 3L3IA 3BP5A 3BXNA 3SDCB 1JNNL 4ZDHA 1F02I 3E6HB 3WFHA 1HSBA 3C8KB 1A4KB 5I19H 4FQCH 3VFPA 4K8RD 1X5AA 5H2BB 1ZHLA 4TULH 2FHCA 3HG1A 2JJSC 5DZOA 5C70A 1WK0A 4CVXB 3O3DB 1WWWX 1CD1B 3WE6B 3OAZH 2R2EB 4HUUB 2SEBB 1RK0A 5T1LD 2DI8A 3V6OE 5L0QC 2EZ0C 1FIGH 4HS8L 1VGEH 1T0NA 1ZKAA 5FM8A 4AMKH 5BQ7B 4EEEA 2BDNL 3SGKC 1TZIA 3VFMA 4LLQA 3LH2H 1EBPA 3ULUC 2HFGL 3EOTH 4KQ4H 1RUQH 3MRBB 4UOW1 4F57H 1MWAB 5FYJH 2IANA 1W72L 4G8EA 1KXVC 4NP4L 4ETQB 2VLMD 1R3HA 4JZNA 4JDVA 1EO7A 3WO3B 1WT5C 2WQ8A 1ADQL 4IRSC 2X44D 4KKLD 3DHJA 4XCFL 5GGQL 2HG5B 4NUJB 2C5DC 3B4NA 1FVCB 4MQTB 4JVWA 1MFAH 3RNQB 1RFDH 2V9RA 2FEDC 3SDXA 3MLPA 4K7PH 1CD8A 4UDTB 2HH0H 1FL6A 2GTWA 2W0PA 3IU4H 1ORQA 5L0QB 2DD8H 3VW3H 4MJIE 3UTPE 3ILQD 4U6HB 3O2DH 4POZD 5HBBA 1H3UA 4R4FL 1S3KL 3TF7C 1EXUB 4Y4KC 2DMBA 1NC2D 4ORGB 3WS3B 1NAMH 2DKSA 3IFPB 5JXED 1HHKB 5CEYA 3MLWL 4FQXC 3BI9X 3PV6B 3WNMA 3UTQB 1BZ7A 4ZFOB 2R23B 1GAFH 4IRSB 4WY7H 5IBLD 1M7IB 5D7SL 5H8DA 1JZ8A 2BHUA 3DXAA 3MRHB 4R6UA 5D96C 3OXRB 4WO4A 1GVIA 1LNUB 1R3KB 4XMPL 2F19L 2NXYC 2O5YH 1G9EA 4HWBH 3QUMH 1ZLUH 1QRKA 1CIDA 3M8OH 2X4QB 4YX2L 1RHHA 1MFBH 5F9OH 1J5OL 3KPTA 3T2NL 4Y4KB 4LLYB 1FNLA 4KQ3H 3SBWA 3O9WD 1AQKL 3IJSB 4F37K 3EDDA 2VIRA 4OKDA 3NABH 1B0GA 3MNVA 2R0WL 5FO7A 3OKKB 4U6YB 2O5ZH 5HYJA 2Y6SD 4NFDA 4X7SL 4HIHA 4YHNB 4OCNC 5D96B 5C0AD 2ITCB 4BQCA 3OL2A 1MWAH 5CMAB 5D7IE 4G5ZL 4OCLC 3RVTD 4DK3A 2NXYB 3RWIB 4KRPD 5I18H 1G6RA 2OZ4A 5C6WH 4NO3A 1UWEH 5D7LD 1LDPL 1ZHNA 4XCCL 2BVTA 3BZFA 1YJDL 1A3RL 2DQJH 4D0BA 2CIKA 4F7MA 4KMTL 3CFEB 3NFPA 5A2IH 2VQ1A 4I9WD 1EGJL 1Z2KA 1JGUL 5FECB 3O4LB 3S36X 1C1EH 3TBTB 4FQQA 1K85A 2OTWB 2AXGB 2XWTB 5ITBH 3CX2A 3K3QA 3G6AA 3EJYC 3ULUH 1GOFA 3X12B 3CDYA 4XNMB 2JELH 1IL1B 4NNPL 1YY9C 4XCEA 4XCNB 4F9PC 1QVOB 5D2LE 4Y19E 2APVA 1MJJB 1N59A 3D85D 4PS4L 4AL8L 3KVQA 2RAMA 1AP2A 4LASL 2PYFA 3PQYE 1MNUL 2BVEA 3H9SB 4RMTA 4J23A 3H7BA 4Z18A 1MRCL 2V17L 4Z5RA 1RULL 3KPSB 4M1CC 3BUTA 3X11A 3HZYB 4LPCA 2VERN 4UBDD 3THML 2J88H 4LHUA 4XHJD 1KTRL 5KSAA 5FUZH 3RL2A 2FX9L 2AEWA 5TE4H 1AGDB 4WDIB 4UIMB 1IRAY 5D7KE 1BVKA 4XP9H 5DT1H 1A64A 3JV6A 1MCKA 3GM0A 1A1NB 4P9ML 2R1XB 4YHPB 2R2HA 1FVEB 5IFJA 1DQMH 1H8SA 1WFOA 3HR5A 2ATPA 3JWOL 5J3HC 4H0GA 1FNAA 1DSFH 2EDOA 3H2WA 3IGAA 1AGCA 4M9PA 4I13B 4U31A 2DQEH 4W6YB 1EH9A 4Z7VA 4M43H 3HNTH 3UDWA 1CE1H 2OK0H 3I6GB 2X10A 2IAMA 4NHCH 3GB7A 4PGCB 2VDRH 3QEQD 4GRLA 3TH3T 1WBZB 2ZG3A 1CGWA 1Z5LB 4JHWH 4K3EH 4NDMA 4GAYA 3FOLA 4UNUA 4HC1L 2VLLA 2AI0L 5HGBA 1OGAA 1QSFE 5F7UA 3OXSB 1EEZA 3MV9E 5F1SA 3RAJL 4HLZG 4R8WL 4M5ZL 2WLZA 5D2NC 4YAQA 3Q5OA 1SJHA 1S7VB 4Y5VC 4ZAKC 1NGPH 1C5CL 2BZDA 2Q6WA 4ZOCA 5DFTA 1A1OA 1JF1A 2CJUH 5MEND 4MAYA 4XVJL 3KYMA 1FDLL 2BK8A 4BZYA 4D9RE 3E3QE 2E7BA 4MX7A 2Q1EA 3WDJA 1UA6H 5ESVA 2DQCL 4HW6A 5D2LF 5L8LB 3FL7A 4O00A 3V79C 3WEXA 3P0VH 1P2CA 1MFNA 5GSVB 5C08E 2Y9RT 3EFDL 1WC7A 2ATKA 4JZJB 4KWUA 3V6FA 5DLML 4QRPD 3LPWA 3FT2B 4YDIL 4BFBD 5I15H 5D2NB 4ZXBC 4F7TA 4KJYA 4Y5VB 3LQAL 4Z0BL 5HYFA 1MCSA 3VWKA 4XVSL 1JJUA 2AJVH 4GKSA 4U1IB 4LLDA 1TJIH 5CILL 4GKNB 5E08H 4K7FB 4OLZH 4JKWA 2O93L 1KN4H 4F7CB 4JB9H 5F7FA 3V4UL 3AC0A 5E5UB 1R0AH 1LE5B 5D1XB 3BESR 3QQNA 5CEZL 3NZ8B 4N8VA 4F3FB 4UQ2A 2C1OA 2NXZC 4DGYH 4OI7A 3DUUB 3TH2T 1ZV5A 5IQ9A 2RB8A 2YPLA 3MBED 2ZUWA 3S96B 1PZUB 2XN9D 1T21A 1OGAD 3MRMB 3BH9B 1HHGA 3ARSA 1BWMA 2ICWB 3ZL4L 4D0DA 1JPGB 2D7PA 4ZUUA 3TBVA 1PYWB 1INEH 2F54A 1IM3A 1QLFB 2PTVA 2R4SL 1FVDA 2BY2A 5C09D 1Z9MA 3BQUC 7FABH 1M71B 3KPRB 5CSGA 1NFDE 2NXZB 4IS6B 3MLYL 1MVFA 4U1MB 1CBVL 2ID5A 1QO3B 4PJ9A 3ZHLA 3CFJB 1OP9A 1FLRH 3C5ZC 4G9FD 1ZT4B 4G8IA 3LIZH 3EO9H 4M61A 1OCWL 4DCQA 4ESKA 4X80H 1NQBA 1U41A 5B3NA 1CN4A 3BW9B 1ZXQA 4RA3A 5GGTL 3CDFA 2BVUA 5FYLE 4WI4A 1MRFL 3CFDA 2ZCHH 1S7UB 2CSPA 3BQUB 5SWSD 3D69B 1NFIA 4MDIB 5I1DA 3GI8H 1KCUL 1NCUA 3RZCD 5EU3B 1AJ7L 5ALBL 4HIEA 4CU6A 5F8RC 1T2QH 4IDJL 3TBWB 3E6HA 3BGAA 1AKJA 3C5ZB 5E94B 3UBXI 4NKOB 4OD3L 1OWWA 4U1GC 