4F9TA

Ribosomal protein l1 from thermus thermophilus with substitution thr217ala
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
226
Chain Sequence
b'PKHGYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTAMGPSVRINPHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
molecule tags Ribosomal protein
publication title [Crystal structures of mutant ribosomal proteins L1].
pubmed rcsb
total genus 65
structure length 226
sequence length 228
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 4f9tA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f9tA02
3QOYA 5DM70 1I2AA 3TG8A 1U63A 3U56A 4REOA 4LQ4A 4QG3A 4DFCB 2HW8A 1MZPA 1DWUA 3U4MA 4F9TA 5DM60 3ZQJA 1CJSA 1ZHOA 1AD2A 3FPNA 3UMYA 4QVIA 4QGBA
chains in the Genus database with same CATH superfamily
3TFOA 4PIVA 2XUPA 1TTPB 2AHOA 3T54A 3QELA 3OT5A 2IBTA 2AQKA 4Q9NA 1WDMA 4ND3A 3I30X 4OJYA 3ZZUA 3GGGA 1U1GA 3BMNA 3LK6A 3LX8A 4NP6A 1DTSA 5GTDA 2X1MA 4QQKA 3UBMA 3QPDA 4EB3A 5KYXB 1U28A 1VCNA 1GN8A 3C4QA 3N8GA 4OBEA 4G23A 2ZIXB 2BMEA 3A6FA 2QX4A 2QX7A 2G4VA 1E1LA 4LY3A 1QLHA 3ESYA 5KSYA 2IYYA 3VMMA 3DULA 5KCMA 1DG3A 5DRYA 4YONB 5JD5A 5G0WA 1GTG1 3O94A 3VR1A 4B44A 2D62A 1M5TA 3QMVA 4CL8A 1M2WA 4DY4A 2D3TA 1EUCA 2P27A 3ECCA 4GMDA 2RK6A 1M6EX 3H9BA 2Y1FA 5I7SA 3BT7A 3N2IA 5KO2A 1QKJA 4OB6A 4Z4FA 1QIGA 2PT5A 3F3SA 2BFDB 2R8RA 3OQVA 3U4QB 4EQ6A 1IEVA 3LPLA 1GITA 3ULKA 2CK3A 3TTUA 4DV1B 5HZMA 3HSYA 3L04A 1M2VA 1YZUA 2A92A 2ZS8A 4NU6A 3R5FA 4F3RA 2JHAA 3LRPA 3NXSA 1JH9A 2PLFA 2C2XA 4A8JA 3FPJA 4FGLA 4DC1A 1XC7A 2FH5B 2X2FA 2H7VA 3MGGA 3R3XA 1NXWA 2B82A 3KPYA 3VJLA 4ZICA 3TF5A 1JXQA 2YJTD 1EX6A 3ZNNA 3OZGA 4RDCA 4BLPA 3AJRA 2EQAA 2PR7A 3AR4A 4R2MA 1MB4A 3PGLA 2H48A 3A28A 4B43A 1L5SA 3TE7A 1B8VA 1OWOA 5LQSA 1DQYA 4POOA 2ZUWA 5CFRA 3WWYA 5FPKA 4YALA 4OLJA 3UB2A 2FFHA 5DULA 3UTDA 3CA8A 821PA 2VPPA 3CMMA 1E20A 2BE7A 4BZQA 1M2EA 4CL3A 2R7KA 1OC2A 5AVKA 4HCJA 4LHYA 1LW6E 4XGQA 3KD2A 3QU5A 1ESMA 2KLHA 4RIEA 5KDLA 2Y1XA 5C46F 2IE8A 2BN4A 1L7MA 1Z75A 3C3EA 3COVA 4LRTB 3VUFA 2GESA 4HBGA 4DWJA 5TT0A 1R50A 4NMXB 2QGNA 2QG4A 3JYNA 5JDCA 3MTBA 1G291 4R2IA 3L0PA 4OX9Y 2HLDA 1KMHB 3RTEA 3AJ8A 1MG0A 5E1DA 1CYDA 1R6TA 1ZH6A 2DTDA 2LZ0A 3FHOA 3ZDYB 4HH4A 5FI0B 7GPBA 3VHXA 5KOYA 3F98A 4D41A 3ADBA 3HBAA 4RYLA 4YAJA 4CQLA 1IBRA 4FFVA 1ND6A 1OLSA 3IAM1 2Y68A 3B85A 4E07A 4F8YA 4HFJA 3F73A 1IUPA 2I91A 5CHYA 4QELA 2VL7A 4YCJA 2AOVA 1MGOA 2HH9A 5BN1A 3W3ZB 4XRRA 4CM4A 3WLNA 1E79D 2DKOA 2Z3VA 4OSPA 1A9YA 4W8GA 4BNIA 1TUIA 3BXEA 1TQ6A 3ILHA 2FHSA 2CSUA 2FN3A 2XRMA 3DDOA 4TLLB 1YDHA 5AKKA 4WEQA 3RYTC 1G5QA 2ENUA 1G3IA 3PR3A 4F0KB 2P2CA 3ASUA 2X9VA 3AXMS 2WWFA 4OQQA 1YASA 1CQXA 1COWD 1XYYA 4X1IA 2HNAA 1P1KA 3RPEA 4QU0A 4TROA 2C5EA 5C4MA 1OBHA 3O8CA 2VDHI 3VPDA 2C94A 2Q5CA 2VTVA 2HU5A 1DIHA 1JHAA 1UM9B 5JG7A 2UVPB 6REQB 3ZHCA 1EE2A 3LC0A 4C9BA 2W4MA 4BX3A 2FMUA 621PA 1Q12A 2ZYHA 4FZ5A 4K6OA 4Q82A 1V8BA 2YZMA 3ANMA 3AI7A 4R1TA 1EVEA 1M34A 2XW6A 2FE4A 1JYSA 4UZSA 1YQ9A 4FDVA 1SM4A 2G0TA 4LHVA 4OGLA 4RHTA 3SNHA 3UWMA 1LTKA 4CM8B 3SYNA 2WJGA 4KIUA 4B85A 4EBFA 4P33A 5IASA 5IS2A 4C2TA 5G0VA 2V7PA 2XE6A 2CXRA 1JIXA 4EYKA 4O25A 3DVAA 3LQ1A 1W4ZA 4XUEA 4TZ0A 2K4MA 1XDDA 4QDUA 4M0EA 3VDXA 4LUCA 4AXXA 1PZEA 3OZBA 3Q5EA 4V03A 2ATEA 3OP1A 2X0RA 1M2OA 4PONA 1NZFA 5KJ1A 3CR7A 2I3BA 3QYPA 2GH1A 3A06A 1CQIA 1THZA 1AXEA 4D9MA 4P31A 2SBTA 4RM3A 4CMEA 4BZZA 3B1XA 3SE7A 2XSZD 4YVFA 3M81A 2QDXA 4RVDA 1NIPA 1TC1A 5IBPA 1YUMA 2I99A 4UXJA 1W5TA 1TM7E 3DE7X 4N3GA 4UQOA 3R5XA 2Y67A 2P9CA 1YNOA 3LVQE 3L4SO 3PUWA 1GK8I 1TJ4A 1FVXA 3L8MA 1YD7A 2R8XA 3JWHA 3LQKA 2E4WA 5JZSA 4C04A 1KRWA 2ZRMA 3CISA 3UQZA 4X6YA 1L5OA 3E9QA 4GKBA 4RKRA 4EW1A 2FRXA 3A9RA 2AZ4A 3TSYA 3EDCA 4KQIA 4RTQA 1X13A 1VBMA 2DWQA 4JCCA 3VZBA 1TCVA 1KK2A 4KI0A 4XOUA 3G0CA 5L3QA 4FEAA 4UTPA 2OP0A 4XVQA 1DBIA 1GUAA 2C7GA 3E3NA 1LSOA 4Q5IA 4OSEA 1AN9A 4IFTA 1TKRA 4U2FA 3ZEAA 5DHSA 1UPCA 4QOFA 1G8AA 2B8NA 2V7QD 4Y2PA 1XD9A 1NJ2A 3GLGE 1QG0A 4FR0A 2FUKA 1U9IC 1EB9A 1PJQA 4GNRA 3SSAA 3SQXA 4KIWA 1D8AA 1UBOS 2PUTA 4NAVA 3A4TA 5A5FA 1JFFA 3AUAA 2EKLA 2CXNA 3MVEA 4X61A 5AD1A 2H7XA 5AVQA 2JLRA 1JHUA 2O2IA 1BSVA 1QVVA 3OO1A 1KH2A 1OTHA 3CUUA 4IQFA 3FPLA 4O63O 1P1CA 2RHCA 3ZCRA 2QN9A 3C97A 4P58A 1R5BA 2ETVA 4JZKA 3WZLA 1YR9A 2PVSA 1CNFA 2QMUA 4RFVA 5F3WB 3DOJA 5BSVA 1W0JA 2NX2A 1YO6A 3B70A 3SC3A 4WKPA 3T3GA 1AA9A 1ATZA 1M54A 3N53A 3RAJA 5C7IO 3AH8A 5ED0A 4EHBA 2I0FA 4LNUB 7YASA 1QSGA 4ZKDA 2QLTA 3MIZA 4LDNA 4Y6GB 5K8TA 1Z7GA 4PINA 3PGVA 5HA5A 1GQQA 1LI7A 4YRJA 3T12A 5JQWA 4EUSA 3JTEA 2NXWA 2PFKA 1B73A 1VLJA 2QD5A 4I50B 3JD2A 5KTSA 1NA5A 5AHRA 3GEIA 3WDKA 5IWAB 1T4BA 3GEEA 1PV4A 3BYZA 3GBPA 4B4WA 2VAXA 2PTHA 3T95A 1NE2A 1ZKMA 3X1YA 1IWAB 4RVHA 3A31A 1XALA 4NZMA 4BKOA 3LA6A 3P5BA 3V7NA 2FLKA 5CD1A 4QICA 2EIHA 5ADUS 4HRAA 4ZWNA 2IHKA 1PLJA 2KI5A 3ELDA 4EF4A 5KYUB 2UXCB 2FW0A 2ZPTX 3OICA 2EDCA 2PUJA 2WR8A 3DMPA 3JVIA 3OJLA 5FAKA 4HNAB 1WRBA 4CMJA 1R6XA 1UAAA 2EZ8A 4DILA 3G6KA 1MEJA 2VH2A 4IMJB 1UWKA 1EWKA 4IL5A 4A3SA 2WMOB 1KRHA 1TVCA 4MSUA 3R7NA 4R0NA 5D6NA 1I1QB 1E0JA 2AGVA 3EWNA 2FWNA 1OX5A 