4F9TA

Ribosomal protein l1 from thermus thermophilus with substitution thr217ala
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
226
Chain Sequence
b'PKHGYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTAMGPSVRINPHS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 50S ribosomal protein L1
publication title [Crystal structures of mutant ribosomal proteins L1].
pubmed rcsb
molecule tags Ribosomal protein
total genus 65
structure length 226
sequence length 228
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 4f9tA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f9tA02
3FPNA 5DM60 1MZPA 3U56A 1ZHOA 4LQ4A 1I2AA 4DFCB 4REOA 3UMYA 1AD2A 1DWUA 4F9TA 4QG3A 4QGBA 3ZQJA 3U4MA 5DM70 3TG8A 1U63A 1CJSA 4QVIA 3QOYA 2HW8A
chains in the Genus database with same CATH superfamily
3R2JA 1A9TA 3VZSA 3AW9A 1E9DA 3FZQA 3P1JA 4LWOA 4UQOA 2X9NA 1EVZA 3HWSA 2ERXA 2IVZA 2JRCA 1T3TA 4BFTA 5JSFA 5I8PA 1UP4A 5LZ5A 1J24A 4QX6A 3TAHA 3ZDQA 4GSKA 4GMHA 4EUHA 5G0UA 4MUMA 2C78A 1XTJA 2FZ4A 1PGQA 1S2OA 2GYUA 2QAGC 2R65A 3KJHA 3KQVA 3MW8A 2BKVA 3O84A 4OQZA 3WLJA 3SIXA 3CR8A 4FYXA 4IJ5A 8LDHA 1B43A 5BR4A 4IEFB 3K8OE 4COOA 4UC0A 1AH2A 3DVRX 1YJXA 2BFMA 4M9CA 2YMMA 5EWLA 2LBPA 2QUAA 2XWBF 4EECA 5C8YF 2QXTA 1Q16A 5K0CA 3BCSA 1GLGA 2ONCA 1QBGA 1L5MA 5ES3A 5BSKA 4YFVA 1CF2O 2V0CA 4YQZA 1T8PA 3O3NB 4L8VA 1VIAA 4KOEC 3L92A 4WW0A 5JJBA 2Q4OA 2XODA 2EKBA 1NW3A 4H1HA 2XE8A 3RS8A 4E4TA 4B7AA 1O94C 1BHJA 1U4SA 1WCIA 1XYGA 3MLBA 3BA1A 4J0FA 4IH9A 5KI6A 4L2IA 5A1TA 3EZ7A 3N8KA 2GJKA 1O0SA 3ANLA 1C7EA 3ZNQA 4ID3A 5HVNA 1K2VN 3ADKA 4QOGA 3SLKA 5COBA 4AJLA 4JLDA 1PD0A 1TIKA 3JQ9A 3EGWA 3EQ2A 1FY2A 2RB4A 1JWAB 3MUOA 3QUQA 3VHXB 5BSGA 1CVIA 1U7ZA 3EFEA 5KU7A 3RS9A 1DXOA 3W2GA 4AJIA 2MSNA 1CZOA 4BEBA 4OKNA 2XMCA 3OUZA 1H6BA 3HB5X 3WWCA 4BNUA 1L6RA 1JQEA 1XZNA 4D9JA 4LPSA 4LYJA 4N9WA 2XLCA 4FCCA 3SC3A 4CGZA 4X8HA 2ZIVB 3Q5DA 1SC3A 1T6YA 2UVQA 3T3PB 1JKMA 1GQOA 2W93A 2XDQB 4MLZA 2YZ7A 2G9NA 3NAGA 4HZIA 4WY5A 4EYOA 4E13A 3DVLA 1TQ2A 2J3MA 3IDFA 4OHWA 4AF8A 5CB4A 1XSEA 5JQWA 4K5QA 4DV6B 1X7DA 4WLOA 3U7JA 4ZYUA 2V4UA 5ALXA 3UBTA 2BR4A 2G1AA 