3C6SA 3GMMB 2AABL 3MLZH 4JDTH 3H7LA 4CVXA 1JPFA 2IFGA 5AAMA 1CQKA 1ZEAL 2WZPD 4L4JA 1FH5L 4HUUA 2SEBA 3QDJD 1ZVSB 4X5WB 4Z7NE 4YWGL 4KJWC 3VXUD 4PJ5E 5T33H 2ADFH 4R96B 3RHWF 4AG4L 5BQ7A 3U46A 2IG2H 3L6FB 4H0HB 4P5TC 2AAVA 3WFCL 3PWPD 3MRBA 1H3PH 2BSSA 4FABH 3GSNL 4LU5L 4DKEH 3HMXH 5JQ6L 3TVMC 5FYJD 3QSKB 1RUPH 3MLXL 3D39A 4U1GB 2GUOB 3ETBF 1FGNH 4XPHL 4LCUA 4PG9B 4DUVA 3E3QC 3TGXA 2DAVA 1S78C 5JPMB 3WFDH 1MH5B 3RNQA 3RPKA 2OBGA 2OLDA 3S37X 4UTBH 4XBEL 1FFPA 1TLKA 4KVCL 2IBGA 5ISZB 4Q9RL 4TVPE 1NFDF 3OG6B 2AXJA 3WS3A 5DWUL 3IFPA 1J0IA 3HN3A 4LPYA 2XFXA 3TVMB 3PV6A 1N0XH 3RY6C 3D3VD 2NX5D 1WT5A 4ZFOA 4IRSA 5C9JB 2BVPB 1M7IA 4C56D 3RGVA 3MRHA 5EU7E 4X8JB 5CD3B 1WEJH 3OXRA 1LNUA 2V5RA 3RNKB 3SDCD 4NQSA 4OKVB 1YEEH 3R0NA 2I07B 4JR9L 4RMSA 5FM5O 3MJ9A 1TENA 5F7MC 2H32B 3WHXA 1NANI 2APFA 3B83A 1A8JH 4J3XA 1IT9H 2X4QA 4BJLA 4KMLB 2JB5L 3QG7H 4LLYA 4JJ5B 2HFEB 2K7QA 3E8UL 1HK6A 8FABA 3QQ3B 3WFEL 2MPAH 4LPVA 3QCVL 3ORJA 4NGHH 5EFIB 1QKZH 2W38A 2YPKB 5JIIA 5FA3B 35C8H 2A77H 5HD8C 3CLFH 3WUZA 2ICWJ 1KCLA 4U6YA 1DANT 3MJGX 2IMMA 4FQIL 2WUBL 1BD2E 1DLHB 1RZIB 4OAWB 4YHNA 2ITCA 1A3LH 4MAUH 3ZT5A 1G0XA 2MTPA 4XVUD 5CMAA 4YXLL 4GKZB 3VDBA 3RWIA 3V5KA 4N9GB 4ZPVB 1A22B 4I8DA 4P5KB 1QBLH 2W0FB 5BRZB 2QHLA 3D0VA 3C60C 3TT1L 1BJ8A 2EH7H 4LLMB 2CRZA 3S35H 2GJJA 2XQBH 1RUKH 4Z7NF 2R2CA 3CFEA 5KSUB 2XWBA 3OKYA 1V7NL 3O4LA 3QDMD 4HFWA 4QOKB 3DVFA 2XOTA 1R3JA 2EZ0D 4FN0A 1INDL 1PY9A 4V1DD 5CZVL 2CLRB 1FNSL 2AXGA 2OTWA 2XWTA 4O2FB 4P57B 3TC9A 2GIYA 4UTAH 1T7VA 1FFRA 3L3HB 1QYGL 5EBMA 1IL1A 4Y5XC 2VWEC 3ULUD 4XCNA 4BELD 2AK4A 3CH1B 3U82B 4XPAL 3B5HA 4GLRH 1RUML 5F70A 5GRYA 1EHNA 5DFWH 1T66C 2VZVA 1A7QL 4DZ8B 3C60B 4U6XB 1PG7H 3QFDA 1BAFH 4DFIA 4PV8B 4QRRB 2D3VA 2FEDD 4YDKH 2CDFB 3KPSA 1I7UB 5TPWH 2HRLA 3DECA 1A6VL 2IC2A 2UVEA 4WW2F 4NRZA 4PP2B 4ODHL 4OGZA 3PWJB 4Y4KD 1AGDA 4Y5XB 4HJ0C 3QUXA 2BNRA 4UIMA 5CINH 4FQXD 1A1NA 5C8JB 3TYGH 3ZYZA 2R1XA 1FVEA 1WSST 4XMLH 1U0QA 1G7IA 4PJXE 5AD0B 1KCRH 3LKOB 2P5EB 4EQ2A 3BKCL 3C08L 4HCRH 4O4YH 3GHBH 2QSVA 3RUGE 2VO5A 3NCEB 3HE6C 2FL5B 1R3IL 4BSVA 5J6GB 5C0FB 1AXIB 2QEJA 5FO8B 5KTEH 4DKFL 5FA4A 3IDGB 3GM8A 4P23D 3DVGB 2R4RH 1K8IA 5KVEH 4ERSH 1PKQA 4D8PB 4YDJB 3QH3B 4PGCA 2F8VA 4NZDA 5EC1A 4WFGE 1QBAA 5E99L 3O0RH 2ENSA 2VKXA 4JO1H 3L3GB 3LEVH 1KEML 3J8F7 2EECA 2OI9C 3B5GA 3HE6B 1WISA 4WW2C 3G6JE 4PJFF 5IB2B 4Y8DC 4HQQH 5SWZE 8CGTA 3RU8L 1UFUA 4WENB 1S7VA 3H3BC 3O8XB 2NZ9D 1VDGA 4M8QB 1KB5A 3H9SD 2V2TA 2PCPB 1RUAH 1JGLL 4EUPG 1N5YH 5C3TA 5DHYA 5ILTH 2M8XA 2O5XH 1JZ5A 5EULV 3P4LA 3P73B 1YMME 2D9QB 4TPRL 3N1GC 3FQRB 1IGIH 3EJYD 1XIWC 4CBPA 2OI9B 4P2OC 4HUNB 1YY9D 3GSVA 1W72B 1JN6B 5KW9H 4JZJA 1MF2H 5AWNL 1TVDA 3EOBB 3FT2A 1WWBX 1OB1B 4HHAB 4E41E 4WI9A 4K7PX 1EMTH 3DV6B 1QG3A 4JKPL 4YEFA 3GSOB 4U1IA 5I8EB 1TIUA 3UXFA 3HKFA 4ALAL 4GKNA 3LVEA 3RWFB 5I76A 1E27B 5E9DE 5KVFH 1TZHB 4U0QB 1P6AB 4AIXA 3R06A 3BKJH 4RX4A 1B88A 4WGVB 3UTZB 3VH8G 4NRXA 3CVIH 4MQ7A 1LE5A 1XIWB 4HKJB 5D1XA 5MEOB 1J10A 1GH7A 4P2OB 1T5WB 2A0LD 1AI1H 2A9ML 2EXWC 2NTFB 3ZKSD 4F3FA 4RGNC 4BUHA 1JWSA 3BSZL 1DVFC 3DUUA 2XTJC 4WUUE 3OZ9L 1HHHA 1OQXA 1CGYA 3SHSA 1JNNH 1PKOA 2BSRB 3O6KL 5HDLA 5ACZA 5J3HD 3MV7B 3QUYC 1JL8A 5T3XE 4RMUA 1PYWA 4Z6AT 4C58B 4OM1L 5FK9B 1UXSA 4G6FB 3V5DB 5EZLA 5I66B 1QQDB 2WANA 3LRHA 1YJDC 1YEKL 3KPPB 3MXVL 5HDOA 2YA1A 1WCBB 4W70A 3QIUB 2QL1A 4PJFB 3KPRA 4GBXC 1BWWA 3SQOL 1U8IB 2O61A 4OFVA 4IS6A 4RGNB 4HS8H 2CK0L 3LKRB 3BZEB 1M05A 1DVFB 1HN1A 4U1MA 1J7VR 5C1MB 3ARQA 4GRWF 3U0PA 1ZT4A 2ERJC 2HFGH 5D1ZA 5ESQA 4FQHB 3B6SB 1P5UA 1CICD 3EO0A 3QUYB 3IXTB 5F3BA 1YN6B 4NP4H 5FV2A 2UY6A 1ADQH 1A0QL 4JE4B 1KEGL 4NZTH 4X6DE 4PRPA 1G6VK 4XCFH 2XV6B 5GGQH 1LEIA 5KBNC 3OJ2C 3QA3B 4ZAKD 1S7UA 2AJSL 2CDGB 3MGTB 5F97E 5JR1L 4MDIA 1N64L 4WJ5B 2A83B 1QBBA 1G0DA 3VCLB 4Q97A 5GGVY 3C6LD 5ADOL 1OVZA 1K2DB 2AEQL 1L6XA 4WTZG 4R4FH 3GBMH 1S3KH 5HDBF 3TBWA 2VQTA 3EYFA 3VXQB 5F9DC 4M4PA 