2H2HA 1DJNA 4D4MA 4W1PA 4Z9BA 4RHXA 3S2YA 3G7UA 1ENPA 3HA7A 3VR6A 2CV0A 4Z4CA 4LJRA 3LSTA 1BCSA 2I66A 3TPCA 1ZI6A 4OQXA 1NSYA 1DRVA 1Y1TA 2ZEJA 4EG6A 2ZLBA 4RU1A 1DIRA 5IAOA 1L7OA 4JJ4A 2J08A 3DLIA 4K2HA 4L5JA 2WSBA 1E59A 2QG6A 3PUHA 4OUDB 1XAGA 4MV9A 4QWWA 3RUIA 4DUYB 1QLWA 1J97A 1XKXA 2R66A 4XD2A 4JWKA 3PPIA 3GAAA 4AS1A 1LX7A 3RS4A 4EB6A 2ZJBA 4JI1B 3TFWA 1NBIA 2VK1A 1FXUA 1BCSB 5AVXA 4MR7A 1FRFS 3AEKB 4BLOA 3LNTA 1F14A 3VMFA 3WVNA 2P9YA 1KHTA 3PT5A 3RAGA 1M34E 3AF5A 4RVOA 4MP8A 4CMGA 3CKYA 4OUDA 3ZWVA 2ODWA 2VQ6A 3BCRA 4JJEA 2I4IA 4Q9IA 3W5CA 5K99A 3FOFC 4U8HA 1U8EA 1IVSA 3FAKA 1A8SA 4R7TA 4D6PA 4KGZA 2R6GA 4R3WA 4GVPA 3N74A 3ZZNA 3FOCA 4YAIA 3H2YA 5JCXA 5HCUA 3LX5A 4H0FA 3Q98A 3OY7A 2Q8NA 1J23A 3EHDA 4HZIA 2FJPA 1ZA2A 2ZAGA 3EF3A 4PYLA 2OYRA 1OBOA 1D9XA 3BRWA 1FNSA 1XVVA 4OL9A 5CIYA 4C0WA 2VHWA 3FOWA 2VZ8A 3QVLA 1VJ5A 2EDAA 1WUYA 3QV1A 5H3CA 4KR6A 1JFFB 1GQOA 1Q0SA 1UOPA 2G6BA 4CUZA 5BRJA 1N6RA 3SXUA 1N2OA 2O3UA 1VSQA 3PX3A 3V8VA 1L7EA 2FPPB 1XDZA 4M0FA 4WASA 5CJ2A 4Q15A 4XRGA 1IJEA 1L7RA 2UYGA 3PFIA 2NTYC 1JE1A 2C7RA 3LA8A 1CKEA 3O3CA 4DLYA 3UIEA 2G04A 1L1QA 2AXQA 4LJLA 1C7FA 1N5OX 1UPXA 3EH2A 5LPNA 3LWBA 3FIUA 4HNTA 3FCAA 1DO2A 2RARA 4OQ4A 1VCOA 4RDHA 5EJGA 2QD2A 1NUSA 4FN4A 4JI7B 3ZZMA 2CXHA 4OQFA 2AK3A 3A6EA 3PVZA 2GAFA 1FFHA 3QEJA 3WNQA 2W58A 5CLJA 1SD2A 3HSKA 3PICA 2AG5A 2DX7A 4FGJA 4M99A 2D13A 3ICCA 3KS9A 3W8DA 4A0RA 1B1AA 4IZOA 1W2WB 1U02A 1OFUA 2IYEA 1IUNA 2XOKD 3V4LA 1Z22A 4EHNA 5JU6A 4ZVKA 1DX6A 4Z7NB 3OFVA 4HNGA 5BY2A 4KN8A 4PXYA 1AGPA 2GCOA 3QY9A 3ZDZB 1QGED 4WUVA 1HZZC 3TBKA 1WL8A 4YRAA 1NFFA 1V45E 1V7PC 3I34X 5LDHA 2SHKA 3EZ9A 2V8BA 2P7IA 4LRUA 4KDFA 5LD2B 1U99A 2CNWA 2E4YA 3F5MA 4DMRA 1BVHA 3AEYA 3OF5A 1Q1NA 4QC2A 5AKGA 5E3IA 1THGA 2B2NA 2V65A 5BSUA 1UBUS 3CHYA 3LK7A 4BXOB 4G6ZA 2ERCA 2RGGA 4KE7A 2PMFA 3ONFA 2OV2A 5DXJA 5LZ9A 3OT1A 3SY8A 4IIYA 3LXXA 1XYGA 1FRVA 4NYMQ 3W34A 4C88A 2Y93A 1KQPA 5E0KB 3RYIB 3KHUA 2ZJFA 4QYIB 3CLSC 1W19A 2YXBA 5IZCC 5JCOC 1KK1A 1VIVA 3QTLA 3C3CA 1T1EA 2JIZD 4MKFA 1JH8A 4BP8A 1BGXT 4FYMA 3AF4A 5FJIA 1Y37A 4D81A 1CE8B 1E3LA 4B2YA 5JS6A 3H8SA 1JUDA 1Q3TA 3IODA 2FSSA 4AF6A 3GCXA 4RHYA 1T2DA 1GPDG 3GDGA 2I3GA 3AO0B 3QE3A 4GX5A 1CEQA 2BPOA 2MT9A 2NWQA 3K7EA 2C8LA 1XEXA 2GO1A 4IIVA 5H9VA 3WADA 4GF5A 2BMDA 3RW9A 1A96A 1KOFA 3IDOA 2RE8A 4Y2UA 4AT1A 3OQBA 2FPIB 4B82A 4U8GA 5DN6D 1T3TA 5FUQA 5ALLA 4CQMB 1Z5WA 2Q0HA 1H8ED 2IODA 2VHQA 2B6HA 2GNOA 2WYIA 2AR9A 1EFVB 3GEPA 1E1CB 4MX8A 3B6MA 1EEHA 5BVGA 4YI3A 4KWEA 3KUCA 2ZWIA 3PEEA 3CUVA 1HORA 3ZV3A 2G88A 4ERXA 2NV0A 2LE0A 4LOKA 3MHTA 3CH6A 1ZXXA 1MIHA 1OIXA 3UK0A 1N8KA 1NE7A 5EHNA 4J0IA 1VYUA 4FDAA 4EG1A 1ID8A 4I4NA 5IT0A 4DOMA 2YKGA 1NBME 3NR2A 2AX4A 1M6HA 4MVJI 4BPBA 4LZJA 1PZGA 2FLVA 2XQVA 1YBVA 2Y1CA 2BGIA 3DBLA 4MVJG 1TJPB 1A8HA 5EMNA 4F45A 3AVWA 4YMIA 2I2WA 4MVJM 4EY5A 2GD2A 4ZT7A 4ARZA 2JBHA 4RGQA 1GFZA 3VAAA 5ADVA 3U5TA 1K3FA 2QZ4A 1X39A 2VNHA 2Z2IA 1KDRA 3NZEA 4RQAA 5HJEA 4AO7A 1V1RA 2W2PA 2G40A 2JJ8A 2I29A 2VH1A 1EVKA 1XL0A 3P26A 4OO3A 4KG7A 3R0VA 4Q9JA 5HF8A 2EFYA 4Q4LA 4ABYA 5DI3B 1SC4A 3AR5A 1V8PA 1VE3A 4I1OA 1VG0B 5IXYA 1KI6B 2VSXA 4XQEA 4G8JA 5IC4A 4O1IA 2ZFUA 1F48A 3BXZA 2BKLA 3KBBA 2VDNB 4CI9A 2AF4C 1N32B 3PXCX 1B43A 3BMOA 3M34A 1QQBA 1SNYA 4I81A 5FBLB 4IIJA 2EG5A 3F7MA 3ROXA 3MCAA 1EEXB 1LF5A 2P75A 1RQXA 2H0AA 3L0OA 4D3ZA 2PS1A 1O5OA 5H4GA 3KWJA 3U39A 3RSQA 2VYFA 3O82A 5A3SA 2BGGA 2C77A 3ED1A 4W9NC 3U61B 2C54A 1NTRA 2QW1A 1DQZA 4UNSA 4ZCRA 5B2FA 3LT2A 4RD6A 2JKZA 1VSUA 3LT0A 5GV7A 1EFTA 3ZZTA 5BT8A 3EFOA 1O7JA 1AB5A 1RWQA 1YQGA 1Z3IX 1JEDA 4FNAA 4KHPB 4KUHA 3NXKA 1UKCA 4AG3A 1ST3A 4NWIA 2IIVA 4YCBA 1KSGA 2CC2A 3RK4A 4RLFA 3R6DA 3ZVNA 4DT1B 5JAIA 4RHFA 1FTYA 3KOOA 4MJLA 2Y2VA 4G5FA 4NMLA 2XVAA 1KI8A 4LE2A 2VAPA 3OZDA 2ZAOA 4QHSA 4TPKA 2VYNA 5TC4A 4DDHA 1YS9A 3WGKA 2NO5A 4MV7A 4KQCA 3VYRB 4DJAA 4QGAA 1OU0A 1KL7A 1YR3A 4PQGA 5KMGB 2XCLA 2XUOA 4B8WA 1UBGA 1P7VA 1Y1QA 3OT1B 4HFMA 5IM4A 2UYHA 3I0NA 4MRNA 1KA9H 5FEMA 3FNBA 2C4WA 1VYTA 5E7MA 3TQIA 1SKMA 4IGAA 5LP6C 2AFIA 3NKFA 1ATIA 3KQVA 1N6KA 4TS9A 3CN7A 1CW2B 5KTOA 3HN6A 1TUGA 4DJTA 3P8ZA 4ID3A 4V0MA 4HAZA 3W3AH 4QAQA 4BWGA 3BGOS 4L78A 1F8FA 1AKYA 3PGKA 4MULA 5AKIA 5A7HA 4BOYA 2NPIA 1BX0A 1Z38A 5EZYF 3TECE 2ZJ1A 4PZPA 1T3LA 5K45A 1JT9A 2ZIEA 1CU1A 3TFQA 2I2XB 2H1IA 3HO6A 4UNPA 4LBZA 3LSYA 4ZOLB 5M04A 2QT0A 4IRXA 1ZJJA 2W2QA 5JAZA 4G8CA 1F2DA 1NUTA 2AN1A 4JLSA 3USCS 3WGGA 2YIJA 4B3XA 2PD6A 4B71A 1K1EA 1RBZA 4X7BA 3RUHA 1JQEA 2F43B 4RUKA 5I9IA 3DFFA 3A2MA 5CA0B 3KOUA 3WXBA 3U60B 2FPGA 4JBIA 1LY1A 4Q6WA 1SBNE 3D7NA 1JKXA 1QX4A 3SDSA 3CF6R 1M83A 4MS4B 3T9AA 5CDTA 5CLLA 2LBPA 4OEHA 4FFOA 4B32A 1YJ8A 3NBKA 5HE8A 3TLGB 2CN1A 2YC4C 1DX9A 1U7UA 4AF8A 2DJIA 4YLEA 3HSSA 4Q3KA 5LL6P 3N0TA 2EZUA 4K9NA 4DB2A 1FPMA 2FPGB 2IC5A 5IN5A 4EUNA 1T4CB 1WXQA 4YO8A 1A1SA 3ZLVA 4ZCSA 3FJ1A 3UV6A 2XIQA 3O03A 3TS1A 4D26A 4NARA 2HIGA 4EO4A 3A9WA 2NU8B 2W4IA 4JSTA 4L4YA 3TQQA 4RULA 2YYYA 4AX4A 3ICWA 2O2DA 3E7FA 4Q01A 4J2HA 5A4AA 1E2MA 3KUXA 2O8FB 4HR7A 2GEKA 4DSAA 2PT7A 1SUSA 1HTBA 3QOWA 2FOXA 1G2OA 3OHMA 2JI9A 3DFZA 