1DKUA 2WFAA 3GU3A 2YS7A 3BE6A 3I8XA 3LUBA 1A9OA 2EZTA 3TG8A 2X8WA 5EE3A 3URMA 1JQJC 1VL0A 4HDNA 1TM7E 4HEQA 4LSGA 4X66B 2CZGA 4MW4A 4AS2A 2JGAA 2Q5FA 1WUIS 3EHEA 4XB1A 4C2BA 5BMVF 1QZTA 3VGPA 5KQLA 1X3LA 4TZTA 3ZDBA 2ZRHA 2EL9A 5C52B 4ZODA 4AT1A 3A9SA 2CDRA 5BR7A 4FKMA 1AOXA 1O95C 2AL7A 4AC9A 4R2KA 3HVHA 3THSA 4A5SA 5A3QA 3KTFA 2ERYA 3R0VA 4PWZA 5AW3A 1KJ8A 4XGKA 5C5IA 5TMDA 2DEUA 1CQJB 3C24A 1XTVA 3TBFA 1OT3A 3ZK8A 1F6WA 1QC5B 3A4MA 1SVSA 3ITEA 2E0IA 3IDSA 2AHRA 1N5LA 2C31A 3H5RA 3GNLA 2BEUB 2XNDD 1CRZA 3B78A 3K0AB 1XNQB 2Z4RA 3AQ4A 3JTEA 4I4LA 3RE1A 5LA6B 2SNIE 1M6VB 2R84A 3F5FA 2H1CA 2WKQA 4BP9A 3KBBA 5JROA 3MTIA 3I4LA 4YAWA 3VR6H 2CUTA 4W5OA 4X60A 1P2FA 3AV0B 4X84A 1GRNA 1GG2A 4MW1A 1D1QA 4DQKA 3DZBA 4EB8A 4N01A 4F93B 4R05A 1SCUB 1R5BA 5BUSA 1KWKA 3A0UA 3DBOB 1OJLA 1MT0A 1PLJA 3NTUA 3PRHA 5K3BA 3I12A 4KE8A 4YEDA 2D5BA 5CA0F 5LMZA 3GT4A 4HLUC 3SOZA 1S9DA 2B8TA 1YR2A 2VT6A 1YCFA 2I4IA 4XPIA 2CVOA 4N3NA 3NBXX 2FWJA 4ZVUA 1GTVA 1F1BA 1TMOA 3SY8A 3QJ5A 4IRUB 1YT5A 5BNTA 4S1TA 1DSSG 2WAMA 3NDRA 3ABRB 4RMNA 2J5XA 4OXXA 1G66A 3ZDRA 5KREA 3Q8KA 2QAGB 1DQPA 5DIFA 2ZRBA 1QZUA 3OQIA 2FPIA 2C2WA 1TA0A 2C3YA 1JVNA 3LQ4A 4G8JA 3EZ9A 3H2YA 1CYDA 2JH3A 1U3WA 4UMFA 1HX7A 3OT1B 1AB5A 3MQ2A 4WBXC 4X8MA 4BGDA 5C7LO 3U1TA 3NCHA 5B2ZA 3BHMA 3NOVA 1R00A 4MUXA 4RD2A 4DEVA 4DA7A 1Z4QA 2CXOA 2X2PA 2ZRCA 4RY9A 2VAWA 2OHXA 1KY3A 2VF2A 1JFSA 5A5FA 2B35A 3G0OA 1IJEA 2JBAB 5FTNA 4Z9BA 2YZGA 4ZVVA 1OXSC 3ZDFA 3ROXA 1ZR2A 5AUQA 2H65A 1SIUA 4JMLA 1XXLA 3K96A 5CNMA 1PZHA 3O0TA 4LRQA 3UA4A 2ABWA 1WZ2A 4N82A 1G2QA 1IDN1 5T4FA 3RIXA 5F3WB 3N53A 4CM8A 5D3MB 2ZJBA 5HBGA 1OVGA 1U0BB 1SBYA 2XMQA 4KPFC 3RVMA 2N0SA 3IIMA 4KNWA 4PNZA 4BIIA 1B1CA 1QTRA 4MS4A 1PJAA 4EFKA 2G63A 4P3OA 4ZYLA 2RK3A 3P2KA 4ZT6A 1Y5IA 1VZ3A 4Q39A 6AT1A 1H5QA 4RCYA 1E9CA 3UTCA 5F3RA 2XYQA 4X45A 4W6QA 2UZ1A 5FL3A 3AB3A 1I9GA 1PZFA 1JG1A 4CIVA 4E09A 2ZJ4A 4XWKA 4DUZB 2IBTA 2Q4BA 2AC2A 3EZ6A 4LYEA 1IN6A 2HDOA 2VK8A 4IQ0A 4QD3A 3SMQA 4CF5A 1RXYA 5BV8A 1VL1A 3LG2A 3OP4A 4RD1A 2Q6OA 4N7JA 5EOVA 4EW3A 4YR9A 2G6TA 5C9ZA 5JFTA 2XVAA 1CULC 3PXXA 2JBHA 1D4AA 4IWXA 3ICQB 1QF6A 2H5LA 