3MLWH 4NKOA 3DYOA 1ZWIB 3DPBA 1DANU 1LO5A 5TDPA 3W81A 4WWKC 5JIHA 4IOSD 4M1DL 1H8NA 3AY4C 3BGMA 4DUWA 3FQWB 5D7SH 1DJSA 1L7TL 4ZXBD 3B43A 3ZKMC 3VJ6B 1GGBL 3JWOC 1IMHC 4XMPH 2F19H 1ZVSA 2FO4A 4X5WA 3EYVA 5TF1L 4R96A 3ARTA 3L6FA 5DDHB 1J5OH 3T2NH 2Y07H 1FGVL 5D1QA 1IM9B 2W0LA 1X3DA 1PX3A 4BFIB 5DGRA 3EJZC 4C4KO 5GRUL 4EQ3A 2MKWA 2NXZD 1AD0A 4WWKB 2BX5A 2GUOA 3RWEB 1PG7W 3HA0A 2IGFH 3NCJL 2DYPA 4JFYB 4X7SH 2YRZA 1BX2B 1OF2B 1MH5A 1SY6L 4PJDA 3KAAA 4WNQB 2FGWL 2IH1B 2P7TA 4G5ZH 3GHEL 5JHDA 1UB5A 5ISZA 4NUGH 4WI8A 1LDPH 4X6EB 2B5IC 3HNVL 4XCCH 1S9XB 1YJDH 3NIGE 5J6HB 4Y1AE 1A3RH 5DD6B 3KJ6L 4PJ8C 4TRPL 3B9KA 3PQYD 5BMFL 4KMTH 3BQUD 1EGJH 3P9MB 1JGUH 2EDDA 4NQEE 1FNEB 4BZ2L 1CF8L 4LHJB 5C9JA 4EXKA 1QD0A 2XG4A 4X8JA 2WIMA 5CD3A 3ZE2F 3VI3E 4OT1L 5TH2B 4BA8A 3RNKA 4CUCA 1LK3L 3K81A 4OLUL 4OKVA 2X70B 3C5ZD 4NNPH 2I07A 4PJGE 3QXWA 4JZOA 2A2QT 2H32A 2AS5M 4XVTL 3RWJB 2ZG2A 4OZFB 4NRYB 1MAMH 3G6DL 5CZKA 4X4ZA 4PB0L 4AL8H 4CDHA 4P49A 3PP3H 3T1FA 1OOAA 3UTOA 4LASH 3G9AB 5FKAB 1MNUH 4QHNB 5FUOL 1UJTA 3FRPG 4JFDB 2HFEA 3LQAC 4PJ8B 4L4TA 1EEYB 3W82A 3QXVA 2MSPA 3F6IA 1MRCH 2V17H 3RY6A 4B5EA 2J8UE 2YPKA 3DUSA 2B1AL 5EFIA 5FA3A 5DI8B 1P7HL 1RPQA 1RULH 2DI7A 1RSFA 4OGYL 3C8DA 2LAGB 1IC1A 3P11L 1XF5B 2ZUTA 1S9WA 3BYTA 3QI9A 1DLHA 1RZIA 4OAWA 4YIQB 3WIHA 1CI5A 4K7PY 3OR7A 5T1KD 2FX9H 1KV3A 4GKZA 4HCRA 4ZPVA 3IFNL 2WUCH 5I1GL 1T89C 3DUHA 4HS6A 2EDXA 1KENL 3IYLW 5GGSB 2UVFA 5KSUA 5IV2B 3F7QA 4P48A 1VEPA 4QY8B 4K23L 4UB0L 5FHBL 1I1FA 3BDXA 4KJWD 4GRWH 2A9NH 3K4AA 1NEZG 4L9DA 4PJAA 3D6GA 1QSFD 4O2FA 2QV2A 4P57A 1WZ1L 1UJ3A 3VFVA 3D87B 3VA2C 2IADA 2HKHH 2D4DA 4P5TD 1ITBB 3MJ8A 1MQ8A 3G5VA 4LAJH 1I9RH 3O81A 4JRWA 5J1TC 4J3TA 5A2FA 4CVZB 3TVMD 4MZ3A 3WNOA 1Q94A 1SYVB 1A6AA 1U93B 4U6XA 4XXCA 4HKBA 5DRZB 4HC1H 2OXGA 2P46B 2YR3A 4JY6B 2X89A 2AI0H 3LY6A 4PV8A 2Z8VC 1JI2A 1I1YB 5F7HA 2CDFA 4YHKL 1FNHA 3ZKXC 3LSOB 3MMEA 3NIGF 4OZFH 4R8WH 2HLAB 3IS1X 5DMKA 2CR3A 3MV01 2GYSA 4X4XB 4YHLH 2F53E 4FQ1H 1CD9B 1F3JB 3KYNB 4FTVB 5DUBA 4N90E 4IHOA 4XAKE 2ITDA 1JHLL 4DWHA 1JTOA 4XVJH 1FDLH 4TSCL 3VI3F 1AC6A 3UBXB 2VRAA 4E9LA 4CVWA 5DJ0B 3VXPB 1A3QA 1KBGL 3RWHB 1KG0A 1GIGL 2P5EA 3HS0A 5IESH 5LGHL 4LPWA 1R5VA 3RHWK 3EFDH 5J6GA 3NGBC 5C0FA 2A6JB 5DLMH 3AMLA 1ZLWK 1CVSC 4U6TA 4YDIH 5BRZD 3JVGC 3W0WE 5JDJA 3WJLC 1OTUC 2JE8A 4YUEL 4H1LB 3ZKNC 3KXFB 4AH2B 2C3WA 3LQAH 2J8UF 4HDIA 3DVGA 3GNML 5CJQL 4K3HA 4Z0BH 4Z78A 4XVSH 2IBBA 4D8PA 4YDJA 4RGOL 5CP3H 2XRAL 4QOKD 4RQQA 2PXYC 5T3XH 5HD8D 4EOWH 5DD5H 1NCNA 3L5JA 4PJBA 1N3NB 5L8JB 4OTXL 4LSSH 4GG6F 4LPXA 4OGAD 4LCYB 4LCWB 4BK4A 4H8WL 3OKOA 5CEZH 3HE6A 2EYTB 3B3IB 5L2KA 4LGPB 4B7LA 1IC4L 2EDLA 4AY0A 5A1AA 2DLIA 3HC0B 4NZUL 5D6DA 2D03L 4JN1L 2I24N 5DD1L 1I85A 3O8XA 3C60D 3TCLB 4M8QA 1IZKA 1HH9A 2PCPA 1EV2E 4KUZH 4QRRD 2E9JA 2IFFL 5DRXA 3QDHA 3ZL4H 3FQUA 2PXYB 5E5RB 5E6IB 4HWZB 1I3GL 1XR9B 3FQRA 1ND0B 2R4SH 2ZUQC 4NKDB 1ULVA 1FFNB 4PJ7E 4XNXL 3GSNB 1CXFA 1CFVL 3T04D 1W72A 1WV7T 4HGMA 4ZODA 5J1AA 2IMNA 4JQVC 3GJFK 3MLYH 1OW0C 1OB1A 4HHAA 1T66D 2DN7A 2BXYA 3UAJC 1WF5A 3AAZA 5DQDL 1FZMA 4POYA 1MHPH 2IBZX 5I8EA 2OJEB 1OCWH 3RWFA 1E27A 3EYOB 1TZHA 3D9AL 1MCJA 1JHKL 1D5XB 1G9NL 5GGTH 1WZLA 4JFFE 4X6CE 2HVKB 2DWDA 3VFUB 2ZUQB 2VZUA 4JANB 5MEOA 1VFOA 1A4JB 4OJFL 4HJ0D 2NTFA 3HFML 1KCUH 2BOBB 4NC0B 5E70A 2HKFL 3BP7B 1AJ7H 5ALBH 1NCBH 3DBXA 4PJ5D 5D8JL 4GXUN 1BQHG 2VLRB 4ODWB 4UV7L 4IDJH 4FP8L 5DQJB 4K94L 3MV7A 5DZLA 1I9IL 4LEXL 3LN4A 4HPOL 4JFXA 1RZ7L 4OD3H 1AGBA 5FK9A 3VD4A 4APQA 2AABH 1QQDA 1T3FB 3U36B 1C8PA 4QKXB 4LVHB 3V6BR 2HJFB 3K0WA 1WCBA 2JB6B 3QIUA 4P2RD 4PBXA 1S7RB 1CDGA 1FH5H 1HHJB 5I1JL 4OFYD 2ZP0T 1U8IA 3ARGA 4M02A 3LKRA 1KN2L 1X7QB 4MLSA 3U83A 1JBJA 1DVFA 2DQFA 2J3SA 3O6LL 1RURL 4J3WA 2PO6C 3WFCH 1U2CA 1DQDL 4LMQI 3SJVE 4FQHA 3B6SA 3GSNH 4LU5H 5JQ6H 3IXTA 3UJTH 3TYFB 1IC7H 1U95A 2D9CA 1BHGA 4XPHH 3HR6A 1E6OL 4OQTL 3KDMA 3QA3A 2BVQA 5EA0L 3KPOB 1NANH 4KDTA 2Z31D 