1M0TA 4C05A 3DXZA 2CMGA 2QEQA 1AG9A 1QE3A 4GX2A 4ZI5A 2FPSA 5C5DA 2QE6A 4QLBA 2HHHB 5ETJA 1I1OA 4TZTA 4XARA 3CRRA 2MYUA 2GJAA 1GL9B 3IE0A 4U7TB 4XEUA 3JATA 3PFNA 1MOQA 4OYHA 5K0TA 3A37A 5D87A 1X7YB 2VR1A 3AF0A 3GFVA 2FW7A 3TAXA 4OK5A 2BFCB 2A5FA 3HZOA 5CNKA 4EB0A 5BXYA 2P4HX 2RKOA 4MMYB 3ZCXA 4Z2YA 2PGAA 2AYXA 4LZWA 1NQOA 1LEHA 3EISA 1FXWA 1UBKS 5IF3A 1IN7A 1G0OA 5BSGA 2CLEB 2IH5A 4OD0A 5F4BA 5HZHA 2HL6A 1YC2A 4KQEA 1ZUNA 3TW6A 2ZQ5A 3OOEA 1JHVA 4IR7A 4JODA 2POCA 3DH0A 1TZMA 2VTKA 1E6LA 2NO1A 4GFDA 521PA 4MGYR 2N75A 2IPXA 5C4GB 5DW0A 5EFOA 4B7CA 2G9VA 1X92A 4K0RA 1DKLA 2ZTLA 1TD1A 2EWVA 3IJRA 1KZ1A 4V0ME 1LZLA 4BE7B 4YP5A 4RPJA 2PH5A 1E0DA 3F6SA 3RC3A 2ID8A 3HCPA 4EHHA 2YWBA 5JH7F 4TRRA 1JWLA 2H4WA 2BD0A 1RC8A 3MAJA 4Y7DA 1GU1A 2GTHA 2WNIA 1QQ5A 1W5BA 4MQEB 2IHNA 3SIXA 4NG4A 1TVKA 4XM0A 3W7BA 2J07A 4FZ3A 5GGXA 5SYMA 4BV9A 3T3OA 3GGCA 4C08A 5JWRA 5BW5A 5KSOA 4ACAA 3FHTA 5IKXA 1Z0ZA 4KREA 3ETGA 1N7JA 3CH7A 4C78A 3AUSA 1IWBB 1NY5A 3SYKA 2VJMB 3PQEA 4FYJA 4RD2A 2O23A 1M6NA 2V45A 3MJHA 2VRNA 3IIMA 2I6SA 5KTNA 1BKYA 1V1MB 2YJZA 5F1KA 2MR6A 1IL0A 4FGWA 4L0QA 4JJ8A 1LB1B 5C9ZA 3L8DA 4ROTA 1QF9A 5H1YA 4M0DA 4HDNA 2O7SA 4HX5A 1RR6A 2P68A 3GFSA 4C0SA 3Q7SA 1V6SA 2W43A 4CM4B 1B93A 3COZA 4MK4A 5KWJA 1WXEA 3KQYA 3ZWWA 3K5WA 3JQ8B 2XNSA 5CLHA 5FOVA 4WXYB 3UPTA 2H5JA 1QGZA 1R9JA 1UXIA 5DCWA 2DETA 5EZYB 1EX1A 2ORYA 3DM5A 3K1JA 4CBVA 3C45A 4NFLA 1E3IA 2V8OA 4OHBA 4G2TA 3HB1A 4MI1A 4OQYA 2O54A 4JH0A 3WK7A 1MHTA 3PIIA 4QPZA 2WVHA 4MPRA 3AESB 2QTBA 1FA9A 2Z2JA 1X7GA 3FXAA 4ZAGA 3DHEA 2W42A 3ZX5A 5TMBA 2C78A 1R9NA 4IFBA 3EVFA 4OK6A 1ENYA 3PD7A 4P3XA 5ARCA 5H82A 2ZRJA 2NUTB 4LSGA 3FYUC 4LFBB 5I4BA 3IUNA 5EZYA 1AGYA 2I6TA 3Q0IA 3UTCA 2Q3JA 4UM9D 4C6HA 5HOQA 2F67A 1Q0UA 1X7XB 3R0ZA 1DC7A 4MUYA 3IQGX 4Q1FA 3AT1A 2WJYA 4QVIA 4X95A 3ZDFA 5JCPA 3K1YA 4W5TA 1TTHA 2P5UA 4HH1A 1U0NA 1ISRA 1KSHA 1D6JA 2C2OA 4PV7A 3S0JA 4ZQIA 1Q77A 1U0RA 3DTVB 3EODA 3NBZC 4LHWA 5B4TA 4JUFA 1COWA 3IP7A 1SVLA 2H9IA 1RLCS 3WNCA 2J5KA 3C3JA 4G9GA 3DVLA 2WSIA 4JR2A 4LCEA 5M3BA 1CB0A 2OP1A 1O6BA 2OQIA 2V4ZA 3H6KA 4P81A 4US1R 2YTZA 2HCFA 4F4HA 3GRKA 3K0CA 3SEAA 2TECE 4GVXA 2ZJ6A 1ZD9A 1EA5A 1KF0A 1PD1A 1GTZA 1ZM4A 1J0CA 2HK6A 2J6CA 3AFIA 2CFOA 3NYQA 2G4LA 5AOVA 2Q1YA 1E3QA 1XDBA 2ZBQA 4MDHA 3MGAA 2ZU0C 1UWVA 3ETNA 3IV7A 4OP3A 5EKTA 5DNDA 2XNHA 2QOEA 3HBNA 4BASA 1ZA1A 3WA7A 2XV1A 3ID6C 3M9LA 2PX2A 1VLMA 2D4HA 4CIDA 4GT1A 2YZNA 1EDDA 1Y4DE 3AF1A 3LT5A 4H1UA 4JLVA 4ZQCB 2V74B 5F2EA 1Q1EA 3MJ4A 4RJLA 2DWOA 3B7GA 1ADCA 5DOZA 4AQ7A 5LXTF 5M29A 1ECFA 1VOTA 3EE6A 1FTGA 4YQZA 4QTUB 1NR7A 2PMDA 1BMQA 1PR9A 2BONA 4TQ9A 4EJFA 1QHYA 1GEGA 4WZAB 3TLAA 2GHRA 1DXQA 2XCSB 4K88A 4XX0A 1MD9A 1J4AA 2JFBA 5CM9C 1WXDA 4Z1MA 3KELA 1NF9A 3P52A 2QQFA 1A7JA 3ZIUA 4B34A 2MIIA 5F35A 1PT9A 3D02A 3DE2X 3UHPA 5AJVB 3UEOA 3OESA 4FW9A 1J5EB 3AFNA 2NSHA 4HWSA 5IP5A 4QXAA 3ER6A 1I2ZA 3S81A 1CZNA 1XPRA 1H2FA 3FFXA 1WP9A 5T4FA 1LV8A 3U5ZB 3PEWA 1SG6A 2ZXEA 3CNNA 3OQIB 3VR3D 3HVJA 5GONF 1NC1A 3SMQA 5AW4A 4A8JB 4QVGA 5EJMA 4LQCA 1YU6A 2A4MA 3DEJA 2A57A 2C5BA 1TZKA 3K15A 3W6ZA 3ZE9A 4LOIA 3IP3A 3BWYA 4R1NA 1TZJA 3IIIA 3AGPA 3TRJA 2AI3A 4M9XA 4EA8A 2QM7A 4N0PA 4DA7A 1ILEA 3D0OA 4A91A 1PT6A 4JT4A 4R1UA 4YP7A 1MO6A 5U9CA 2TYSB 4J7UA 3C8HA 3ZHXA 4HWRA 2PUDA 2QZJA 2ZZNA 1MKYA 1BO6A 4AXBA 4TMKA 1C9YA 3K8QA 1FFGA 1J5PA 2E89A 2PRKA 3GEGA 1LH0A 4K3UA 3L0SA 1TL7C 5A05A 1WABA 3LT1A 3WSWA 4C4PA 3Q8KA 2OBBA 5LQMA 1US8A 1F51E 1UWCA 2BC9A 4ZI3A 1GHTA 4QFDA 4DSZA 4QNMA 2WYVA 1ZJ4A 1NQXA 3VYSB 1I5RA 2EV9A 4EKYA 2FVYA 1LLDA 5FO1A 4ARBA 4BO6A 5GOTA 3WYGA 4BAGA 3BERA 2IPMA 2HPVA 3U7JA 2EGGA 4FLEA 1AK1A 3F8SA 4OHVA 1FDWA 2B3TA 1BS1A 1NYTA 1KMQA 1G3MA 3BFKA 4FQ7A 4HEA6 2WJJA 5B3JC 4GECA 3GJ8A 2D54A 2NN3C 2XZPA 1BEUB 3QBTA 1E1MA 5AI5A 3E8MA 1VL2A 5HIMA 3L43A 3CH4B 4QARA 5B7PA 5KNBH 4IM7A 2H00A 3QM1A 3LTNC 3WKCA 2QRVA 1E2UA 4JHXA 3E2IA 4TWBA 4CCWA 1WKCA 2IUTA 1N6HA 1S2OA 1YR6A 2D0OB 1OMOA 2IHJA 4CEJB 1YZKA 3IP8A 1QC5A 3GNLA 4FVTA 2W71A 8RUCI 4OV6B 5AJZA 3W6NA 3ASZA 2W2NA 3PQ8A 3TNJA 4CETA 1CTQA 1NBMA 1NSTA 4NFSA 3I9LA 5E4TA 5EPUA 2XE8A 4MLDA 5JXWA 3C98A 2IF0A 4Q9HA 2E5LB 1XZDA 3HB5X 3PA6A 3ZGZA 2CDAA 5E7JA 3X1DA 4ENQA 1NRIA 1YT5A 2BFPA 2GZSA 2KS6A 2AJLI 2WAAA 4K6GA 1KE1A 4GSLA 4KN6A 4OHFA 1Z7EA 5DK6A 2PUCA 3LIPA 4P4LA 2A9OA 1LDEA 4GZLA 1D2GA 3T94A 1BJRE 3OKCA 3DC2A 3AI2A 4BNWA 1JIUA 5E0OA 1KMMA 1BXNI 2XMQA 3DJYA 2DFXI 2OCBA 4FP9A 4DREA 5JC1A 1P4HA 1KO7A 3MRTA 2MSCB 3KEFA 3OLVA 3ZV6A 3X2EA 4AY6A 3KWFA 3V1NA 3H1BA 1E9AA 3FVVA 4D4LA 5BWMA 4MUMA 4XWAA 1A27A 2CLIB 2IU4A 3O47A 3GFOA 2GYWA 2X77A 4NG5A 3PVSA 3SC6A 1L1EA 5AUQA 3BFVA 3I28A 1CUFA 4S1WA 4BWYA 3AR7A 2OB2A 4WECA 4H7IA 4MGHA 5T4HA 4JBGA 1UJ4A 3K0HA 3BG5A 3LY7A 2IYZA 3K1ZA 2KW5A 5ANRB 4XFJA 1KR2A 1W48A 3KU4A 4MUFA 2AW5A 1I5EA 4TTAA 3PGA1 5CM8B 4ZXFA 4FXOA 421PA 5ALVA 3VTZA 5AW3A 1Z6QA 3MYRA 5DEIA 4YMSA 4MCHA 3GT0A 5DEOA 3EQ7A 3EZ6A 4OG2A 5ALDA 2ZYGA 1KE2A 4TVSA 2HF8A 4I46A 1O08A 3FPFA 5DTQA 1WMBA 3RNLA 4P4GA 5EGSA 5EKUA 1Q21A 1Z33A 3OQ1A 4ZGBA 5BRAA 3I2JA 3LP5A 3HPQA 4Y6PA 4D7AA 4WACA 5AESA 3GK3A 2WWHA 