1ZY2A 4KITB 1LK7A 5JPCA 4YRZA 2DE0X 2I78A 4GXRA 4KMMA 4TTJA 3CUYA 3MUNA 3N6VA 1EVJA 4DQXA 3WK7A 1HE8B 5HHTA 2CMKA 2MYTA 5A3JA 2XOKA 1L5HB 3NYWA 3CN7A 1DTSA 1XT6A 5AW7A 3R3YA 4FWTA 1VMAA 3OIDA 3UUGA 2ACEA 4ZALA 3ZWAA 4PAMA 5K3CA 1OF1A 1HLDA 2NT4A 5BN3A 3HXTA 3ZBUA 2PUWA 1FDSA 1KMHA 2WWRA 1AGNA 3TTXA 1O57A 2O06A 2Q5CA 4DILA 2JI8A 3HL0A 3QLUA 3DXYA 1OLXA 2W6MA 3NNDA 1Z7WA 3LFHA 2OPHA 3RVJA 2IITA 2ZDQA 5K6TA 3E7FA 3BMNA 4MGIR 4A36A 4RJJA 2VDRB 3WGGA 3WMXA 2A3RA 2IJGX 2RBEA 1WB6A 3MOGA 4UMVA 2MU1A 4KLNA 4M38A 3HBMA 4XRRA 5G41A 4J0GA 1XDSA 4JL8A 4KUHA 3TLZA 1ODLA 1BE8A 3DHVA 3B9PA 3MIZA 3PRJA 2HPHA 1IH8A 1O89A 3GA7A 1DUVG 4OSEA 1O77A 2ZATA 4RDHA 3TXXA 3PDIA 1UZMA 3RANA 3DZKA 4OYHA 5LM3A 3HVJA 4ZOBA 1E3SA 3LLMA 2GN8A 3R6DA 1XZCA 3SR3A 3SYLA 1VP9A 2B5OA 4FFBA 4B32A 1VXOA 3KLMX 1MN6A 1D1TA 1Q77A 3BL6A 3RSCA 2CFTA 3KD3A 4RK0A 1A96A 4BZWA 2QSJA 4DJTA 2BFDA 1SVNA 2FUG1 2HYDA 2XMDA 4IDBA 4NICA 4F7WA 1JQ5A 3C45A 2ENUA 3EARA 3QLTA 2X5OA 4QDTA 3NLLA 3ITKA 1GFIA 1SCNE 4IP0A 1U7PA 4RF4A 3ZLJA 5CPFA 1QIJA 2JBWA 3LVRE 1REQA 4KBYA 2Q45A 2ATEA 4BNVA 4Y6SA 3HU3A 3WB1A 2VOEA 4A16A 6YASA 4PR0A 3FJ1A 1SXJE 2FW9A 2GNAA 2I6TA 2VNKA 1BGXT 1LW7A 2ANCA 2Y1EA 1U04A 3A6EA 3TJMA 4OBWA 5IN5A 3RK1A 4CKYA 2FX2A 4YA6A 3PX2A 3U7GA 4D0NA 1KERA 1IPHA 3PPYA 5CW2A 2F4NA 2OORC 4OA5A 3LQ2A 3AF0A 4QECA 4DNFA 1FDTA 2ZRIA 2DBVO 2QORA 4H9GA 3T3HA 2BKAA 3VSBA 3L05A 4FGZA 4X7MA 3MS2A 1V71A 1M6NA 4E4RA 2GLXA 3UGKA 1CE8B 1XZIA 3ZWDA 5KDOA 4O4IF 3TBKA 3KB2A 2AZDA 3I6BA 4JUAA 5LJIA 1DADA 5H70A 3SZLA 3C48A 3L7LA 1Y4AE 4EHFA 3ZD7A 3PEFA 1X14A 2BSQA 1E96A 2IYYA 2WAAA 1DAMA 1NZJA 1N6RA 1KOJA 1VYHA 2MSKA 2VJBA 2BFPA 3QQ5A 3NWPA 1KKMA 2HXGA 2I5PO 3QV2A 3R7SA 1K5HA 1FFYA 1KK3A 3TSWA 4JI4B 4XX1A 2NNLD 4K8RB 3PUHA 2B37A 3BIXA 3QWAA 4UOQA 3UT5B 4PTYA 3S8YA 1FDUA 1WTAA 1KY5A 1TQHA 2RHMA 4JQZA 3CNLA 1XZJA 4ALIA 4ZDIA 2VHUA 1EGVB 3RODA 1E64A 3LVQE 1ZJZA 1RP1A 4PCAA 2Z6QA 2O19A 2BKXA 4W5WA 5KQPA 2G88A 3JRWA 5FPPA 3RU2A 3ROGA 1MO4A 2CYAA 3B2QA 1BYIA 4U00A 4X1YB 1SKMA 1W1WA 4B3IA 3DF7A 5CG2A 1IN4A 3V1TC 3IHWA 3JS5A 3DE3X 3EXFB 3ORHA 5KNBA 4MRPA 1W4AA 3PXUA 2YWHA 4E5VA 3NVDA 4AMYA 