3FT3A 4K71C 2D0GA 3MGTA 3B2VL 3L1OL 4MXQC 1QP1A 2K1MA 4KVCH 4PRIB 3QWOB 1T22B 1K2DA 4GUPB 3U2SB 1NJ9B 4UINL 3G08B 5GISH 2PO6B 3V4PL 4RAHA 3U6RB 1NUDA 4AQ1B 1XIWD 3KPMA 4P2OD 2GAZA 5DJ2B 3MRRB 5KS9F 2YXFA 3ARBC 1WWCA 4HXAL 4RDQF 3BIBX 1SEBA 4RAVB 5IHBA 4K71B 1BD2D 3NIDE 2VLKE 3RTQB 1WFNA 4JR9H 4NCC2 4WRLA 3S3PA 1A9BB 4KH2A 1DDHB 2HYMA 2A38A 4WI5A 5DJZB 1NGXA 5SX5K 4G6FD 1PZ5B 4RRPA 3BOVA 4NPYB 2CUMA 3WBDA 5KANI 2E7LC 3WFEH 1H3TA 4BFIA 3QCVH 2EXWD 5J89A 1DCLA 1T2JA 4AENB 4AM0B 4AJ0A 2ZNWA 4RGND 3RWEA 7CGTA 3MUGB 3GMOB 3AB0C 2XTJD 3S88L 1BX2A 4YO0B 2WUBH 1NGWB 3SCMA 4KV5F 2IPKB 4WNQA 2BOCB 3GSXB 4YXLH 3HZKB 2FJGA 3MRNB 4TNWF 3ZDZE 2NW3A 3QUYD 1NC4B 1YMHB 4G7VL 1XMWA 1MCFA 5DMIL 4HJJL 4G8GB 1PBYA 4L9LA 4C55A 1N5AA 3TT1H 5J6HA 1FG9C 2X6MA 1MEXH 5EZJB 5TDNA 1AD9B 1TCRB 3T3ME 5C0CE 1B0WA 3BPCB 1CLOL 1EPFA 3P9MA 1V7NH 4GBXD 1FNEA 1INDH 4C57C 3F7RA 1I1AA 4ZFFB 4XBGB 1FNSH 1NBZA 3AB0B 1X5KA 2QSTA 2R56H 1T7WA 1QSEB 1A5FL 3NA9H 1KFAL 3W9EB 1ERNA 2GSGB 2EICA 1II4E 1QYGH 4FQJH 1AHWC 4XPAH 5E2VL 3UJJL 3RWJA 5JO5A 1IGYB 4HIXL 4U1HB 1UWXK 1VADB 1A7QH 3JWDH 4QHNA 1CTNA 3Q48A 5KS9B 4PJ8A 1EEYA 2CIIA 4I2XA 2Y72A 2CO7B 3WXWL 3TNNB 5MHSD 2C3HA 3MPCA 3STBA 1YYLL 1JHTA 4RGMC 4JPKL 2Y36H 3AREC 1A9EB 4KTYA 1U8QA 1Q72L 4U7SA 2IWGA 1A6VH 3IKCB 1CIUA 4YFLI 1LE9B 1A47A 1FL5B 5FM4A 5L2JB 1GYAA 1MCHA 3H3PH 2AJUL 5F7YC 1IM9D 2IBZY 3KWWB 4XP6L 1U8OB 3R1GH 5BOZG 1AHWB 5HDQL 1CDYA 2EIDA 3QO0B 1QFHA 4WWKD 4Y2DA 2I9TA 1KULA 1VGKB 5D4QA 4YJZL 1Z9SA 4L3EB 3ZKMD 5IV2A 4UIKL 3WN5A 4FXGA 4QY8A 3C08H 3S36L 4RGMB 3BAEH 4LVNC 3JXAA 4HEPG 3AREB 1R3IH 2WP3O 1UXWA 3QEHB 2QKIB 2AEPL 5GPRA 1DBAH 4ZPTA 2Q3AA 4DKFH 3GSQB 4JFEB 1XH3A 1I9EA 4ZUTB 1HSAB 4PJEA 5LG1A 2LTQC 4FG6C 5F1NB 2X7LA 1R24A 5F8QC 1NGZB 2R0LL 3U4BL 1SYVA 3EJZD 5HGAB 4WHYH 4L4VD 4XP4L 3MGAA 1HXYB 1I1YA 2HT2C 1EA9C 5DTFA 4LVNB 4OZHF 3LSOA 1XGPA 5HHME 4MJ5B 4WV1C 2HLAA 3LV3B 4TTDC 5DJYA 4XWOC 3HAEB 4MB5A 4X4XA 4JFDD 1F3JA 3KYNA 5D9SB 2FNBA 4U1NA 5FOBB 5JXAL 4Z8FL 1F00I 5KZCB 3DI2B 5CWSA 1X6LA 3OKEA 1CXEA 3UBXA 4KK6C 5DJ0A 4ZMAT 5C2UB 3MC0A 4TPRH 3NN8B 1J1XL 5HHPB 4I77L 5DFVC 2YXMA 1V8HA 3O3EB 4ODSL 4I4WB 4MHHI 4XAWH 4F7PB 2ADJB 5CUSH 1OP3K 5AWNH 2A6JA 5LCVH 4WV1B 1S7TB 3QO1A 1YN7B 4YHML 4H1LA 4QXUH 3KXFA 1MVUB 5C0BA 3M17A 3T4AB 4WUUD 4AH2A 4JKPH 5KOVC 2V2WB 4IJ3C 2YBRA 1I8KB 5LKNA 4ALAH 1KC5H 4YZFE 3CJJA 3QFJE 1KGCE 3UTSA 3ULVE 3ARZA 3VMOA 4HXBL 1E4KA 4UDUA 5T3XD 1XAUA 1SJXA 1LP9E 4Y4FC 4EI5D 4F7EA 1N3NA 1HILB 1HI6B 4YNYB 5ID1B 5DSCA 1J12A 4LCYA 4LCWA 3BIKB 5GSRB 2XZCL 2ZSWA 3CFKB 3QDGE 2A9MH 4NO0A 2EYTA 3B3IA 1VFAB 5CEZD 4J12A 2Q7YB 2MHAA 3BSZH 5INCB 4P5MB 3HC0A 3JZ7A 3OZ9H 3EJJX 3KYOB 3TCLA 3CSPA 1RJYB 3GSUA 3O6KH 3OSKA 3BYYA 1N8ZA 4IJ3B 2UYLA 3FFCB 4OLYL 5C07B 3E1F1 2PXYA 5E6IA 4HWZA 3NCBB 4Y4FB 3HMWL 3GIVB 1ND0A 1YEKH 4H20L 2Q7NA 4OZHB 1FFNA 1IAOB 2E9IA 3K1KC 3GSNA 3IKKA 4FTVD 4X6FB 3SQOH 3G5XB 1YEGL 4G3YL 5E8PA 4NQCE 2CK0H 1KLGA 3FFDB 3AS3A 3EFFB 3ZE1F 4U1LB 5ESAB 1FZKA 4L5FL 2OJEA 4WWID 4X4MA 3EYOA 1O0VA 2P5WE 3UTTE 1UZ8B 1ED3B 4PR5A 5C08B 1A0QH 2N7BA 2GY7B 5EU6A 4O58H 1OGTB 3VFUA 4HH9B 4FXKB 1SYSA 3EOYG 1U3JA 1U2HA 1A4JA 2R1WB 5AEAA 3T08A 5JR1H 4HD9A 3CXDL 1N64H 4Q6IC 5K9QI 1S7QA 4J6RH 3QZWB 1WQVT 4MMZC 1WLHA 5ADOH 4P46A 2AEQH 5F88B 4DVBA 1OWRM 1X5LA 1YQ2A 1QSZA 5DMYA 4GAJL 4JFHE 5HYSA 3DOSA 3E2HC 3MRDA 4NZRH 3DRTA 3E6FA 3LQZA 4IOFC 1X44A 3VXRB 3F8UB 3O41B 3LDBB 5T1MB 1J8HB 1RK1A 3WDIA 5KJRL 2ESVE 4HBCL 4KZDL 4M1DH 5B8CC 1ES0B 1M7DB 2ARJQ 1OTUD 2JB6A 5L7XL 3ZKND 1S7RA 2XZZA 4WEMB 5JIPA 1GGBH 3ULVF 5MERB 1HHJA 4NSKB 4JRXE 3ULSB 1LP9F 1X7QA 4Q6IB 5TF1H 1QLRA 1YNLL 1JF6A 2P44B 2PXYD 1C5DA 2Z93A 3U0WL 2B8OT 4L3CB 4GRMB 5LAXA 5IKCA 2RCSL 1WAAE 4ONHA 2D7QA 4RDQG 3MV8B 1FGVH 3E2HB 1P9MC 3WLWC 1AQDB 1TVBB 2ENYA 5ANMA 5GRUH 5MP6L 1RIVL 1Z0NA 3LKPB 4EDXB 4NQED 3NCJH 1D9KA 1WBXA 4OV5B 1SY6H 2BJML 4EJ1C 4NNXB 3GHEH 3I75B 4PP1C 5JHLL 1JNJA 4PRIA 