2P9QA 1J22A 1O54A 5JY1A 1OV4A 4RZ3A 2QLJA 4U2KA 1XU7A 1ZDMA 1GNSA 2HK7A 3Q7PA 4J1QA 1JEEA 3HBJA 3OPYA 2DECA 4EHFA 4DR5B 1JE0A 3DTVD 2VDLB 3ADCA 4ENWA 2UV8A 1S0UA 5FT9A 3TMKA 2VJAA 3H9QA 4D5EA 3K0FA 2DHQA 4C4AA 4TUYB 4OHKA 2ZBGA 3WB2A 3L01A 4CE6A 3C16C 2B1IA 4XWKA 1PU2A 5K8IA 2GPWA 5BMVF 2R1ZA 2ZYRA 4F4JA 4XFKA 2Z4RA 3LYUA 4P92A 1CD5A 4IDFA 4INAA 3K0CC 1EFUA 1V9LA 2VBFA 3HE3A 1NN5A 1N2CB 2IGBA 1M1YB 3G2NA 3U4IA 4HQ6A 5CT9A 4LV5B 1JPVA 1Z26A 2WU4A 3QA9A 4M9SA 4U0JA 5AJTA 5EFZA 2IXFA 4R01A 3T7AA 2WTUA 5L7YA 2ZU6A 3ZEIA 2V69I 1TW3A 2CVPA 1BXRB 1FZTA 4O4JF 4OYYA 2BWJA 4X7PA 3DMTC 5KTYA 3PA8A 4BMNA 3L2OB 2I6FA 1WLSA 5L8VA 2JIQA 5LOVF 1FRQA 3DMDA 4AG5A 1N3BA 2UKDA 3GX1A 4FOSA 2HPZA 2KBEA 3LMKA 4FFMA 4MJ7A 3HDQA 3OIVA 5LDDC 5CEEA 4B3IA 4HAVA 2HF9A 3GJRA 1RJWA 4X7MA 3RVQA 2IUYA 3M6VA 1ADBA 3ZC3A 2Q4OA 1K75A 2ADOA 2BEUA 1YJQA 1UADA 3OEYA 3RRBA 2FPIA 3OCYA 4N82A 2O8VA 3FSJX 3GRZA 4Q02A 3DDUA 3OZVA 2NQ2C 2WTXA 1M1YE 1UJ6A 2VK4A 3OE1A 4C7BA 1QGUB 2OFFA 4DIEA 3V34A 2PMKA 4TTRA 3PL5A 2XOKA 2WW8A 3CZ5A 5BVGB 1LX6A 1HLFA 2EU8A 2M1ZA 3A2NA 3FCOA 3TCKA 2NU9A 3DZIA 3SPXA 3IUBA 1IAQA 4YJGA 1WETA 1PVDA 2YNMD 4YJ3A 1GQFA 4F2WA 3IPCA 4X1KA 4QFMA 1EKXA 1F4VA 4IEIA 3N6XA 5DI9A 5TS3A 1WV1A 4L5BA 2C9CA 1YR2A 3SX4A 3C4VA 4R2KA 4U7PB 4WOBA 2H54A 2Q4DA 5LKAA 1OT5A 2Q3HA 3PFGA 3R3UA 3T38A 3EXIB 4GU5A 1CVIA 4BB0A 2VJKA 1T2NA 1R66A 5IM5A 4G09A 4D9FA 1JEJA 1S8OA 3HCDA 4FFBA 3HCBA 4TLMB 5DLYA 5ERXA 5DTEA 1NQUA 4BQEA 3CO0S 5JAHA 4P7JA 1XRQA 1NI3A 2WILA 2G7MC 1QQ6A 1QFXA 1QHNA 3D7RA 3GJ7A 2ECKA 1HX7A 4A10A 4NK5A 1ML4A 4AL4A 1B4DA 1GCOA 3NHYA 4AW9A 3DL2A 4ND6A 3VR4H 5CAEA 1KI6A 4L8VA 1QO0A 1WHTA 4EY7A 1YOBA 3U31A 2X3YA 5CR9A 1X80B 1E7MA 1XEWX 1Z29A 1L4BA 1ONOA 1TVMA 2SICE 3LQRA 5D8DA 1B6RA 1FP2A 5G0TA 4EHIA 1E2FA 2J7KA 3E7XA 4HS9A 3ZI7A 1C1HA 4EG7A 3ASVA 2YMQA 4AZ3A 3A1FA 1N9ZA 1K97A 3MMPA 3ITNA 3P9IA 2OPHA 4TMFA 3PNLA 4A8JC 3WOHA 1KRXA 3JQEA 5E9JA 3NGMA 1ZIPA 2BKEA 5IAAA 1JLKA 5I5EA 1P2TA 3HJHA 3P9YA 4MHOA 4HFNA 3A6ZA 4H0CA 2YHIA 2G70A 5FL3A 5L4LA 5J2TF 1SK9A 1Y1KE 4C7MA 1GCUA 1DKQA 2DEUA 4XW2A 1XZLA 3CVUA 3P96A 4OB7A 1RLDS 3FYTA 3G8BA 1GSIA 1DC8A 2PJRA 4FONA 4XLTA 3QI2A 4Z2AA 3IDQA 1GUBA 3VVLA 3ICQB 8ATCA 2DP4E 2W6JD 1M6VB 2CT8A 3KOYA 3CKLA 4G4IA 1CJKC 1WDLA 4WZBB 2XCOA 2XMGA 2X1HA 2W98A 1W94A 2VSOA 4KWHA 5FR1A 5FOTA 3RVLA 5EEGA 1AU9A 1O4VA 3CUKA 4P2BA 4QRDA 4EMUA 2B99A 2A4KA 2XLCA 3QLEA 2W4QA 4CKYA 1JILA 3JX9A 5FADA 5IULC 2JFWA 4YRFA 1OXUA 5LJLA 1SCQA 2WFMA 3CPEA 3Q7RA 5BR1A 4OATA 2FW6A 1WXXA 4YJKA 4M7WA 2HIMA 4IOMA 4YAWA 2MDTA 3U81A 2R751 4DLRA 2CL5A 5H8WA 3GEHA 3TRIA 3H17A 4JDUA 3AEUA 3OLWA 4BO1A 5B3LA 4HWKA 4I4LA 1NN3A 1H8HD 5K05A 3GPIA 2PKXA 3E4CA 4PX3A 3U16A 2OBLA 1GGJA 1J25A 3I23A 1NXXA 1UIMA 4MIKA 2YRWA 1KMIY 3VI4B 3K0SA 4AI6A 4D3DA 1KDPA 5K09A 4G5HA 1J8VA 1J06A 3H19A 3EVEA 1MFZA 3PF8A 1LBIA 1SGWA 4IHQA 4N41A 2CZGA 1U3DA 4IINA 1B0UA 4O4HF 3C8MA 5EUCA 4O5OA 4EB8A 1DIGA 1Z8NA 4N0MA 2ZQYA 3T0IA 1W36B 2X5XA 2NYUA 3GNQA 4DXAA 3JQ9C 1MJHA 3VR3A 1ZO8A 3JAKA 4HDCA 1LTQA 2HDHA 3FMGA 3W6PA 1ZS9A 2PJZA 2PSDA 4TL9A 4V2UA 4WK2B 1PVVA 2HGZA 3SSOA 3VISA 4DLUA 2JBAA 1U9YA 3GAFA 5ALYA 5AUOB 2WWYA 5FB3A 5HXAA 3LXMA 4ERNA 2VTEA 5DK4A 5B1SA 3USZA 1TO1E 4LMRA 1XTPA 2XQKA 5CYOA 5KDOA 5EAIA 4YA6A 5B64A 2QJTA 2ZVQX 2ANCA 1MJ5A 1XCGB 4REMA 4FKBA 3VR5A 3IVCA 4V1CB 2UVDA 2K6GA 1E5QA 4C4OA 3S1LA 2B5OA 1P62B 3KPUA 2R4QA 4WXRA 5EG5A 2N1MA 2W2LD 3FWKA 1PN3A 3KNZA 1LDMA 3W5UA 4ZYLA 2XTZA 3D6MA 5AI9A 5B3KA 4XWYA 5KX5B 3NALA 5GQSA 1BJTA 5CURA 4W1SA 5P8WA 3T4PA 4GH5A 1JZSA 2Q5JA 3G1TA 4S3MA 4DMUB 1B8OA 1Q0HA 1H8HA 2A9KA 5M5BA 3K09C 1QU3A 3PPXA 1KDVA 1I7SB 2WPDD 1V47A 1VL8A 3AHFA 3QU7A 2QUIA 1SKYE 4JU8A 1YQQA 2YZ2A 3H97A 3M83A 3OD5A 2BGLA 4BATA 1P5JA 4ICIA 4BMXA 3NBYC 4C0AC 2XYPA 4CTKA 1Y1LA 1JV2B 2YFYA 3GVCA 3V1LA 3S1AA 4D4JA 1NWHA 3GP8A 3H2IA 4B6SA 3OE7D 4F0JA 1D4OA 3CTMA 4BLVA 4OSOA 2BHSA 1V95A 3S1SA 2C7PA 3RVPA 2FB9A 1P4JA 2FG5A 2JCVA 4Y3UA 3C1AA 4ZGGA 1X1RA 3IAXA 1F3LA 1ACLA 4Z3DA 4PG7A 3EA5A 1P73A 5I6DA 3RH0A 3AR6A 3D8SA 5BWLA 3WGIA 4I14A 2GD0A 3EAFA 4WJZA 5A04A 2HPAA 5IUJC 3RD5A 4R1OA 1JJAA 4GQIA 2ESRA 4J4HA 1X7WB 4RK6A 4RH0A 2I6GA 4LX8A 2YRXA 1VTKA 4UEJA 3WGHA 2ZTUA 1QFSA 1MRNA 2WJ4A 3F97A 4IUBS 4W9NA 4ZRDA 3VR5D 3PQ7A 4ADSG 1NATA 1QHFA 4JUAA 4OM8A 4CG1A 1ZVJA 1V96A 2ET6A 1WPXA 3O75A 3G5TA 1LPNA 2R85A 3DJFA 1N5MA 2ZVJA 2P6OA 3UKDA 1ZMRA 4EG5A 1C1DA 4DJDC 3U09A 4UEKA 2P77A 2QTGA 1GVNB 2JAUA 4JLMA 3E5NA 3TOZA 3E3AA 2W5UA 4MV1A 5J5CA 3VNRA 4ITUA 2B1JA 3FCXA 2Q1UA 4F21A 1WSWA 1V37A 4JFRA 3ZD6A 1RI1A 4LXXA 2HIHA 1PNQA 3C8ZA 1Y7IA 2H29A 3EZNA 1FMLA 3CZAA 3NCHA 4N0QA 5IM4F 4NONA 2X6QA 3C5CA 1GO2A 2C1ZA 2VUIB 3HVHA 4R9VA 3RK0A 1X70A 1G3RA 4TX1A 3LPAA 3GROA 2XNDD 3NW9A 2DR3A 2IYFA 1RLMA 1RZUA 2AG1A 4O4HA 4UE6A 2BFFB 4DNOA 1J2UA 1SO8A 2ZQZA 5J43A 4FJ1A 2QL6A 1WSAA 2Q6LA 4DQUA 5ALXA 3OPXA 1SIOA 4MDEA 1T0BA 2CL7X 3QU2A 1XI2A 3F90A 4RF5A 1H9AA 2BFEA 5BOSA 1XRSB 3QBVA 1VLLA 4CMIB 4AJ4A 3ZOZA 3LUDA 2Z6AA 1MX5A 1UPBA 2A33A 3PHCA 2Z6VA 3PDJA 4MKZA 1EQUA 5DYYA 2O2GA 4NBTA 2AT1A 4WIAA 1TVKB 3WFJA 4G01B 3FFAA 