3KEMA 1F5SA 3PT5A 4UU0A 4CIAA 4IX9A 2QUJA 1E8MA 3HLYA 1M2WA 4B5LA 3P45A 1FS5A 1MEEA 3HVKA 1O7JA 1T8UA 16PKA 3DO6A 4QEZA 3F4KA 4S24A 1OH7A 2WJJA 4FNMA 2PYDA 4KXFB 4C7JA 2XOKD 2IEAA 1R0RE 3S8MA 4O2BA 4FM9A 3CCCA 4BP3A 4JBGA 4Z4GA 1KFBB 4WZAB 4Y6RA 2WY2D 1YJ5A 2NN3C 1LH0A 3OX4A 3QU4A 3FRHA 1P0IA 1I1HA 4OV6B 4EOGA 1BQEA 4LOLA 4GW3A 1E9BA 3IILA 3RQIA 5I51A 1U2EA 3FD8A 4KP7A 5CLGA 3KK0A 2A9JA 3C3XA 3AF2A 1AUSS 2Y1WA 4JT2A 4ZCSA 3U7HB 1R10A 2BGNA 2YRFA 5I7OA 4JT4A 4B9AA 2JIPA 1GJRA 1NFRA 2GHQA 4LFAB 5BNFA 3G8BA 4MUYA 1Z17A 1KBQA 2ES4A 4KIWA 3VH2A 1P9LA 3FYDA 5B55A 4UUQA 3MJEA 2BM1A 3ZHUA 2E4VA 2Z3ZA 3VVBA 3WWYA 1ULZA 2QVYX 2GDJA 2Z43A 3WLNA 4E5MA 1S89A 3KV3O 3FYCA 3HKBB 3ONDA 4ZCMA 3AF6A 2P6UA 1RRPA 1E98A 1VPWA 5A2QA 3KYDA 3TLKA 2BKUA 1NMEA 4QDUA 1Z7GA 3NWBA 4OATA 5FUXA 2CL6X 1W36C 1E1CB 3OZVA 3WKBA 4OKIA 3HH8A 3K5PA 3U61B 4P98A 3SFTA 4C2UA 5J1SB 1RYZA 2ZWVA 2AA3A 2OE2A 2XNHA 2CZCA 5EWMA 4IKPA 4QASA 2HT1A 3O4RA 5ALIA 1Q7EA 4FGJA 2VZ9A 4MX8A 3G0BA 3ANMA 1DDOA 1Z2CA 1YDGA 1DC8A 1YJCA 3ZE9A 1OROA 1BAPA 1E4EA 2YQ4A 4FQ5A 4WWHA 4AWAA 1YO6A 1I5RA 4M54A 4CMKA 2PO5A 1IOLA 1P7VA 2QTGA 2GTHA 1I4DD 3MINB 3KUCA 1BU5A 3T5BA 4DVJA 3HCEA 5I7SA 3FVRA 3LMKA 3WKAA 1VSTA 4QXMA 1KR2A 1IJKA 3LYLA 5AOVA 4D8VA 4Y2TA 3NBKA 3RH0A 4BLUA 3R1IA 3JPYA 1NFFA 1T2UA 1FSPA 1DP4A 1MB0A 1RM0A 3WLRA 4GR9A 3BMQA 1DBSA 3OIYA 4KVFA 3MCAA 1R64A 2AV6A 1GQRA 1HL7A 1KYXA 2XF8A 3TB6A 4BZPA 1M8FA 1R0WA 2FWIA 3F7MA 4O1IA 5T67A 4PHCA 4UZEA 2WV9A 3IQXA 3AETB 1M1XB 3CYFA 1T5IA 3VQTA 3QVJA 1AGXA 1XJCA 1U7XA 1PYGA 1RXIA 3KCNA 5J1TB 2QP4A 1HK7A 2O5VA 2YINC 4DQDA 1XX6A 5T4HA 1PFKA 4B1FA 1PZNA 2CT8A 3PYMA 3NT4A 4BQNA 1JEQB 4R98A 3PDCA 5HRUA 2HU2A 1Y6FA 2Y1CA 3EX7C 4N1AA 4OQDA 5FLXA 1YDFA 4RCVA 4A82A 3J81k 5BO5A 4PCUA 4EB3A 1QFXA 3SIRA 2OAQ1 4NNJA 4UAGA 5E9WA 1S1MA 4BQRA 4YASA 4OB6A 3ILYA 2XGSA 4DT1A 1OQAA 5I9SA 4FOSA 4HMPA 1PT8A 2RE8A 4LXXA 5T64A 3FTCA 3K0KA 2BR5A 4AVYA 1Z6TA 2EJCA 1ZGZA 2FUEA 4OH7A 5J2TF 1K5PA 4PGHA 1XD9A 4RWEA 3ZE2B 3ZW8A 3NAZA 5KWVA 4E2XA 4HDSA 4A0RA 2CF5A 1VIMA 2HRCA 4POOA 3WS7A 2JIQA 1XRSB 1Z3IX 5ICEA 1O0BA 2FR1A 2ZB8A 1GOTA 4LHYA 1LDMA 2GVZC 