3QWOA 1AR1C 4FFWC 5HGHB 4GUPA 3U2SA 3G08A 3ALPA 2EDNA 2MMXA 3VXSE 5FO9B 1PD6A 2Y1VA 4O51B 2GJ6E 5C92A 1N2RA 1FAIH 2BMKB 3KJ6H 4TRPH 3U6RA 5BMFH 5BO1L 1BFTA 2CRMA 5LWYH 4I0PA 3MRRA 2D31B 4PJCE 2CPCA 1CF8H 4NHUA 3S4SB 3X13A 1Q1JL 5CSZB 12E8L 3UAJD 2VLRD 4LKXA 1O5DT 3RTQA 5BXFA 4WFEE 1MLBA 2X4TB 1NBYB 1BQLL 4XVTH 3IAGC 3G6DH 5DJZA 4ZUVB 4PB0H 5K9KB 3FB6A 1PZ5A 3U48A 3PXJA 2E7MA 4G43B 3GKWL 4PLKC 4P2QB 5C0EB 5MEPB 5HGDA 3QJFA 2GK0B 4NT6A 2GTZB 2B1AH 2QBWA 3MUGA 4WUKH 3V6OA 5DMGC 3GMOA 2HWZL 5D6CA 4PG2C 1NGWA 3T0XA 3VD9A 4AIZA 2BOCA 3GSXA 5EZIH 3QQ9C 4KRNA 2VR9A 1CFTA 2VUYA 2Z4QB 3CVHH 4H8WC 4X0KB 4XBPA 3SKMB 4ZOAA 3I3BA 1VACA 4ZD3L 1YMHA 1UH3A 3IFNH 3NIFE 2VNCA 4GXVL 4F2MA 4G8GA 6FABL 5I1GH 3BD5A 1MUJB 3BVNA 3AVEA 4FQ2L 5EZJA 1VENA 5F89A 1YY8A 1JIBA 1TCRA 5AG9A 5E4IA 2EYRA 3BPCA 2A6IB 4HG4J 2B4CL 2ICES 5IQ7L 4K23H 4UB0H 3V5HA 5FHBH 1JYXA 1UC6A 5CS7A 1L9NA 4XBGA 2XG5A 5CLTA 3MJ6A 3BIAX 4OLEA 1CFNA 1WZ1H 5B38G 4MJIA 3CMOL 1QSEA 2PO6D 2R8SL 2GSGA 2PYEB 4WEUD 1IGFL 4LNRB 1FYTD 3SGEH 3QNXA 5F7DB 4Y4HA 1FN4A 3F7YB 3OV6A 2PW1B 5E5MA 5IB4B 1ETZA 4N90D 5IOPB 1NL0H 5M95B 4NOBA 1EO5A 4FHBD 1UVQB 4U1KB 4JO4L 2QSCL 1IKNA 2X1PA 4YBHA 3TNNA 1GZPB 4QF1B 4EVNA 2Y4SA 1TJGL 1B6UA 4MXQD 3QNYB 5CGYC 3LKQB 3H6JA 4KHTL 1CXLA 1P7KA 1G9NC 3IKCA 4AEIL 3BDYL 1FL5A 5IROA 1PLGL 1H0DB 3HC4L 2X4OB 2FSEA 1EHXA 3T0EE 5AAWA 5BS0E 1AHWA 1JHLH 4MD0A 3S98A 2EE2A 5J7CC 1Y18A 4TSCH 4MCZB 3ARBD 1KBGH 1RJCA 1VGKA 5GGUA 1L4IA 2AERT 3WFBL 2YD6A 3RIFF 1OAUL 2DIAA 4LARH 3EYQC 5KOMC 5LGHH 1TPXC 4K94C 1WTGT 2Q86B 4WGWB 3TO2B 3NOIA 32C2A 3F62A 5D7IA 5ICYB 4QT5A 1NC4D 4RFEB 1YPZB 2MCPH 5I8OH 4Y16C 1JVKA 2DMKA 3K46A 4YUEH 4JFEA 1FBIL 2C3VB 4NC2B 1OTSC 2NY6C 5CJQH 1BFVL 1LEKB 5D7JA 5EU4B 4BH8B 3FJTA 4RGOH 3MUHL 5DC4B 2JJTC 4BM7A 2XRAH 2Y5TB 3I9GL 2ILLA 4BH7B 3MRLB 4X9FA 3L5WB 4YLQT 4OZIF 1BIIB 2DQIL 4NWTL 1QSED 4OTXH 2Z9TA 3TO4C 3V8CA 3NIFF 2HJLA 5BZWB 3BZDA 4QXWA 1HXYA 4H8WH 1EAJA 2VITA 2W60B 3HUJF 4Y19A 3LV3A 4Y16B 1LVEA 3IDJB 2VSDA 2VMFA 3HAEA 1F2XK 2UZIH 5DD1H 3PABB 3FB7B 2L7JA 5BZDA 3ROOB 43C9B 3O6FC 1MI5B 4E5XB 5D9SA 3I84A 4UQ3B 4NC1E 5FOBA 1AFVL 2IFFH 3BHBA 1KLFA 2FX8L 3FO2B 2P1YA 4LVEA 5I30L 1CYGA 1G7MB 1I3VA 1NCAL 3LZFH 4FFZH 2OYPA 1I3GH 3FB8B 3NN8A 1NMCC 1BFOA 1XGRB 5K93A 1LGVA 4XNXH 1CFVH 1F4YH 4I4WA 4F7PA 1FL3B 1QBML 1S7TA 1P7QB 1XGQA 2QSQA 4OCWL 4W6XB 3VDAA 3MLRL 3HZVB 2HVJB 4YFLF 1MVUA 3NCYP 2ADIA 4AEEA 5DQDH 5HHVH 4FS0A 3ARYA 4PJXB 2V2WA 4L3ED 5JZ7D 3O6FB 4PJIE 2AJXL 4PRHB 1EFQA 1I9JL 3QNZA 1I8KA 1T1YA 4YGVB 1RIHL 1HQ4A 3CDGA 4IOIB 2ZUUA 3D9AH 2N4IA 3ARED 3B9AA 3RUGB 1JHKH 1G9NH 1Y0LB 1KLUA 4JY4A 2AXFB 4YNYA 3QUKB 5ID1A 4M7KL 4P9HL 1AO7E 1NMCB 3BIKA 3CFKA 4OJFH 1JYVA 4TNWK 3RRQA 5F6IC 3OHXA 3BJ91 2Q7YA 3P9WB 3HFMH 3HI1A 2VC2H 2HKFH 3T8XA 2X4SA 3KYOA 3OF6D 3PIQA 1J87A 4UV7H 2JLLA 2YA0A 4FP8H 1IGCL 4K94H 3VH8A 3N06B 5C07A 4HPOH 1RZ7H 4OZIB 3EOAB 4RZCB 2CLZB 1U8JB 3MV9A 2EDBA 1OAYL 3GIVA 1PEZA 1XCTB 1IAOA 5F3HB 5C0JB 4PJHF 4XPBL 3HUJB 5I1JH 3G5XA 3V52L 5F6IB 3VMNA 4FG6D 5CJ8A 1INQB 1KN2H 1WGOA 1P69B 3FFDA 1J1PL 2QJDA 4U1JB 5KZCD 1NCCL 1WBYB 1YYML 1KJ2A 1TITA 2Y23A 3O6LH 1RURH 4MNGB 5JIKA 4R0LB 5IB1B 1UT9A 4LLAA 5GJTL 3R8QA 2IJ0C 2ARJB 2X09A 3V0WH 3RIAF 1B3JA 2DS4A 3T0EC 1HE7A 3ZDYE 2HT2D 1UZ8A 2DF3A 3V7AG 2VLME 5C08A 4EZMA 3D48R 1N26A 1A6WL 4TTDD 1E6OH 3BH8B 4QHLA 3H0TA 1IBGL 4K2UL 4XWOD 4JFZL 5EA0H 4E41B 3VG9C 4PRNA 3U1SL 1TQCC 4ODTL 3FO1B 3B2VH 3L1OH 1BLNA 1KXTB 3A6BH 4ZTOL 3DARA 2H26A 3QZWA 3WSQL 4Z7WF 3WIIL 4XXDB 5F88A 4KK6D 5ITFB 3N0PB 1CDHA 5J13B 3EDFA 3V4PH 5DJCA 1F90L 3LPGA 4D9LH 4OZGB 3DMMD 4CU8A 5B39B 2F8OA 2FO1A 4RIRA 3D2UD 2V5YA 3O41A 3I6KB 2YK1L 3FQNB 5E2TL 4HXAH 1M7DA 3OJMB 2E3VA 5GRZA 3SO5A 1B2WH 2JJVA 3EZJB 3VG9B 1U92B 1TJHL 4J4PC 1TQCB 1NFKA 4P3CL 3QCUH 1Z3GL 4FZ8L 1FFOA 3QXUA 4TN9A 4Q6IA 3FFCD 4Y88A 1NMBL 2PW2B 5TF0A 3SDYH 1DL7H 1TMCB 3MTRA 4L3CA 3DX8B 4H88L 4PBVC 2OL3L 3QB7C 