5ALOA 3STWA 1J5XA 1G7SA 5KNLA 1KXZA 2Z6QA 1E6WA 2BBSA 1DC5A 1WVMA 2O0JA 2O8NA 2WF7A 3BK1A 3FKSD 1YOVB 2A7QA 3DKKA 3G82C 4JQOA 3VO9A 4N1AA 1AKQA 4HAXA 5DCLA 4N01A 1NVKA 5AWFC 1I3MA 1KFEB 3DA8A 5FI5A 1Y48E 4P53A 4QODA 3AVOA 4DT1A 1ZK1A 3NDIA 4E5NA 1U0GA 3D8NA 3HYCA 1P4SA 2NUTA 3L7YA 3PUYA 2ZIUB 3A0UA 1S9HA 4HQOA 2AX3A 4M0LA 2VZEA 3JAMA 1TO2E 1S3SA 5BRNA 1N4AA 4CNQA 3WLJA 4DDWA 3U3KA 2BR3A 2Q27A 1LFAA 5F4ZA 1CUXA 3SKVA 1SCUB 1RJGA 1YL6A 4N8DA 3A9VA 3U4GA 1LPPA 2G5PA 4GLLA 4LC1A 4RXUA 4KE9A 4ZAYA 2JIRA 4B6GA 3JRNA 1Y6RA 4KAXA 5JATA 3P20A 4S2EA 4MRMB 1LLFA 2W6QA 2J0SA 1DBVO 1MHPA 2PZ8A 1FFXA 4IO1A 4H4CA 3T7IA 1XROA 2PYDA 4FD3A 4CHGA 4D0SA 1KAHA 3E6AA 2QYHA 1KFCB 1MO3A 4OPMA 1Q0LA 4H18A 5TQ2A 2DM6A 1RNLA 3I3SR 3DUWA 5A4DA 1GP2A 1C0PA 1GKKA 4G8DA 3M6AA 2D0IA 1XHLA 2GJ4A 4CV3A 1JEYA 1ISHA 1Q2XA 2R5FA 1VP9A 3B89A 5EWLB 3UUWA 5EWJB 2OHXA 4D98A 4HB4A 1SQ6A 2VSYA 4TTQA 1K06A 3K6SB 1LK0A 4WQMA 1NJ1A 3I5YA 4UTNA 1G20E 1EDOA 1GTJ1 3DD5A 4TT8A 1U2EA 1GKYA 3DT9A 4ZVRA 3ZYZA 1E9DA 2C58A 1EFRA 4DLWA 4PCVA 5C7YA 5JMTA 3AESA 1ZK3A 3LC7O 3WB1A 4NK4A 5I8WA 4IPTA 5TSDA 2O8CA 4INPA 5IW8A 3DLAA 1DWOA 2OO3A 1CZHA 4IHJA 3BCUA 2H9AA 1WW3A 4D5GA 1G8PA 2JJMA 3HWRA 2QK4A 1KO1A 1L2TA 2IHUA 5A5VA 1Z5VA 4WADA 3MG9A 2GEUA 1DNPA 4LYGA 3RFFA 3UMSA 3G8YA 3VPGA 5FOSA 3ZTYA 3NUQA 3GP5A 3PYXA 3WRXA 5K3EA 1DCTA 4WSOA 5AKJA 1CNMA 1CRLA 2IU6A 3LDUA 4HL6A 5ALFA 1FLAA 3O3OB 3R3VA 2E5FA 4E5PA 2ZJ7A 1LUAA 2QBYA 4MV0A 2XE7A 4Q1VA 2RGUA 2ZIXA 2QYTA 1DOHA 4KLAA 1ZQ9A 2H2FA 4CR8A 3GNTA 1B8PA 4DRYA 4G81A 2NTJA 2W2VA 3HP4A 4OMDA 2FZVA 1XMOB 1C0IA 1T9ZA 5EE5B 1JLMA 1JHYA 4ZU1X 3LG2A 2VJLA 4UFOA 2IVZA 5C4IA 4JP5A 1UMBA 2YICA 2XRYA 4KDRA 2H4ZA 1ZR2A 1SOAA 4MB0A 1U5BB 2EX0A 2ZDGA 4RPIA 3IT2A 5ECGC 1I33A 3MAGA 4X1YB 5CTAA 4X97A 3RKSA 3L4BC 4ZVSA 2AN4A 1FRZA 3ESBA 1I13A 3I2KA 5FO0A 4HFRA 1L4MA 3F46A 3AQIA 1GARA 1RBQA 4TV9A 1U1FA 5KVCA 1AUXA 4UUNA 1JN0A 3ETHA 2IS4A 2P9HA 1U0SY 1RBOC 3DEAA 3F5QA 3HJRA 4HGOA 3H4TA 5D3KA 4O6VA 5LBIA 3UXHA 3VUEA 2GN0A 4JQZA 3WGTA 5JE8A 1Z34A 3CRQA 2H6EA 2XRFA 2ZRNA 3QF4A 2B0JA 3ACBA 5CT6A 4DWVA 5BURA 1PJRA 2DFVA 2PD4A 1AGRA 3ORQA 2Q6IA 5ER6A 1QK5A 1UFKA 2V59A 4KFCA 4NCHA 4CF7A 4EQZA 2COUA 2GFQA 4INZA 3ONDA 1KPIA 2YWGA 4OP1A 3TSZA 2YY5A 5BW6B 1P75A 3I42A 5A9TA 3LUAA 2K7FA 1TCBA 4ZA2A 3VC2A 2OHHA 1XK7A 4Y6LA 1F1BA 4CMHA 1G5TA 1OIVA 1A7UA 2X7HA 4NJEA 4ZRNA 1S1CA 1AQYA 5EJIA 2I2FA 3GN1A 3A4NA 3MXOA 4UULA 3L7DA 4HQ0A 3ZWMA 4KQGA 4LJ5A 2ZUEA 4XCQA 5ICEA 5REQA 1YB5A 1K0UA 2IZ5A 1R0BA 1SVUA 3GRVA 4R05A 3WGLA 2FJ0A 1KWKA 2E7ZA 3H13A 4TLEA 1GZSA 4BRSA 4FDLA 3GELA 4LF9B 4J2TA 4BVKA 2D1TA 1DE0A 3JU3A 1NUQA 3OE7A 3EIXA 3QEMA 1A2OA 3FPEA 1WXIA 4P54A 3LW8A 4HDMA 4BNKA 2Q2OA 3VBEA 4MUIA 2XH8A 2FGKA 1LPMA 3O91A 1TD9A 2J9YB 1FBNA 1KXJA 3CLUC 3E35A 2JI6A 3AMVA 4UU0A 2ZRIA 4EPVA 2NACA 4LRWA 3GJSA 1U0EA 2J87A 1MOSA 2DE0X 5A7GA 5K8LA 3W9SA 3N05A 1VG8A 2HEIA 1W96A 2HDOA 1JQBA 1R0SA 3EIFA 1N0WA 1CUIA 3D0QA 3EC1A 2F2TA 4RV9A 3RSOA 2VJQA 4CMAA 4RUBS 2OV3A 4BGEA 1NT2A 4C0KA 4MS1B 1VSBA 3L1HA 1B0ZA 4IIEA 2JHCA 1XZJA 1JA1A 2PVPA 4P7KA 3AERB 3AI3A 3HC7A 3PKJA 1YRWA 4ZIRA 4FSXA 1D1QA 3OLZA 1NYQA 1PTJA 4EPXA 4TQGA 1ITZA 5CLGA 1MIOA 1Y3IA 2CMKA 1F20A 1T3SA 1W8DA 4UNRA 4L4SA 2HSGA 3EXHA 3DAFA 5DLPA 3EIUA 1MABB 2HXSA 3D6AA 3HFRA 3WDLA 4L7QA 5YASA 1XYVA 4F3KA 3O4HA 4M60A 2PPVA 2BGMA 4LJ8A 4TOIA 3F6BX 4NR0A 1N33B 3P0RA 4MUXA 3SHQA 4K46A 4TKLA 2BLLA 5TEWA 4JY7A 5ALNA 3FMOB 5KYNA 1XZGA 1KEWA 2IQ5A 4KXLA 3DL0A 3OA2A 3QIAA 3STYA 3UMJA 2DTEA 4P82A 2H5EA 3UB3A 4DMKA 4NHEA 5FBHA 2HNBA 5TF0A 4FEEA 3TLKA 4DJFC 5ARBA 4LSMA 4XA8A 2WPDA 4G97A 4OFXA 2WUDA 3CRVA 3PQ6A 3HCFA 2ZGVA 5B1YA 5B1EA 3ZBUA 4L5IA 1SHKA 2XWBF 3KJHA 3E7DA 1I7DA 4DRZA 1PGQA 3V48A 2O7VA 2OGZA 4S0ZA 1FY2A 1NBMD 2RHOA 5F2OA 2ZZMA 1K7CA 3KSAC 1NW4A 2HTEA 2JVKA 1CY1A 5LDGA 1R0WA 1N7IA 2G25A 2CNOA 2JGMA 1XWWA 5F78A 4BNTA 1C4WA 2XZOA 3HHPA 4B80A 1T0UA 1ZIDA 2BJWA 1A9SA 3HCOA 1FX0B 4DIBA 3DEKA 1JR2A 1R0LA 3B3JA 2KQUA 5FTMA 3ZDAA 4RWZA 1WTAA 3JPYA 3AOGA 1IY1A 1C0LA 5GMOA 2AXPA 5JISA 1P0FA 2QJOA 3ISJA 4ENRA 4LYAA 3UO8B 5FV7A 3V55A 1TGVA 3LCJA 1L8XA 2LWIA 4HPJB 3F3KA 4LISA 3ZXSA 2HRDA 2QDKA 2JIOA 3DO5A 1PSZA 2RBEA 2NZUG 2PH1A 4UATA 1O1YA 4RA9B 2CFTA 4MWOA 1FXWF 1J20A 2FEKA 2R84A 3AR2A 3ILSA 4WFKA 4F6RB 5C8YB 5JLJA 1TM3E 1KH3A 1SCJA 1ZD2P 1E0KA 4QLAA 2FEOA 3TSWA 1NKTA 5KNBD 4FE7A 1Z45A 1R15A 5LYJA 4R40A 2QN8A 4BGIA 3I04A 3QPAA 1RM0A 5B57C 5JTUA 3WMXA 1PKEA 1OX4A 3RUBS 1GAJA 2WIFA 1CZUA 3HABA 5LB4A 2G83A 4XTRA 2QIOA 3IOMA 1AT1A 1QYVA 1JKIA 3C7CB 4ZZIA 4ZAFA 1DADA 4I1SA 4K1XA 2OOKA 4YP0A 4EIWA 4GPEA 3FSGD 3I9KA 1RJDA 3C15C 4NNJA 1I2DA 4F96A 3IUYA 2XBMA 4ND1A 2ERXA 3ANLA 4YAEA 1ESDA 1UXKA 3HGTA 2C95A 2CBGA 5A1TA 1NPYA 1VCIA 3USES 4MYHA 1NBEA 2PXCA 3FLEA 4H7EA 4EUHA 5FI3A 3IVXA 2QQGA 4HKTA 1RQPA 1UDRA 2Z1NA 4HUQA 1FC0A 2GASA 2RIPA 1TA4A 3NHLA 3CB4A 1P74A 3QITA 3JVEA 3VKHA 2CNLA 2VA9A 3FVRA 5IEJA 1SIWA 1Y9ZA 4GXQA 4KYVA 3BD9A 3AL3A 2VAMA 3I1JA 3ZHZA 4R4JA 2VOEA 4HDKA 3U3DA 1TJNA 4F5WA 4EPRA 3NEYA 1WCV1 4IQ0A 4REQB 4MO2A 4LKOA 2I2DA 1UIRA 3E8XA 3LC2O 2X9QA 3THXA 