3LA8A 4C1NA 4WNCA 3ZCPA 1DIRA 1HM5A 1TZBA 1FYVA 2LDXA 3ACDA 2J9FB 3CLTD 5D7NA 5EXSA 4F4FA 4TKVA 3E0XA 3HV2A 3KKMA 4BMDA 2EHDA 2HLDA 1YRWA 2D0PB 1SKQA 1XTZA 2A5GA 2H1IA 3N5CA 1IBKB 3LFUA 1TQ8A 3M3DA 1N6PA 1NMSA 2JAPA 1CY8A 3AEXA 5HMLA 4IDDA 2CKDA 2QW1A 1B8OA 4URWR 5EHIA 4F72A 2UZ0A 1D1PA 4PGAA 3RSGA 3ZE1B 2FWRA 1KEEB 3QZUA 4FLEA 4MVYA 1KI1A 1VYVA 2VHCA 1R88A 1JMKC 3GELA 3U3OA 4RV4A 3SQXA 2QJTA 2WT8A 1R37A 1JLSA 5B7NA 3L7MA 3JQFC 1E61A 3Q40A 1IJFA 1H5UA 1TI7A 2IPXA 5JCJA 5A06A 2D1SA 1PGPA 3EGIA 4RIHA 1XQVA 5DI3A 1N8SA 4EHNA 5C1OA 5CEJA 3DOCA 1DINA 3LUFA 3N7AA 3ZHBA 4PLYA 4L75A 2MYUA 1J0BA 3U7EB 4PONA 3KB1A 4BWFB 4KR9A 2OFXA 5K01A 2QNRA 1XP8A 3E22A 4JEHA 1N6LA 2PNJA 3WQSB 1IVSA 4HWSA 2RKWA 4DLAA 2JCXA 5TLSA 3GRRA 4N7MA 3SJBA 1U2RA 3DQPA 4B46A 1XNRB 1G8FA 3A6KA 2GXAA 3SF0A 3D4NA 3WLEA 4FWIB 5AKEA 4NYJR 4Q3OA 1W36B 2Z1MA 1SBCA 2A57A 2IW1A 2W2VA 1NUTA 2NQ8A 1CXZA 4TT8A 4HDAA 4BKRA 2Y99A 1W88A 2YXPX 2J48A 2PWBA 2RI1A 2ZAMA 3ESXA 4EWLA 2QJRA 1OWMA 1Q21A 3C1UA 1ZGGA 4GSYA 5EP3A 1QQ6A 1V7QA 2R60A 1VP3A 4W5TA 1PCXA 1UBFA 2WICA 1JDBC 4F9EA 1YR6A 2BTQA 4X00A 1HORA 5LYJA 4OAPA 4MO2A 5IVPA 5GIPE 1PSZA 4ZDWA 3T41A 3WTCA 2MR5A 3M6FA 3L1IA 3BL5A 4IW3B 3TNYA 2QS9A 1NI5A 2ZSKA 4X9XA 4CG2A 2X8JB 3QEJA 3OO0A 2OLJA 4R16A 4TT3D 1U3GA 2H1FA 4AUMA 5I7FA 3KVVA 1D5WA 3AKCA 4L27A 3U80A 3LT5A 2CUKA 4I6GA 3VV2A 2BH2A 1RXOC 1G0NA 4HYEA 1VPEA 1Q14A 3OY7A 2FRXA 4O4HF 2Q3MA 3DMGA 1VLQA 3MWKA 4ONEA 3SYRA 1Z39A 4BRWA 3F3YA 4FSHA 5DWDA 1X86B 2VP5A 5C34B 3NJ8A 4D3ZA 3G9ZA 4MB6A 1AD2A 3G5LA 2VJCA 3UAWA 4YECA 3DFFA 3CR3C 5GOZA 3DEYX 2R751 3TLJA 5ECDA 4BGUA 4E2FA 5KNCH 1RYNA 3LUDA 4NYIQ 1IY0A 4PFQA 2I3GA 1DVRA 3G0CA 3FZYA 4HS4A 3AC0A 3SYTA 4MQ4A 4MP6A 4Y6GB 1PAUA 4JROA 2A94A 3GLRA 3H8JA 4OXIA 4IDAA 3USZA 5FOQA 1AMUA 2ZUVA 2C99A 2D2FA 4UBIA 5FTMA 3KSAC 1G6KA 4ZQEA 4GPIB 1QTNA 1UR5A 3JYPA 3SLGA 1IOWA 4OJMX 4YVFA 4NV1A 1RI3A 2DH5A 4LY9A 3B1FA 1M6HA 4MYUA 2IE8A 3I9KA 4X93A 3VR2A 1N32B 1RYMA 1Z7YA 1JXOA 2BFBB 1Y6JA 1TU0A 2DHDA 2FSFA 3KP1A 4FHCA 4M8SA 4MEAA 4R7TA 3VJMA 4FFRA 5LBTA 3WGMA 4ML3A 4A92A 2AYYA 1MPTA 2VHQA 4NBVA 3LCUA 3VYUB 3ZV7A 2YWDA 1W5BA 