4Y4FD 3U9UB 3SDDA 4CKVX 3MV8A 3LHPL 4O2CB 1VFBA 3GJEA 1JZ4A 1AQDA 5C0CD 3VXMB 4KJPC 3GMRA 4PJHB 3ROLA 4EI6B 4EDXA 3C5SB 2DTML 3MRJA 3S88H 2R9HC 3IAQA 3HPLA 4OV5A 4NQDB 4MNHA 4CAGA 4NNXA 5C0DB 2DM2A 3OQ3B 4LSRL 5C0AE 1UZ6F 3SOBL 4HG4K 2BSTB 4MJ6B 1B0RA 1FLTX 1JNLL 5K9JL 5HGHA 3Q0HA 5DMIH 5D7LE 1RZJL 1T5XB 3GSRB 5FO9A 3SE8L 3AUVA 3RFZC 3MREA 4R26L 4OCRL 3GJFA 2DM7A 1CLOH 3NBNA 4W4NA 4I9WE 4QXTA 3SDXE 2J12B 4KK9C 5DGQA 3S4SA 4XPTL 3CZFA 3MJ9L 1A5FH 2GHWB 2GJZB 1KFAH 3ZDYF 4Z7WB 1JCKA 4WVRA 2NY1C 2YD9A 5E8EB 3PHSA 3CX5J 2X4TA 1NBYA 2YN5A 3MSPA 1YEFL 1ORSB 3UJJH 4CJ0A 3TBYA 3VXRD 5K9KA 4OD2A 4L29A 3NCMA 1J8HD 4HIXH 1GGUA 5F72S 2FLRT 2PF6A 2OR9L 4G43A 2H3NB 1DUZA 3F12B 2P8PB 4DTGL 5C0EA 4KJQC 5J0BA 3WXWH 3QIBC 1Q0YL 4Z7QF 5L6YH 1ZLSL 1YYLH 2GK0A 1RV6X 5GS2H 4JPKH 3UX9B 4YR6A 3VXOB 2ZSVB 3MRKB 1Q72H 4KK5C 5C0IB 1RQ5A 5EN2B 4LRIC 2GFBB 2AJUH 4X0KA 5IP4A 4XP6H 4G6ML 1UENA 3FRPA 3TN0C 2IH3A 4IOFD 2B7DT 4I18C 1ZHKB 3EIFA 5JMOC 3QG6B 4AYFA 1AH1A 2A6IA 4UIKH 3RBGA 3QIBB 2DQGL 3S36H 2DM3A 3HPJB 4KKBC 4OBSA 5A2JH 5JOEA 4PTUB 4ZSOB 2CMRL 2AEPH 4LRNL 1KIPB 3L9RA 5HHMD 3QULB 2Q8AH 4JREC 2WWMC 3O3BB 5KANG 3F7YA 2WWKO 2PW1A 5IB4A 3TN0B 3WLWD 2R0LH 2OJZL 3U4BH 4I18B 3ARFA 4HUVB 2X40A 1CDIA 3F65A 1UVQA 4XP4H 2R2BB 4PRDB 3FT4B 3NAAH 1EUTA 4QF1A 5JUEL 3QNYA 2LQRA 3IFOB 4PP1D 5T5FL 1CZ8L 1FNGB 2K7PA 2EEAA 1EERB 4FFWD 5GRVL 5J56B 4G42B 3RVWD 5H35B 5I1HL 3BMVA 4NQXB 1H0DA 2C7UA 4JREB 5D5ME 3PG2A 4DQOH 4GXUM 4P2QD 1AGFB 3BZ4B 5JXAH 4Z8FH 5MENE 4LAQL 4M62L 3VXTB 4M4RA 3SDAA 3QWRA 4MCZA 3QFJD 1KGCD 5ENWB 3ULVD 5TQ2L 4JHZA 4X7CC 3WFZA 1U3HD 1J1XH 4I77H 4PUBL 1N4XH 3TO2A 2MKLC 3VGAC 1SJEB 5ICYA 1UQSB 4PTTB 4M7JH 2XKUA 4RFEA 1YPZA 4IRJA 4RBPH 3DRQB 1KJ3L 4YHMH 3EUUA 1LEKA 2W9DL 2G9HA 3IS0X 4TUKL 2NR6D 5IW6A 4WHDA 2VLJB 4PLKD 3STZB 1Y6NR 3VFWA 2NTSP 3IJHA 4LIQE 4Z7UE 2Y5TA 1OM3L 3P0YL 4BH7A 4W6WB 1HSBB 3MRLA 4AIOA 4HXBH 3L5WA 5DMGD 3N50A 5DK2A 3M45A 2VR5A 2MWCA 4RSVA 2I60L 4TSAH 3OG4B 4D9QD 5JW4M 2PYED 5JNYB 4RWHA 3OGCA 1X6NA 1F8TH 1KB5L 3W11C 2DM4A 5HPMA 4L3AA 4Y16A 3VI4F 4YGAB 3FB7A 3JBG7 3EDKA 43CAB 1MI5A 4HKZB 4E5XA 1MFCL 1S5HB 1UKQA 1MQKH 5IJVA 4QCIA 3FO2A 2XN9E 1G7MA 1OHQA 1OGAE 1UYWL 1JGVL 3CGTA 1OSPL 5FF6A 3FN3A 4D3CL 2IANB 2XA3A 1ZSDA 3QPQC 4G8EB 3MLTA 25C8H 4JZNB 4H20H 1XGRA 2EDKA 3DNKA 1J88A 2F53B 2FDBP 1OQOA 1YEGH 4G3YH 4WO4C 4WCYL 3ARWA 3HZVA 4ORZC 5TGBA 4OQTA 3O2WL 3ZDXE 2RHEA 3UJIL 1ORQB 5FB8A 1QEWB 4OIIL 3ISWA 4EBQH 4PJXA 3RI5K 3RA7H 2HAZA 1ZE3C 1NLDL 1L0YA 1EJOL 4IOIA 4M1GL 2I5YL 4U3CA 5T5NF 5CGYD 3RUGA 3MXWL 2F9BT 4HV8A 1V7ML 4OCXL 3AS2A 1F6AB 3SBWC 3PXHA 3QUKA 4Z0XB 2FHFA 2X4PB 5EUOE 1BZ7B 2JJUA 3S34L 4MVBC 2C4FT 5K33A 3WNLA 2F5BL 3DXAB 5SWSE 3CXDH 5DJ6A 4Q9BA 4JG1L 4HUMB 2MNUA 3MRGA 4MDJA 1I7ZA 2HFFB 4JFOA 4RAUB 3U30C 4GAJH 5HYQA 3BWUC 1P84J 3EYQD 2DQHL 2V7HB 3RVXC 4X7FC 1UACH 1RHHB 3EOAA 3FHQA 1DEEB 5SWQB 5KJRH 1F5WA 1U8JA 2CLZA 4HBCH 4J3VA 3G6JA 5SWZA 1XCTA 5F3HA 5C0JA 2VIRB 2OTUB 1B0GB 3O3AA 4WU5B 1OTSD 1VSCA 2NY6D 5FO7B 1FORL 5HYJB 2YPLE 2B4CC 2CUHA 4HX1B 1INQA 2YKLL 3QDJE 2DRUA 4A6YA 4XB7A 3HE7B 4P99A 3VXUE 1YNLH 4MNGA 5IT2L 1YMMA 4ZOEA 3U0WH 4R0LA 1KCSL 4Z7VF 2RCSH 3K4ZA 2MQ3A 3U30B 3CPLA 2P4AB 3PWPE 2ARJA 5DMJB 3TO4D 3VXSD 2GJ6D 3BZFB 3MLVL 5FYJE 5MP6H 3EHBC 4ENEC 1RIVH 4MWFB 1P7QD 4KI5E 5E6ZA 3FMGL 4E41A 1B9ZA 3G9VA 4XCYA 1CDBA 1UKSA 3FO1A 2BJMH 2UWEB 4FQQB 2D7MA 3F58L 3MCKB 3O6FD 4PRHD 3TV3L 5I16B 3G6AB 4MJ4A 5KSAC 5I8KL 5JHLH 3Q5TA 5E9DA 3H42L 3UROR 2VABA 4XCEB 5ITFA 3REWA 5LGJA 4O9HL 1N59B 4OZGA 4JFFB 5EZOL 4X7EC 2YD4A 2F58L 4ODVL 5AG8A 5B39A 2NMSA 2PYFB 5DRWA 1HCVA 4BSWA 3HRZA 3I6KA 3FQNA 5DJAA 2NX5E 3H7BB 4JHBA 1GC1C 4X9GA 4LEOB 4JO2L 4QTIL 2J4WH 4QTHB 1YNKL 12E8H 4LBEA 1U92A 1NDGA 1MY7A 2NY3C 4XRCB 3DYPA 4Q7DA 2DWEA 5KSAB 3RL2B 1KPVA 2EO9A 4NNYB 3UDWC 3DO3A 1Y6KR 4M7LL 1VFUA 2BFVL 2IAMC 3OB0H 4DUXA 4GRLC 3CDCA 2QQNL 4BYHA 1OTTC 2X1XR 2R2HB 1T04B 2JJWA 