4HUQB 3UMYA 2VPWA 4HV4A 4F2PA 1QCDA 2X4DA 2BZSA 4F12A 4ZMSA 4E30A 4W5HA 4EYQA 2XKKA 5IG2A 4HDRA 3OQNA 2VXYA 1B0PA 1LLCA 4IICA 4Q7LA 2H16A 4BKMA 4LPKA 2J67A 1Q19A 1RHKA 3D2BA 3SF8B 4AECA 4B17A 2HYDA 1T6ZA 2XUAA 5HPYB 5KX5A 1WCYA 4HNVA 1CQJB 4KPFC 2DMRA 2JJ2D 2P0AA 3B51X 3FZQA 1XMSA 3QFCA 3R76A 3H84A 1M8JA 1OXVA 5T3UA 2QMHA 4X6UA 1X15A 1DAGA 4W7IA 2PUEA 5CT4A 5IJZA 4LCBA 4LFCB 1NW5A 2GDZA 4KZKA 5E9QA 1IONA 4BDTA 4NZPA 1X8LA 1YBMA 2Q3CA 1Q0ZA 3QVMA 1XF9A 5CDSA 1VRVA 2OD2A 3HJUA 4UHBA 5TGDA 1X1CA 2WD7B 3DDSA 3TOSA 1XA4A 1TMOA 3GUVA 3WV5A 3DHVA 4BEJA 1P8AA 1Z2OX 1TQHA 2IPNA 1YHYA 1PNVA 3NOOA 4LQLA 2FX3A 3RS5A 4YRSA 4U6QA 4N8SA 1EINA 1XMQB 2FF5A 3GLHB 4H2DA 3A9CA 4WXPA 1SXJE 4UUAA 1GNPA 1KS2A 1LRKA 4JITA 3BBPA 2J59A 1W0KA 3CNBA 3FR7A 3HFGA 4LWOA 4OHCA 5DM0A 1ODSA 4PGHA 1JPUA 1INLA 2X2EA 1NR5A 1RM3A 1PFKA 1IOWA 2OGWA 3G3EA 2IV2X 4ANFA 2R96A 4OTZA 4XYGA 2AOTB 2FW8A 2VG8A 1RC1A 2EVWX 1PR3A 3DXXA 2ZW9A 1Y9EA 2HT6A 3PNQA 4WCVA 5GIPE 1Q95A 3RWOA 1HXHA 4NS1A 4MI3A 4GDMA 3VKWA 2A6PA 1KBOA 2QZSA 3NP9A 1CY0A 3IT3A 3L40A 1EP1B 3QNUA 3SJUA 1V8DA 4ZVPA 5KYVA 3SYTA 3ZBTA 4PIPA 3WAKA 3N07A 1SBTA 4KV9A 4QBHA 2V97A 1X14A 2F8LA 2XDQA 2YV3A 1EIWA 2VP0A 1L7DA 1XMIA 2VDRB 1GG5A 2Y8EA 2A30A 2ZYAA 4R8LA 3GLQA 4PC1A 2D5IA 1F0PA 4PCAA 1C9DB 1M8FA 1EWQA 1PAUA 1CJBA 5TV2A 4E31A 4F04A 4WX2B 1YJCA 2QR3A 1R88A 2BCEA 1DXHA 3E9DA 1YFKA 4IWNA 3ZU6A 2AMFA 3AI1A 1EE1A 3T1OA 2PSHA 4I99A 3UNXA 4ZVTA 3PRJA 3HP7A 3PTAA 1QTRA 5GVRA 3MFYA 4XM2A 1ZH0A 3WQHA 2EEPA 2X86A 4D9HA 1JDUA 3DHWC 4J6FA 3P0HA 3ESZA 2IYQA 5BO5A 1VMAA 3K0KA 5AVOA 1IN6A 3ITEA 3MTDA 3VXKA 2W2MA 3SG0A 2OOSA 3D3WB 4UUOA 5I48A 3D3NA 1AA6A 3O8QB 1MFPA 2WV9A 3NBUA 3P2OA 3DEHA 5LC1A 4DA9A 4XYLA 4YRNA 2UAGA 3IALA 1OREA 2FN7A 1PT8A 1H3FA 2X3FA 4RD4A 2VT7A 2ILVA 1H5UA 3PS9A 5TJ9A 1KJWA 5C32A 3EVGA 2WUFA 5AXCA 4A4DA 3W4KA 4PTZA 4TSKA 3PXXA 3AB8A 4PX9A 2XB4A 3EXHC 3PTZA 3P9ZA 5EIFA 2CDBA 3K31A 4OQLA 5G4LA 1CEXA 4RNDB 1WSDA 1Y3HA 1FDTA 1MRZA 1NDHA 1WXFA 3CIFA 4G41A 5GV8A 2HLDD 1WZNA 1FYXA 3DZKA 4OQDA 4GMKA 4U9IS 3R74A 2OK7A 4B76A 2ZCUA 1BWSA 1S2MA 1Y3CE 4BGUA 5G40A 5CB6A 3CW8X 4PYNA 2HA5A 4N7JA 3ZOKA 2CE2X 3IMCA 4FXPA 1L5KA 3V4OA 5IHPA 1FPQA 3Q8LA 1CLEA 3H1AA 1VDMA 3A4MA 1XRLA 3JRXA 1CHDA 2QZZA 3R0JA 2PWYA 3SQMA 2PY6A 2VP2A 3ICPA 1SBYA 3I45A 3O9ZA 5JD6A 1R4AA 4Z4EA 3KSUA 4P93A 2R8YA 3BH6A 3KR1A 5LMCA 5DNYB 1OZFA 4RY9A 4WFIA 3KKPA 1QWSA 2WE8A 3H5AA 4JGIA 1N3YA 2YNMA 3A26A 3KHKA 4NE2A 3U6KA 3JALA 5AKHA 1XRPA 3TW8B 1J7JA 3ND9A 5AHKA 1K08A 1WZUA 2ACWA 2Q9BA 3BA1A 5IAEA 2QMQA 4QBIA 1WDWB 3WMGA 4PVDA 2V03A 1W5FA 1HLGA 4MO9A 1RAGA 1ISGA 1TU3A 1Y9DA 5LR6A 4JLDA 2NIPA 3PIDA 1HRKA 5LP6F 3H1GA 4PYIA 5EHGA 4V0RA 1AD2A 1YJ5A 4QPNA 1ACMA 4JXKA 1G2QA 2IT1A 4KXWA 5JI3E 3AFGA 1KVRA 5CB4B 5IT5A 1QCZA 1SR8A 3IV6A 3MJSA 4OBBA 3UWDA 5CRIA 3NWOA 1ULBA 5JZMA 2L19A 2I7CA 1ZJZA 2ONYA 3V46A 4QJ4A 1RC0A 1YQWA 1T3GA 4N0EA 5ER9A 3BJIC 2CGEA 1C7IA 4BEVA 1NW7A 1B8UA 4XB1A 1VA4A 3IBGA 1SOVA 1L8LA 1RYFA 5C31A 1YE3A 2C4VA 5GP1A 4DA8A 1OXSC 2Y4OA 3H1TA 3P9KA 3PD0A 3F7NA 4DDTA 5BQFA 3EX7C 4EQ6B 5F9HA 3IUMA 2IEDA 4IX9A 1OX6A 2P35A 1OJLA 1XJWA 2Q3MA 1A8IA 3WL7A 4KXQA 3JQBC 3TUIC 3U26A 4LXUA 4I5GA 1T36A 4FHDA 5ESXA 2XB2A 3KC2A 4JL6A 2ORIA 3J81A 2JGIA 2RAPA 3ZKWB 2B83A 4AFNA 2BEVB 2DUUA 1V1RB 4YS6A 3UY4A 4MJ3A 1XE3A 2BHLA 4B3CA 1V9SA 2BM9A 1QTNA 4IGEA 2Y66A 3HYTA 1RT9A 3PNVA 3UG6A 1GYRA 4DCPA 1IR1S 2XDAA 1QZ3A 1TYBE 1FP1D 3NIGB 4WD3A 1F0KA 3EZFA 3OPVA 2Q9CA 4DZZA 2E55A 1QIHA 3QG5A 4DYHA 4GVLA 3ET5A 1FJHA 1ULTA 1CUYA 3KFVA 4CKCB 1KI7A 4JYPA 5HFNA 1PSDA 2CXOA 3JW8A 4R1MA 4WKOA 5IC5A 2GLUA 3UF0A 2CE7A 4DIKA 4XDYA 2VRWA 4L1KA 1XCMA 5JFOA 3LHKA 3EXG2 4Y1RB 2CSXA 1G6Q1 3MOIA 5ALTA 4JI3B 5A5EA 5GAJA 2QRKA 4G86A 3NOXA 3VOSA 3W5SA 1SEPA 3M5PA 2AVDA 2Z8XA 5CW1A 2PJUA 2LCQA 3SVLA 2JB9A 4ESEA 1RACA 1X3LA 2PL3A 3D3EA 1Z13A 4HVLA 3TLCA 3KTOA 3DL4A 3R7AA 4BFTA 4FN5A 1HT3A 5I5GA 5AW6A 4QQ8A 2EW1A 3C5HA 3IR5A 3DBRB 5B4UA 1D4FA 2A94A 2P2LA 4IYJA 4TYQA 4ZTBA 4DR3B 1IJFA 3W2GA 3MUNA 2OSVA 1ZRSA 2YX1A 2YDYA 5I7OA 3AKEA 4AS3A 4NMWA 4CMIA 2FWMX 4QWMA 4YO7A 1NG9A 1XZAA 3Q88A 3IE1A 1YRYE 1VFPA 4MW5A 4NFHA 2ZTHA 2X13A 3FDJA 3R0IA 4G0ZA 3FMVA 4CF6A 3WYDA 1YIAA 1AF4A 3Q8WA 4RE6A 5LOVA 4FUQA 1Z4JA 3Q2OA 1LBSA 1W0JD 2MHCA 2V9PA 2VP9A 2WA1A 3DLTA 3LUHA 5LN1A 3KZNA 2YN2A 4MA4A 4Q1BA 5FLYA 2G1PA 4TXJA 2FP3A 1KC3A 1SCUA 5JSFA 3QSGA 4LRQA 1UZUA 3IESA 4PSDA 2FKAA 1GPKA 1EGQA 1JJIA 4I2VA 2PCLA 1BWQA 4WE3A 4B3FX 5ELXA 4FI3C 3L1VA 1FE8A 1LQUA 4Q9LA 3R5KA 4WY2A 3E9RA 3ETLA 4KZPA 1BMDA 2H18A 3LRXA 1GXSA 2IK8A 4L6CA 4TRMA 4D1YA 3RUEA 5KTKA 2AW3A 4YWHA 1SPBS 1H1LB 3T3HA 4WLFA 4ZAXA 3TLYA 1P2DA 4GD3Q 3DFIA 2DH5A 3IAEA 1CRWG 1T8YA 1ZOPA 4JP8A 3NWEA 4J7XA 3S8MA 2Q3BA 1O0SA 3AINA 1JQ5A 2FZ5A 1KY5A 5ES4B 3TLGA 1WULS 3P2MA 1BE1A 3AYZB 3FWNA 1G17A 1H6BA 1HWYA 2QT9A 4PC6A 1YDFA 1TYDE 1NJFA 3WLMA 4YX9A 5LWHA 3J80A 5ERGB 3C3BA 2JGKA 3HFSA 4M1KA 4N5MA 4RJKA 4WCFA 1JNYA 1MG5A 2CJFA 2I4TA 3AC0A 4WLVA 1ESCA 4GI7A 5TEVA 3CO5A 3VNSA 1OBFO 3QX7A 2ZRCA 1EHIA 1C81A 1R4MB 1VZ2A 4HDSA 3AL0C 3GEMA 5I4IA 3KETA 2VJPA 1C41A 2Q5IA 