2HGSA 2X40A 3CE6A 3G5TA 3TO5A 2D2XA 3CX7A 1FZQA 4ZV9A 3RK4A 4EVQA 2ZTLA 3KSMA 3T3IA 1P5JA 4FINA 4KFTA 3UENA 4F9GA 1X8JA 3OKPA 4EQ6A 4G25A 4Q01A 4JI2B 3COZA 3NOXA 5EPEA 5JSYA 1J1UA 2VDOB 3GEGA 5DSTA 1X7YA 3TTYA 3ZY5A 3PIIA 3I9FA 1W9MA 2B36A 3NHMA 1KEVA 2HNBA 4HWTA 3G2JA 1OZAA 1WULS 4DLLA 4FN4A 1JV2B 4U2CA 4CU5A 4F0KB 4H6WA 3B1VA 3AJRA 3KS9A 3V2HA 5BMVB 1BOFA 1N0HA 1PZGA 2EWVA 2ATIA 4N5MA 1B3BA 4Y2YA 4PAQA 2HLDD 3HB1A 2W6OA 3HA5A 4KQEA 1NVWQ 4MICA 3WYBA 4WOPA 5G4KA 3TW8A 4BATA 2P90A 3CISA 4DRYA 5HIJA 5EL0A 3W5BA 2OBNA 3VDMA 3C2QA 1I51A 2FW6A 5LYJF 5BV2P 1E3MA 2P35A 3RFUA 3R5FA 4CUZA 1F8FA 2EP8A 1EVIA 1E2HA 3HDGA 1GPDG 4FMDB 3R8CA 4IOMA 2WZBA 3EDQA 2X4IA 4KQWA 4G0ZA 3K05A 2XCRB 5A71A 4D43A 2QQFA 2QMHA 1S7CA 5SYAA 5JCJD 1W75A 1OE0A 2E6KA 3DO5A 3VV3A 1DC5A 3VYVA 3QKWA 1SUFA 2Z08A 4GPBA 3UC9A 1X80A 2L17A 3OTHA 1HE5A 4GOND 4P84A 4AMUA 4BL5A 1IAQA 2Q29A 4RVSA 2IXBA 3ST7A 4A8PA 1E5XA 5FWXB 4W5NA 3GOQA 4FC6A 3OJWA 2OT3B 3FGOA 4PZPA 2QGZA 1LDBA 3AIKA 1RAGA 3FTQA 3GVCA 1O58A 5EWJA 5E6SA 2J7PA 4W7SA 4Q3NA 1ETHA 3T7TA 2W6IA 3TSOA 1VHJA 3A11A 2FZKA 1I3NA 1IQ0A 1NMXA 5CGQB 4MAAA 3QYAA 4I5GA 1JDBB 5IAGA 3P96A 2VRNA 1U7TA 1YR3A 3MXOA 2Q5EA 4B3SB 1DZIA 4H0FA 2P5TB 3ORQA 3N6RA 3GBVA 1NWCA 1AC5A 3BFVA 4X5OA 2N42A 3PITA 3BHIA 2HUPA 4ZT5A 2ZRMA 2XUIA 2AE2A 1GV0A 2HU5A 3IAHA 1ONPA 1EP9A 2B9VA 2W4QA 3H65A 1WCYA 4W1PA 1KVUA 3W9UA 2IT1A 2R25B 4YRSA 4Z4FA 4W7HA 3T7AA 1RI4A 4E1AA 4B3XA 5B1HA 3PR1A 3RYCA 2ZYRA 2ZR8A 3TG2A 1ZJ6A 2PCJA 1NBEA 1R8XA 1HNNA 3SPXA 4ZI7B 1LK5A 3WGZA 1NXWA 1SXIA 2XCOA 3MD9A 2GR9A 3VDRA 4D6YA 5FULA 3AUKA 3F47A 3CEAA 3INRA 1EFPB 3QFCA 3SHQA 4ME6A 3H2HA 4ZKDA 3CS3A 2V3WA 3QLVA 5FL7A 4C04A 3V7YA 3WO0A 5HQ3B 3V1LA 5EZSA 3LX8A 4ZWNA 3U56A 4AJ1A 1YSCA 4AM8A 5H4GA 2CGEA 4AZWA 4ON9A 5EIHA 3OZWA 4C3ZA 4QGSA 3NHJA 1RYEA 4RK4A 1VGVA 4DDKA 4XD7A 4N49A 1FSZA 1R0SA 2G7ZA 3TECE 1IQUA 4PPYA 1PEKE 4UMDA 1NP6A 2GN6A 3PXAA 4Z7JA 1BHSA 5JTUA 4B71A 5FTKA 1KI2A 4TQUS 5LKRA 4ZPXA 2WU4A 2IFTA 1W46A 2GASA 2NT3A 3VR2D 3AB7A 1NP3A 4IS2A 3ZHZA 3GDGA 3HZOA 3H9EO 5EQFA 4YP6A 4FMBB 4JOCA 3L1HA 2WC1A 4S12A 4AXXA 4V1CB 3HU2A 4KDRA 3V1NA 4TMTA 