1BVLA 1U36A 4ISVA 4OFDA 3HR5B 1GGTA 1BOYA 4EI6A 4W81A 4JPWH 5E1AB 3C5SA 4GAFB 1EX0A 2HWZH 2QADD 5CCKL 1G6RH 2OZ4H 1Q0XL 5E8DL 4P4KC 3DO7B 4K3GA 5C0DA 3S37H 2NY3B 4R7NA 2BSTA 4MJ6A 5I0DA 4ZD3H 1EBAA 2YRPA 4MD5A 4F8QA 4S1QL 3S6CA 3MCLL 6FABH 2IAMB 3GSRA 4MAYC 3GB7B 4JKLA 2CXKA 3MBXL 4X6DA 1YQVL 4GRLB 2J6EA 4R9HA 3UYRL 4NDMB 2X05A 4KKNA 4YPJA 4GMTL 4TSBL 4F9LA 2B4CH 3FOLB 2ZG1A 2DLEA 5GJSL 5IQ7H 3CSGA 3DI3B 2VLLB 4XMKL 1JZ6A 3B8YA 2C1PA 5HGBB 3TT3L 5C0NC 1CL7L 2CKBA 5IVZA 4EDWL 3CMOH 2GJZA 4P4KB 1EEZB 4YC2C 3JTTA 5E8EA 4Y0GA 4OV6F 4QRQB 3RL1B 5TE7L 3ULUE 1U3YA 4LCCA 4LKCA 4YAQB 2C3GA 1FSKC 2VE6A 4KI5F 3T0ED 1JMXA 2Q6WB 3VWKC 3AROA 2IQAA 1A1OB 3TJEL 1JF1B 1OY3B 4MAYB 1OPGL 1LO2L 2BXZA 3EDEA 5JOPD 4TVSa 2H3NA 3F12A 3PL6A 4MX7B 2QSCH 3RDTA 4F58L 3WIHL 2OSLA 1ZANL 3RZWA 3NTCL 3O11B 5GS2D 3VXOA 2W65A 2ZSVA 1T6WA 2YC1B 4FNLL 4KHTH 5C0IA 5I1CL 4Q58C 1P4LB 3BDYH 2AVGA 1U91A 3C9NB 1PLGH 1HNGA 4K8RL 4P9HC 2GFBA 4YC2B 3HC4H 3V6FB 4C4KT 1CL7I 2R29L 5FUCC 4LSVL 4LSDA 3C5JB 1DUYB 3WV0A 4F7TB 2B20A 4JM2B 4KJYB 2VZ3A 4TOYL 5CLWA 5DC0A 3LQMA 4UUJB 3KLHC 3VXMD 5C0GB 4GKSB 2VISA 4LLDB 1GC1H 1ZS8A 4G9DA 4NQDD 1CR9H 1OAUH 1X5JA 5CD5C 4J4PD 2FR4A 3BEVB 1CDJA 2DIBA 3WO4C 3KPLA 2L0DA 2VXQL 1KIPA 2Z35B 3I02A 4N8VB 5IBUB 5CJXA 3QULA 2C1OB 4UQ2B 1FBIH 4LRIA 1K6QH 1BFVH 3F6LA 4Y1AA 5GGVH 5IQ9B 3MO1B 2VZTA 4PLOB 4DAGL 2HJKB 3VRLF 5A16A 3I9GH 3O4LE 5DK0A 2KQNA 4KJPD 5F71A 3WNKA 2FX7L 2HTKD 2R9HD 3MNWA 4D0DB 2R2BA 4PRDA 4NWTH 4ZUUB 2F54B 2YWYA 1J0KA 2EC9U 3L3JB 2MJWA 5DD0L 4PJGA 1FVDB 1NBQA 4WI2A 4AT6A 5E2UH 3WO4B 4NQXA 1HEZB 2OR8A 5HHOD 3H9SE 1D5BB 1D5ZB 1AGFA 3EGSA 2AJ3A 3QT2A 2ZOKB 1WIOA 3H3KA 3VXTA 5I30H 1UG9A 1KTLB 4KK9D 5ENWA 3KPSE 1ZGLA 1M6OA 1F4XL 3GBLA 1IQDB 2C4FU 3TIDA 3T2OA 1W0WB 2NY1D 4O02L 1AO7D 1OD7A 1SJEA 5TDOB 1UQSA 3CD4A 4PTTA 3HCVA 3CFDB 1F6FB 5JA8B 1QBMH 3DX6B 1CDUA 4OCWH 1ZT7B 3GI9H 3MLRH 5IMKB 1NFIB 5EBGA 2OMBA 5D70L 5IM7B 2GY5A 5I1DB 5M7QA 2AJXH 1I9JH 3BEWA 3STZA 3TA3A 3ZE0E 1RIHH 3QIBD 2B2XL 3GMQB 4FFVC 5I8CB 4R97B 1IARB 1AKJB 4XH2A 3RY4A 2NZIA 5DYOB 4KK5D 4M7KH 4P9HH 3C6SB 1T4KA 2YD7A 5JNYA 1A7BA 2EE9A 5IHUL 1W0VB 2FZ3A 1JPFB 2CRYA 3MGOA 3ECBA 3TN0D 1JGEA 5DS8A 4GAGH 4KRLB 2XA8L 4OFPA 1MFDH 2GKIA 4JY5L 43CAA 4N1EA 4HKZA 1N6UA 5CSBA 2EXYD 1IGCH 1S5HA 3U46B 4K3DL 3UO1L 5JLZB 2XZQL 1MJ7L 2G5RA 3ZZ1A 3WLBB 3PWNA 4KKBD 3ZKQD 2BSSB 3FOMA 4S1SL 3X3GH 3GK8L 1RZJC 2OL3B 4LHUG 1G7HB 3D39B 1K5NA 1QNZL 2F53A 4LCUB 2WWMD 4F33B 3RGVC 3TESA 3V52H 5IW1A 5E95B 1BZ9A 4P59L 2ZUYA 2K3TA 1QEWA 1BJ1H 1FFPB 1ZHBA 2NY4D 5EOTB 3P40A 1MCLA 4BFGA 5GJTH 4KDWA 2EDJA 3MODL 4TQEL 2BC4B 2VB5A 2VH5L 2DMCA 1QFUH 5IFHL 1A7RL 1F6AA 2FRGP 1N6VA 2XFXB 4Z0XA 1A6WH 2X4PA 1IBGH 4K2UH 3BJLA 4JFZH 3W0WA 3IDYC 4W68A 5D2NE 3BMWA 1XCQA 5KN5B 1E4WL 3U1SH 4ODTH 5CBEB 1FHGA 4MA3B 4PY7A 4ZTOH 3RGVB 2VLJD 1Q9KA 3CSYA 3DTXB 1M1SA 3WIIH 4NQSB 3ZHDA 2EDYA 3W2DL 2KQMA 5HVGB 2HFFA 1F90H 3GBNL 4GSDH 1RZKH 4RAUA 3WHXB 5FCUL 4KTDL 4M6MH 2V7HA 5L9DL 3HG1D 4Z76B 1DEEA 3H9ZA 2YK1H 5SWQA 1N6QL 5E2TH 3TZVC 8FABB 3GFUA 3ZE0F 5IBTH 2Y25A 4U33A 2OTUA 1DLFL 3IDYB 4WU5A 1TJHH 1VPOL 4MQXC 3WUWA 4HZLB 1X5ZA 1F42A 2ZWLT 4FZ8H 4HX1A 4WI6A 2CLVB 3QEGL 3HE7A 3EZ8A 1KXQE 3Q3GA 1NMBH 1FV1B 4IIQA 3FQTA 3ZT7A 3LKNB 5JDSB 3V5KB 2IAND 2G5BA 1KJVB 4U6VL 2VKWA 5HHXL 1GHFL 1TQBC 3LHPH 1YZZA 3D0VB 2JIXA 3TP4A 5KVGL 1DR9A 2ZOLB 2FIKA 3KPRE 3MYZA 5IHLB 3E0GA 4KPHH 4MWFA 3TZVB 4HUWB 4MD4A 2XWBB 2AV7B 4HFWB 2DTMH 3KR3L 1R3JB 4AEFA 2UWEA 1BJ1J 3MCKA 4K3JL 1A6ZA 3B8SA 4LSRH 4ZFZB 5I16A 2G60L 4RMQA 1SBBA 3ZYIA 5HI5C 3P30H 1E28A 1JNLH 5K9JH 5EBMB 2P5WB 2W07A 3QUXC 2AK4B 3OAUH 1P4IH 3QPQD 3S5LG 3SE8H 4XNYH 1BEYH 4IMLA 4JFFA 4R26H 4X6CA 1TQBB 1P4BL 4OCRH 2B1HL 1GXEA 5K9OA 4QLRA 4F15C 3MQIA 3MOBH 2UY7A 3QFDB 3DXAD 4N8VG 1K8DA 1ITCA 4WO4D 4HIJB 3DGGA 1EAPA 2KKQA 4LEOA 4XPTH 3UPAA 4QTHA 4OCSL 3MJ9H 4R90H 5TFSH 1U58B 2BNQB 2D2OA 4PRAA 5SV4A 4XRCA 4NRZB 1YEFH 5J57B 