4KH0A 5F9MA 5FWXB 4PZ0A 3HB4X 3KYCB 4TWIA 3ELBA 2E0IA 3WGQA 5TMPA 2QGFA 4BNLA 2R8PA 4IZHA 5K3CA 2Z0MA 3SGLA 4ZTZB 2MU1A 4WMLA 3W79A 5EPOA 4KVAA 1PDVA 3JQPA 4BQOA 1PJ2A 3QF4B 4UOEA 2CV1A 2LD4A 2QSZA 5C8ZA 2YINC 1IN1A 2IOQA 4UASA 1CY8A 2J0QA 1AKRA 4EHDA 3RVKA 3C7KA 1KMNA 3HDHA 3D5EA 4H3SA 4YY3B 3P0FA 4UM5A 5LYYA 1G55A 2I62A 5DYGA 2X8LA 1MO4A 1OXXK 2CB9A 4ND7A 2IUSA 2APJA 5DHFA 4L27A 1N9GA 3CWZA 1QV9A 1T2CA 3KG2A 4JJ6A 4QBGB 4YJHA 3RVDA 4DV4B 1O77A 5CD9A 2CUKA 3L93A 3HKEB 3KQWA 3NC4A 4JXXA 2UXDB 4B2LA 1ESNA 3TG2A 4L95C 2QMYA 5ENVA 3J7AC 3QOYA 3AXTA 4CZ2A 2H1LA 3GHHA 2X4LA 3HG7A 4D43A 1YE5A 1MORA 3JS5A 3B6ZA 3EYAA 6NULA 3VJRA 2E6KA 3EA4A 2GHIA 3GFTA 4K2AA 3MCTA 4R6WA 3QVUA 4C0BA 4AKGA 3PHIA 4DV0B 2VWGA 4I2NA 3O73A 5SZHB 2WE7A 3QFHA 1YF3A 2HWXA 1BD3A 1QYWA 4OI0A 1UKZA 3GH1A 5IUNC 2DBVO 3KSRA 3N2KA 5AFSA 4H6XA 3A7DA 2TS1A 3QV2A 4IDNA 3S5JA 1V4VA 4KSYA 3PXEA 1Q16A 4R1PA 3BXHA 3FNRA 1PEAA 1Q6ZA 2X7JA 2JEYA 2O3JA 2C92A 1ZLYA 2KE5A 1Y8CA 4GR4A 1CYEA 2Q2NA 2DBQA 4EZIA 4C06A 2FVXA 3SKYA 1R6DA 1SU8A 3ORRA 4BO0A 1A2BA 3DS8A 4C89A 3B3AA 1S4MA 4L51A 4PLPA 1W73A 3T1TA 4BAUA 1E2JA 1D6NA 2YWXA 5FEUA 3JR7A 4ZQHA 1H0RA 1L4NA 2VT6A 3ETJA 3RS8A 1I1HA 2AJBA 2L17A 3ZCVA 5LVAA 3SKXA 1M1XB 5DKFA 3H1FA 4I50A 2LGJA 3R8XA 4L85A 2PKRA 3UAZA 1IZ0A 1NTOA 1T2EA 2P3SA 3BULA 3G2JA 1VHJA 5JCJA 1DKNA 1P9LA 1HDEA 1YJAA 1YUBA 3BSFA 2FKNA 2VUHB 3K09A 3NUGA 4KN5A 2Z58A 3RLFA 5L3SB 2UUBB 3PFHA 5ERYA 2AEEA 1W52X 3OJEA 3GEDA 2MSKA 2UZ3A 3OG9A 1DUIA 1Y8QA 3B8EA 2BI8A 3UXEA 3VHRA 3ZQ4A 4D9EA 4M8LA 5TT1A 7ABPA 1ZK2A 2I87A 1R8JA 4DBZA 4NEGA 4EYOA 1OI4A 3NEJA 4BYGA 4CDNA 4B9AA 3H99A 3B13B 4YI5A 5LZ2A 2F8SA 1KAQA 2V7UA 1U80A 4U7GA 4K9MA 3GJYA 2H0QA 3B3FA 2DJ5A 3HI6A 2P3QA 4MINA 4E3WA 1FDOA 2ODTX 1HDIA 4D9GA 1P2SA 4QDZA 2QVYX 4HGZA 1EVLA 1DO0A 1Q15A 4JYZA 4M0MA 5A0FA 3DE0X 4JI6B 1X1BA 1JLLB 3M89A 4HXGA 3FE2A 5EP4A 3SX0A 3TL2A 4AJIA 2OORC 2OENG 2WTNA 4RVSA 4K81B 1R2QA 1P9WA 2VHTA 1L5GB 3K2EA 4ALIA 1ZN8A 5IYZA 1NL3A 4Y9DA 2D5BA 3LCRA 4TM8A 3DKVA 4MKHA 3GLIB 1T6XA 3FY4A 3CX4A 1I24A 4B0PA 4K6MA 2JIZA 2JVIA 1FUUA 3C7TA 1M2NA 3O8LA 1WHSB 2FX2A 4DRXB 3NIFB 3OPYI 3GT3A 3FCEA 5T64A 5HQTA 2Z95A 3RASA 2WJZB 1DV2A 3ER8A 1JDBC 1PVOA 1UP6A 5KYUA 1AH2A 4GBMA 1UMDA 4Q4JB 2B98A 2HLPA 4WZBE 3TB6A 1FCJA 1ZUWA 4HD8A 3G0DA 4QKQA 2IOFA 1VPEA 3WGMA 3L7NA 5FWDA 4WJLA 4QAJA 4YT4A 5GPBA 2HCTA 3PNKA 5DHQA 2IYOA 4ER3A 1DPGA 4Z51A 2A5LA 2K7ZA 4CFZA 3IAS6 2FA9A 1Y1SA 1H8EA 2DWUA 4HYYA 1XSEA 3SQLA 1NJSA 4W5WA 3GLSA 3RS3A 3AZPA 4PZYA 1VE5A 4J07A 3MT8A 4TL6A 1FP4A 1X1SA 2MYTA 4PRLA 1L4KA 1GZ6A 3BWEA 3BWXA 3DBVO 3PXAA 4MICA 4UHCA 3WV4A 4YRBA 1TTTA 1RRFA 4ZN6A 2D2EA 4IV5A 2WJWA 1RHJA 4YHBA 4NYJR 3N8IA 4EYEA 4MVYA 3WHIA 1MX3A 3SC2B 1QFMA 1VRCA 3CJRA 4DMLA 4C0HA 4GQAA 5T41A 3DOEA 3L92A 4Y67A 5DBEX 2X9NA 3IULA 3R3SA 2ZWMA 3SQNA 5K4AA 4UFPA 4ZDKA 1J0AA 4EENA 4XX0B 3SJZA 1V7ZA 4HO1X 4LCJA 2AZMA 4Y6OA 5CGZA 3LF2A 3AR9A 4LXTA 3A6LA 4LDPA 4UZFA 5AQ1A 1TA9A 4N3CA 4GE0A 4S35A 1GR1A 2PXAA 2Z1DA 3LF1A 5DX1A 1TRKA 2J6BA 2EJTA 1TK3A 4RHUA 4EHLA 4RTPA 3E23A 1G8KA 3CYFA 3L7LA 3O8OA 3WICA 1OH7A 1YTUA 3CEAA 4I4IA 1QHSA 4Z0HO 1VHLA 3O2NA 1QB8A 2ZAIA 5DGHA 2GZ2A 1CG6A 1GGKA 1IDN1 1IK6A 2XI4A 1T1GA 1XXHA 2GN9A 3IA7A 2GVZC 5IJ0A 4E46A 3SICE 3ANYB 3DZDA 3ORYA 1DC6A 5ILGA 4YREA 5TQVA 3AKCA 5F21A 1A97A 5D7BA 4JUCA 4UD6A 1Q7RA 3ZY3A 4OK3A 1IXKA 4S1OA 1HDRA 4OHXA 1FTQA 2C07A 1DU4A 4WKGA 3KXKA 1Z12A 3Q3JB 3AEQB 1FQOA 2P6UA 1XXHB 1L4FA 2R7MA 2VF8A 2X6RA 5F5LA 1D09A 2F3QA 4ZGWA 5K6TA 3T5DA 1O6GA 4R31A 1F12A 1KK3A 3R6GA 1VPDA 1TFRA 3EZLA 3L4JA 3K0BA 5EIOA 3M4NA 2R87A 2BEUB 4TGLA 3V8RA 4BXOA 1M7GA 2W6CX 1I4OA 3GJZA 1ZGJA 4I08A 4J29A 4WH0A 3NHWA 3UWSA 1DKPA 2DFTA 5AVUA 2OO5A 1FMCA 2G67A 2F90A 4EMBA 5JNSA 1E64A 2RI1A 1UBJS 1WBJB 4YP1A 1PK7A 1SUDA 1YCGA 3BB1A 1PEDA 4RD0A 3RYIA 3S6JA 4FK8A 4J0CA 3IEVA 1BRMA 3V1MA 1E1NA 1JSZA 2DYKA 1MB0A 3U44B 3QYJA 3EUAA 4QSHA 3VM6A 1HR0B 2I1WA 1ODIA 3CEHA 1IM8A 2C0QA 3G1WA 1GZUA 5DW3A 5HUQA 1GZHB 3PHHA 1ZNQO 5DNVA 4BC1A 2IGTA 1ZL0A 3NO4A 5JR3A 1PZHA 4RPKA 5CUQA 2NQTA 4DLXA 1GDTA 2WM2A 4LVUA 4BQNA 4KJZA 1CY7A 3W3AD 1I2MA 5G0UA 4BN4A 5H7XA 3HYSA 4N76A 1G8MA 2V7EA 2LKCA 1QANA 4RSHA 3VR4D 1TYCA 3IJ5A 5GZ1A 2QY9A 1D2MA 1UMDB 4RY8A 2ACVA 1HLPA 3I2FA 2YBDA 4M9RA 3QUBA 4N7RA 5EE1A 3THRA 2QLBA 2FP4A 3R7FA 3WSVA 1QTIA 4KFRA 2SKDA 2DHCA 4OX9B 5JD3A 3W2FA 5BW8A 4YV2A 1P7ZA 2PKQP 5AW7A 4MKIA 3RHZA 4DDVA 4IDGA 4CN9A 1K6EA 1QFYA 1TA0A 3BAFA 3GMDA 2GBPA 3ABIA 2IPLA 2RHMA 1X9GA 4J0DA 4GEGA 4QYIA 4R9UC 3AM1A 3KR9A 2JVJA 5KQMA 4FEYA 3TZEA 4GZ5A 1JHDA 1UBLS 3I04M 2B20A 3C7AA 3MJRA 2NXCA 4PXSA 3I9V1 3O4VA 3BRQA 3GUZA 2WB4A 1P6UA 3A8TA 3R7LA 2PX4A 3UVEA 5KTMA 1W6RA 1PBTA 1RE0A 2Q62A 2Q4RA 3ADOA 1XBTA 3OCJA 5GZ3A 5HUHA 3FZYA 2JAOA 2O2SA 3QEBZ 1ZHOA 3IVAA 4ZU6X 3GG2A 4Q3AA 1RKQA 2ZRFA 3K96A 5JEDA 3B1FA 1APBA 2P6RA 4HAOA 1E1RA 3CLTC 5D00A 3WRYA 4Q4HB 4BFZA 3MRXA 2FRDC 1XTJA 5IU6A 2OZKA 2LTAA 1SFRA 4FCTA 3AOEC 2VOJA 3ZHUA 4Z9AA 5JXHA 1WCWA 3GRCA 1P9NA 4G0PA 4L6AA 3LGAA 4QT0A 4ASUD 2RHBA 4O33A 4CM7A 2VRBA 1TLFA 3AG6A 3FDIA 1AS0A 2XOXA 5FPYA 1AVTA 