1FDIA 3S2IA 5CDSA 3L41A 4G81A 4O5AA 1U3TA 2G4LA 3QSGA 1UK9A 2QEQA 4JYBA 3LO8A 4B4VA 4YLGA 4CHGA 1WEKA 5EESA 5CDFE 1K9SA 3RS3A 2GZDA 4EHJA 1KEUA 4H1WA 1P5ZB 3CVYA 4QYTA 1I5OA 2EYUA 1YS4A 2YVUA 2H17A 3MWDA 1XZPA 3ANSA 1MRNA 5C18A 1W5SA 1RAEA 1QAQA 3EVFA 4PEVA 1SUWA 3S68A 1HZZA 2AVDA 3F3MA 4BJ3A 2XYVA 2QVXX 4OYYA 5C8VA 1AKNA 5CHYA 1V6SA 2C57A 3JAKA 3OPYB 4RZHA 1VCOA 3QQPA 1L8QA 4G63A 4HNAA 1W1IA 4ZT7A 1H3FA 3QLEA 3F3KA 1K06A 2W48A 1Z4LA 3PDJA 2HWKA 3WAJA 1MAUA 1PNRA 3F98A 4PCVA 1SG9A 1Q84A 4DRXA 1IY9A 3T9EA 4QLOA 1IZZA 2XD4A 4KLZA 4A0HA 4EH1A 5TEWA 1RI1A 3FZGA 3PQ4A 4EJ0A 2E85A 2R00A 2X0DA 3OPVA 1XV5A 2FUG6 3LDAA 1VPLA 4MARA 1ORRA 4MVJP 1AHIA 3EIEA 5GONA 2IEBA 1N7IA 1YQ9A 3C39A 3GLFB 1KO4A 4RLHA 5LQRA 3KAQA 5K1ZA 1ZM4A 5BORA 2NXNA 1QX3A 1RKXA 2CFIA 3F78A 3HQ4O 2FMIA 1RC8A 4RD4A 3EZFA 4DLKA 5TF0A 5KTNA 3HI6A 3CUUA 1WVIA 3QXGA 1GVNB 4P4LA 5IBQA 4UARA 3S7ZA 3FCUB 4FGWA 3ADBA 1X0VA 2PL9A 4X85A 3PUWA 3VZBA 1Q15A 2J7PD 1UXIA 2X22A 3U44B 2J09A 3GHYA 1NXPA 1U9ZA 4K6OA 2W6ID 3FNEA 1LVHA 2QXYA 1XVUA 2WWFA 3GUHA 1AV7A 3M4JA 2O8VA 1L5LA 1NW5A 1DOHA 3SC2A 3VI4B 2CMFA 1Q2XA 2PZJA 2AF3C 1AT1A 1CP3A 1Q7RA 4J0EA 4NJEA 3HCWA 3QELB 1SN7A 3N74A 3QOXA 4IQGA 4IPTA 3TAUA 3STXA 1FS4A 5LZ8A 1KEZA 4REQA 2IUYA 3OE7A 5JRDS 3IJPA 1R8QA 3ANXA 1DFHA 1N25A 4YRFA 2JVKA 3VZDA 3C0KA 2XYGA 1P4JA 4RJIA 2WQZA 4DWVA 1EX7A 3W7VA 3OY2A 4UQLA 2VT7A 2GEFA 2MCFA 4YAKA 1E7WA 1GNVA 2JFZA 4JXXA 4OHKA 3ETCA 3G2IA 2HPVA 1CJTC 1ZEJA 3ZZUA 3ND6A 4FEAA 1J09A 3FCCA 5K0JA 5FL7D 4L5YA 1ESZA 2NX2A 1NR7A 1ZHHA 2V9CA 5NULA 4EUSA 4KQGA 5J4LA 3NNNA 1RP7A 5K4AA 3E6AA 5C1PA 1E58A 4P83A 1OB5A 5FQOA 5FI1B 3SBEA 4CCYA 2BFEA 3H9BA 1PR9A 1ZGBA 4PIPA 4XD7D 1IPEA 5MN5A 3C5WP 3PVCA 4RGYA 4J1TC 3ZNPA 4L95C 2F62A 2BONA 1G17A 1SA0A 2FNAA 3BJMA 5JALA 1VKHA 2HIHA 3P97A 2UVDA 2R6AA 2V7EA 1JT9A 2YRXA 4H3KB 2UKDA 5CLFA 3RSFA 1NQVA 3U37A 1VTKA 3V1MA 4UDNA 5GJWC 3AK4A 1FSFA 4NEGA 2NUAB 4ETMA 5BV0A 4WN9B 5E4JA 1JI3A 2R66A 2E5FA 5GONF 3T7EA 3VAZA 3D8SA 5FHQA 3QOFA 4EDFA 4GXNA 3I53A 2FE4A 4K0KB 4ZDKA 2JLZA 4C4RA 2AEMA 4C0XA 1QCDA 2PX5A 1IZ9A 3BPSA 3CW2A 4LCEA 4BY9E 2VXCA 3AUJB 2BF4A 3KE8A 