3FN9A 5DJXB 1XF3B 4NNYA 1MFEH 3QUXB 2BNRB 1P1ZB 3HB3C 2OR9H 1HCFX 4AEHL 1T04A 4DTGH 1RZFL 4CN4A 1G7IB 2VDKH 4F15B 1Q0YH 5HYJD 1ZLSH 2ZCKL 1NEUA 4ZYKA 1VA9A 4NZJA 5E1AA 3CZJA 5CKAA 5C7XL 4NBXB 1G84A 3DO7A 4BSVB 1CLYH 1OARL 1X4ZA 1M7XA 2J2ZA 2PETA 4G6MH 3RVXD 5FA4B 4MZ2A 2D7NA 1K8IB 4DKDC 1PKQB 5FYKU 4BQ6A 3CK0H 4XP1L 5EC1B 2LU3A 5AZ2L 2XWJB 3JTSB 1JYWA 2DQGH 3EO1A 1EDQA 3QYCA 4ZNEA 4BFEA 4QHKI 4M6NH 4HULB 4PLJC 4JCMA 5IMMA 5ISZE 2CMRH 4LRNH 3RVUC 3EW3B 5I73C 4P4KA 4JZJC 2DLFL 3KPQA 2BY1A 4JJHA 4JFQA 4QRQA 5KVMC 3RL1A 3QHZL 2VXTL 1QFOA 3UPRA 2X9YA 2OJZH 1KB5B 2Y7QA 2V2TB 1SHMA 3RX8A 1YEJH 4L8DA 3T3PF 4ENED 5DHYB 4NQVA 2GITA 2W9EH 3VWJB 5B38A 2RGSA 2EIBA 5JUEH 5DQ9A 3IRZA 3O11A 2VLKA 4LHUD 4ETYA 2R15A 5T5FH 1CZ8H 3KPNB 5KSAD 2YC1A 5D1XC 1P4LA 3GSVB 5ERWA 2VXSL 4I1NB 3MCG1 5I1HH 5I73B 3C9NA 2DQTH 2HMIC 4FQCL 3C5JA 1DUYA 3LD8C 4JM2A 1J18A 1MCPL 2UUDH 4UUJA 4M62H 4GW5A 4JDZA 3LRGA 5C0GA 2G2RA 5I76B 4MS8C 5FKPA 1IE5A 4XTRC 4PUBH 3R06B 1IAKB 5BW7A 4Y8AA 2NY3D 3LH2L 4NRXB 4UZGA 5LQBL 4YH6A 3BEVA 4MQ7B 4KQ4L 3ZTNL 4QHUA 2X1QA 2Z35A 1KJ3H 2IAMD 5BRZE 3DX9B 3TFKC 5T3ZE 1JWSB 2W9DH 4GRLD 4TUKH 1OTTD 1HHHB 3LD8B 2VDPL 3MO1A 4P3DB 5JQHC 2HJKA 1OM3H 5D1ZC 1WWAX 3P0YH 4QOKE 3V7MA 1MFAL 1KTDB 5ACZB 4LPTA 3IU4L 1U8KA 2I60H 4NQTA 4P4KD 1UXSB 5EZLB 3L3JA 2OCFD 4PBWD 2HN7B 2ZNXA 1KB5H 1KYOJ 5DHVB 2X5PA 1HEZA 5J12C 5J1SC 1FC2D 5ECJE 5JW3L 2O61B 4MAYD 4PJDF 1MJUL 5DJDB 1M05B 5CHNA 1D5BA 1MFCH 1D5ZA 3STLB 5FGCB 2ZOKA 4OF0A 4MNQB 4QRRE 5ETUA 4J7RA 1UYWH 3AM8A 3N85L 1JGVH 5D1ZB 1OSPH 1KTLA 5ESQB 5IB5B 3U0PB 5I1EL 4D3CH 3IVKB 3EO0B 3C2AH 2O5YL 5F3BB 4HWBL 3QUML 4GO6B 1IQDA 2VZOA 1SMOA 3TBSB 1IILE 1W0WA 2ZCLL 3R4DA 3QIWC 3QWQB 4PRPB 4POUB 5TDOA 5MI0C 2VWEE 1LEIB 4HF5H 3Q5YA 3DGCR 1DE4A 4LQ1A 3DX6A 4WCYH 3VWKD 1ZT7A 5IMKA 1MCQA 4S11A 3GMLA 5J12B 5IM7A 3UJIH 4OIIH 3EAKA 1EFXB 1SVCP 3ARDB 1QRNB 2XNAB 3DURB 3MX0A 2R69H 2WP3T 1NLDH 5HGGS 2P5EE 5CBAA 3GMQA 4M1GH 5I8CA 4Z7OE 4OF7A 5E2JA 3EYFB 5D1QC 4PV9A 3DX7B 4OCXH 1V7MH 2E27H 3NH7L 4UT6H 5DYOA 5D71L 4K55A 5TDPB 1LO5B 3S34H 2EH8H 1XZ0A 1W0VA 3BGMB 3QIWB 4HGKC 2F5BH 5MI0B 1C12A 3BRGC 2YPLD 3ZYJA 4JG1H 2IF7A 5EORH 3KLHD 3S3JA 2FO4B 1A6UL 3EYVB 4U3HA 2AK1H 3OAZK 4JEGB 4PRBA 5JLZA 2F54D 3PV7A 5CD5D 2DQHH 5ITBL 1JUFA 3WLBA 3X17A 4N0UB 1ZA6A 3B9KC 5D1QB 2AJZA 1XGYL 2LE9A 2WINB 1NAKL 4J3OC 4ODUA 4HS3A 2OL3A 1G7HA 1OLLA 4JRYB 1AD0B 4KI5D 3TCXA 4HMDA 4P2RE 2WIIB 2Q3ZA 4F33A 1FORH 2DYPB 4PJ9D 2QR0B 4DW2L 4JFPA 4PJAF 5GHWL 4PJDB 4YFEA 3DV4B 2P7TB 5IT2H 1W8NA 4HAGA 3CCHB 5JHDB 1KCKA 1UB5B 1I4FA 2FBOJ 5EOTA 1JF5A 3L5XL 1U6AL 2Z8RA 1UWGL 4I0CC 2BC4A 1TCMA 1WFUA 3Q1SL 3WS6C 3N9GL 3B9KB 5TE4L 5DO2C 1VHPA 4G6JL 4XP9L 15C8H 4M5YH 5KN5A 2VDLH 5CBEA 3F58H 2H9GA 4MA3A 3QI9C 1DQML 4S2SB 3TV3H 4HWEL 1PSKH 2YS4A 3DTXA 5I8KH 2Y06L 1N0LA 5CZXC 1AKJD 3H42H 1X5GA 4JQIH 4JZOB 5FYKL 1Y6MR 2DL2A 4I48A 3W5MA 2P49B 4K8RC 1WIPA 5EZOH 2VN7A 4R3SB 2F58H 3T1FB 1ZLUK 2DQEL 4LCIH 5J11C 2AKRB 5SX4I 4Z76A 3QDGA 3ILPB 3HNTL 4L4TB 5I9QC 4NHCL 4X6BB 3DLQR 4OI8A 2VDRL 2ZKHH 4QTIH 3DUSB 3FO9A 3GGWB 1YNKH 4GJTB 1LHZA 4JHWL 4Z7OF 3HLAB 4HZLA 3T0AA 1BPVA 1UJ3C 3RJDA 2CLVA 3V4VH 1S9WB 3QI9B 5LGKA 3OR7B 3NA4A 4FFVD 4ELMB 1FV1A 4M7LH 3LKNA 5JDSA 2BFVH 1Z9OA 1KJVA 4F37F 2JF1A 3D39D 2DBLL 1GGYA 3BDBA 1D5MA 2ZOLA 3FAXA 4HS6B 4XXCC 5J11B 3SN6N 4PJFE 1NGPL 3TZVA 5AYUL 4MA7L 4HUWA 4RGNE 4NQCA 1HWHB 2AV7A 2CJUL 5I9QB 4PJBF 2JK5A 2XTJE 4YEEA 5E8DH 1Q0XH 1I1FB 3SE3C 4LDOB 4PJAB 4ZFZA 3VDCA 1UJ3B 3IB4A 3VFVB 2IADB 1Q9OA 2E6PA 3MJ8B 3G5VB 2P5WA 4S1QH 3UTTA 3MCLH 3S97C 3I85A 2EDWA 3WL9B 3MBXH 4WI3A 1CCZA 1Q94B 2OR7A 1YQVH 3NCYS 1A6AB 3UYRH 4WHCA 5IBLC 4IRSD 4GMTH 4TSBH 3UC0L 1A7PH 4I3GA 5I15L 3EYSL 4HKBB 3RGVD 1RJLA 4XMKH 4HIJA 1CL7H 3ARPA 1IGJA 2XQYG 1TJIL 4EDWH 3B2UC 2XZAH 2H32H 2R0ZL 4OLZL 1U58A 2BNQA 3MMEB 2VYRE 1MOEA 1MPAL 1U9KA 5GQBA 2FCBA 4LSTL 1CXHA 5IVXB 2EC8A 5TE7H 5DMKB 4R7DA 1NC2B 3OTTA