3BWMA 5FORA 3RIXA 2W6ZA 4EA9A 1XNQB 1YKSA 2RAUA 1JP7A 3DONA 4L0CA 4LDRA 3ZWKA 2GXAA 2YBVB 2WT9A 4G65A 3AUFA 4Q4HA 3I01A 1EFDN 4Y2TA 3UENA 3I76A 3VSCA 4RQUA 3WWPA 1CRZA 4RKQA 4JXZA 1H05A 2C42A 2XT0A 3U3MA 4DTCA 5IPFA 5BMOA 3GLIE 2DPMA 4RL6A 1H2ZA 1S5PA 3D1JA 1V11A 2QJRA 1QOPB 5FFMA 5KSZA 3BZUA 3QZUA 3MTQA 2VF7A 4EJSC 4FFNA 2QENA 4IF6A 3SX2A 3JATB 5F52A 1O8CA 3ZE6A 1GJRA 5K8JB 1L7QA 5BSHA 5HOEA 2GBLC 3O2QB 5JFTA 1WU8A 3AEXA 1Y89A 1CC1S 2JFQA 4GDFA 1CR2A 1AV7A 1RJ9A 3RS9A 4H7PA 1SVMA 2IXBA 1EK6A 1YJBA 1JGTA 3LCCA 5DWQA 4BUJA 2XGJA 4JC0A 4PHFA 1BX1A 2IKQA 2YQZA 1IZ8A 3EC2A 5CG2A 2D0DA 1B6GA 2AOWA 2C2MA 2JPDA 5FQOA 1XFAA 3D3WA 3DNMA 1XAIA 3GF4A 1GNRA 1RFLA 3PNOA 4PQEA 3T1NA 1ZI9A 2ZKIA 4EVQA 3I2YX 4OOEA 4PANA 1IRXA 3NVDA 4EVRA 1BGVA 2ODEA 3MGCA 3G68A 4H0NA 1N0UA 1NT4A 4JP1A 3UHAA 5JO0A 1DI0A 4BNFA 2YYZA 1QV6A 4MOWA 4NPHA 4B3SB 4EJ0A 1N78A 1NJ6A 3EW7A 2NUPB 5KOHB 4CEIB 3AP2A 4H31A 3V4FA 3G5MA 3OZ7A 4D3XA 3QEAZ 5KIAA 3UAOA 4QL3A 3GLUA 2WJHA 5FOXA 1UJMA 1V41E 2BSQA 1KTVA 5AUPB 2NUAA 5I7UA 5IXSA 1DCKA 1L4HA 2GKOA 4LJ4A 3RREA 3HJFA 1EE9A 2IUFA 5D2CA 1N92A 4BU0A 3X1WA 1IXZA 3DR5A 3OM8A 4KOAA 3W9BA 4RPHA 4TMVA 1KQGA 4ZJUA 1Z68A 1XCOA 4DHWA 4YUYA 1A9ZA 3FLAA 2VT2A 3EJ6A 3FDZA 5B3JA 3G0IA 1FFCA 2SKEA 3PGXA 5HUJA 4GKJB 4D6YA 1H3EA 3I12A 1Q1ZA 1RU3A 4CIAA 2JGLA 2B34A 1AS2A 2MMGA 4YXWA 3RTCA 1QR2A 2IP2A 4HPWA 4MAFA 1JQDA 1W34A 3TG8A 3Q3IA 2V0GA 3JQFC 4BB6A 4REOA 3N3BC 4LYYA 1EHCA 2XYHA 3SLGA 2OLJA 1RPAA 5HZGA 2ZROA 5F5NA 1X86B 3EEFA 3E9CA 4PG8A 4PHCA 1VECA 2A9PA 2P11A 3OQ6A 5A9SB 4DTIA 1GZDA 1U8UA 3FKJA 3NJ4A 2H08A 3EN0A 4HN9A 5GINE 1X19A 1PEKE 3TTYA 1G20B 4CJXA 5E8RA 4Q3OA 4ZT5A 4E7PA 2D74A 3EXIA 1QG4A 2ODNA 3R3YA 1RAIA 4IFEA 1ZHFA 1PDOA 4IWYA 4K5QA 4FD2A 5AOCA 3ZDQA 3T1YB 3FFWA 4OGGA 3EQ2A 1EB8A 1V3TA 2R1VA 2VXBA 2WVGA 2XYRA 3ODPA 3QP9A 4FFBB 3MW8A 4KP7A 2GPNA 2GZ3A 1RCTE 2Y1GA 3MK31 4GC9A 5GJCA 3RCBA 3TQTA 3KZVA 2G8NA 3GLGB 2OV6A 3L46A 3K30A 4HB2A 1TAQA 4JASB 5HF5A 4RV4A 3TD6A 2ZSJA 1C9EA 4BQRA 5KB3A 2B9VA 5HGXA 4Q7QA 3MS7A 4FYKA 4ZYWA 1WHTB 1F2TA 3A3YA 4K9OA 1V3VA 4CTJA 3O8BA 4GR5A 2FMHA 1Q7CA 3C3AA 3D8TA 3GFFA 1VLZA 4WFQA 3GEBA 5EXPA 3U9LA 1NMSA 3M6LA 4OH7A 4BLQA 2I9KA 1J00A 3IIEA 3OZEA 4ZK2A 1RRGA 5C1OA 4GBJA 2HA2A 1JJBA 4UAVA 3MBOA 3F5SA 1IULA 2FFAA 4E70A 1ZZGA 5JVDF 1CUBA 2Q0QA 3MS4A 4MUEA 2O50A 3AV3A 2IEAA 4M53A 3NB0A 4Y1RA 5F73A 1XEXB 1VJDA 2EJUA 4Y8VA 5FFNA 3UT0A 3UC9A 3B1JA 2F3SA 3DMTA 3UGJA 4FWBA 3TM4A 1M2JA 1PUIA 1VHQA 3FHCB 3MTAA 4RORA 4D99A 4E7OA 1FSGA 4KGVA 4O4IA 4V02A 4P84A 4MROA 5COBA 1NVVQ 3K9GA 3KFLA 4KNVA 3ZE1B 4YYEA 3WWEA 4X41A 1VYHA 1QPZA 1YMQA 3EZ7A 1JT2A 3AM3A 5ECYA 4ARAA 4B9EA 3V5NA 1ZMOA 3M4JA 2O8BB 1T36B 1TOAA 1ZIXA 1KZ6A 1ZISA 2WMDA 4B4UA 5K8CA 3DKRA 1WZEA 1IOLA 1ONBA 2OGTA 3SLRA 3FPNA 4TXHA 4Q3CA 1E8MA 3DXYA 3LIIA 1I3KA 1H2YA 1X7ZB 3QLTA 2FR0A 3I2IA 5EHQA 4EEXA 5AVVA 1GG8A 4B5KA 5KQLA 5LYJF 1JXAA 4D92A 2OQ2A 1WB4A 4RFSB 2JLUA 3VNQA 4AY4A 2P91A 5I9BA 2Q5EA 3HUTA 1TQ8A 2G3YA 4M0KA 3A4VA 1QH1A 1NP3A 2HMYB 1G8FA 1WD5A 4IH4A 1YI8A 2ORED 5ABPA 3M6MD 2W0SA 2FQQA 1X7ZA 5A1JA 3OI7A 3VU1A 4CKCA 1BXGA 3BWVA 2HXGA 1ECJA 3Q0TA 2H11A 4XR4A 3SHVA 1X9HA 4MS3B 1OR8A 3MGKA 1TRHA 4YDQA 3PXBA 3CE9A 2CFIA 4P3YA 5TMEA 1PWYE 4AN0A 3KSDO 4C0JA 2WIGA 4OHRA 4KPEC 4W5OA 1QB7A 2AC2A 4LWZA 4X90A 4BFLA 4CKXA 3H16A 4X1IB 2EKPA 3L07A 3TW4A 4FFWA 4DC9A 3VOAA 2WKSA 3QTTA 1ZD5A 3LBNA 1ZN7A 3CPSA 4I3HA 1P5RA 1Z4KA 3CEJA 3K4PA 4DLNA 1UM9A 1I10A 3H0KA 3SS9X 4TVOA 1AV6A 2V6AI 4PM4A 4AF7A 1E5VA 2GVNA 2IZOA 3RRMA 1M0WA 4KQKA 4UVEA 1FFWA 3JQ6A 4MLZA 1E4EA 2OBNA 2PS0A 2Z30A 1XVLA 4JCOA 2F3UA 1X77A 4FNOA 4BVEA 4IKEA 1I2CA 4JVMA 3HHEA 2XTAA 3U3XA 2FEAA 2ST1A 1Z47A 5MDHA 2EBWA 3OF2A 2HJVA 2YFKA 1FUEA 4MS4A 2ILTA 3ZY4A 1JHMA 4QOIA 1QUFA 4QA9A 4QULA 5CFLA 1TZ2A 1ORRA 1ZKDA 1N2GA 4CKBB 3LGSA 2XSZA 4RK0A 3BF8A 4N3AA 2DXIA 3OJWA 4Q03A 1KYTA 3PCRB 5BVHB 4MVWA 3Q6NA 2TMGA 1NXPA 3HR7A 3GVIA 4FC7A 4MLCA 3V1TC 2VK2A 1IVYA 2DSTA 2WRZA 4XOIA 4FB5A 4C20A 3IRVA 1UPFA 4KYIB 3QBDA 5K2MA 3UJ7A 5B58C 4CDRA 5HK8A 2YOGA 1PJSA 3NHJA 4J16C 1GV0A 5HX7A 5L3VA 3T3NA 2NV6A 2OCYC 2WU8A 1Z0AA 4B2PA 4MPJA 3L49A 2OC9A 2ZZKA 2NSJA 1DOZA 2A14A 3CUTA 3EWIA 1K9SA 3T4UA 4ARVA 1REQB 5MGNA 3S8YA 2YXNA 1R37A 4KLNA 5SZJA 1O9BA 1OAKA 1QAMA 1U1IA 1R9MA 1K2WA 1NV9A 2FY8A 3PIRA 4H35A 2BFAA 3D6UA 4G9BA 1MV5A 4HSGA 1TCCA 1J1ZA 2WJ3A 4PHGA 4UBKA 3UXYA 4URWR 2AJDA 3WZ2A 4OHYA 5BQOA 3OJOA 3DZFA 4JJGA 4QQFA 3FH0A 5KVQA 3S68A 2DFKB 3ZJ5A 3TJRA 2WF6A 3P9RA 4MQ6A 4WBXC 4KIJA 3WTBA 3JQAD 3K1TA 2BFCA 3GIWA 4GMXA 4GP7A 4RE5A 2ZJ8A 2EBHX 2NXEA 3L79A 9ABPA 1MNQA 2ZRPA 3RI3A 1XD2B 4FC6A 1F8XA 1TZCA 2C2KA 2YWCA 5DNCA 1UKAA 2W7TA 5B6IA 1RW4A 1E0SA 3KPWA 3D3JA 1RWVA 3GJ0A 1HKHA 2DWCA 3ZTWA 2C4UA 1QHHA 4CM6A 3W8EA 2H3HA 2WIJA 3AFHA 4E5KA 4HDOB 3T7TA 5CLQA 3DBIA 2VHJA 5BNFA 3CLTD 4YR7A 1IEWA 5THXA 2YZKA 3EGCA 2X0KA 4MR9A 4B3DA 2OLEA 4TL7A 1IMOA 4GOXA 1OFHA 1KAGA 4CU5A 1ZJ6A 4NJMA 2G1UA 3KOMA 4LDJA 3REGA 2GAOA 5IVIA 1X0XA 4NNPA 2UYCA 1KFKB 2VA8A 2X2OA 4YIKA 4HHHS 1P1IA 3RSCA 1UP7A 4UARA 4IQ8A 2R6JA 1P1FA 2PFSA 1QIDA 2R6ZA 3FGOA