4N5LA 5ESDA 2XLBA 4OQFA 1OLSA 3GX1A 5B3JA 1FX0A 2QA5A 5CITA 3JYOA 1JIQA 2WWYA 1U0EA 1II8A 2P27A 2G0NA 2P7HA 3OPYI 4F6CA 3CXUA 3SBOA 3WKEA 3PRYA 1MX9A 1JXAA 4BKUA 4RJLA 2M6KA 3AL0C 721PA 1T3ZA 4II7A 1B0PA 1FUEA 2C2YA 4ZVNA 4Q4CA 2AB0A 2DFVA 5FOWA 3IMKA 4HH3C 5JTTA 4CEHB 5MN6A 4I1YA 2C9OA 2H4HA 4YCMA 1I30A 1R0XA 2J31A 2VPWA 2HV9A 1XDDA 2IOFA 2PL5A 3OZXA 3PUVA 4Y6QA 1NQUA 3RYFA 4AD8A 4IGEA 1GYPA 2NYAA 4JK3A 3QTLA 1BXRB 3RR2A 4J16C 4K88A 2PS3A 5CHEA 3RRJA 3M49A 4YONB 4G4JA 5DM60 1W85B 2TMDA 5IAEA 2F48A 2O3SA 3LX5A 1Z18A 4KAXA 3H4MA 4JOQA 4FBLA 1IG3A 1NVXQ 3AVTA 5JLAA 1SQSA 1UBTS 4BAGA 1FDRA 4BQQA 1XKQA 4UVGA 3HP7A 2VTEA 3HCBA 4A0SA 4KI0A 1NLUA 4UNNA 5L3VA 3QPAA 5DASA 3PA8A 1JBQA 2I2XB 1Q0HA 1I3CA 1Y8CA 1XMOB 5A3RA 1S3GA 1N9GA 2DBYA 4MPPA 4Y9DA 2V6MA 2M98A 3E1SA 2Q3EA 2QTAA 1ITZA 2X1HA 4RLFA 4NF2A 5TPZA 2A30A 2H1LA 5ALPA 5AJTA 1Y8RA 3CX6A 4JKYA 1SEVA 1Y1QA 2UZIR 1WDWB 1GTG1 2CVQA 2QTRA 3I58A 1TL7C 1GPYA 3AT1A 1KSGA 1VDMA 1W44A 5IT9A 4LCBA 5HPYB 1CWUA 2IHUA 5GZ1A 1D6JA 4YRMA 4RDIA 4WLNA 1YC5A 2YMPA 1J7JA 4LJKA 3SJAA 4EZEA 3AVOA 3NM5A 5HF9A 5BPHA 2JVIA 1GCIA 1TU4A 1MOQA 4AZ3A 4DB2A 2GKGA 1QIMA 2JCSA 1X92A 2PFSA 4XSHA 4A8JA 1T6BY 1H3NA 4KQHA 5CFQA 5AM5A 3T9FA 5CDYA 3D0RA 5F2EA 3IAXA 1JEEA 5CAEB 4Q0MA 1GUZA 4CKBA 4DCSA 1ZESA 4XX0A 3RUIA 3I30X 3MMPA 3ND7A 2CBZA 3JQ9C 3KQLA 2YX1A 1PFGA 2FK7A 1XHEA 1KI6B 3EVDA 1IM2A 2WMOB 4Z8XA 3MT9A 1ZRHA 1PJZA 2MINB 2P2LA 3RKRA 2DWQA 4CCAA 5I45A 4HDRB 4HMOA 1PV4A 2XAUA 2JJMA 3I39X 4I9UA 1RFLA 2BIFA 3I32A 5ARBA 5KYXB 2DFTA 3TW4A 1NUSA 5B1IA 4CT5A 3WRWA 4HVLA 4A4DA 2BGJA 1MC1A 4LC0A 1A8PA 2E5WA 1SVOA 2E82A 1D2HA 1IJBA 1YXMA 2YFHA 5HGJA 5KOYA 4C4OA 3CH7A 3OQNA 2C2ZA 1NV8A 4UTPA 3AJDA 4GH5A 2AMFA 3OM8A 2QP3A 1YFJA 2XQFA 1WSAA 2PUDA 4TYQA 1UWCA 2EARA 3CEHA 3DVQX 1R4MA 2E49A 3OBBA 1AQIA 1L5FA 3QBVA 3T9BA 2XUKA 1WDTA 2QVGA 3W34A 1EJ0A 3ZWYA 5J3JA 3F96A 1IAVA 2IYLD 4EARA 2A0WA 4E21A 1J49A 3IUNA 5CXUA 1PQYA 2CLMB 5A62A 5FBZA 2C88A 2ACVA 1O6GA 4DANA 1HY3A 3IKLA 1RJ9A 3A6JA 2O8EA 3ER8A 3QIAA 3C41J 3SGLA 1L7PA 4Y1RA 3U4IA 4CFSA 3HB4X 3E70C 2X77A 1L8AA 3GJ5A 3UAZA 1QYXA 2C9MA 3K32A 3OURA 4EW1A 3T5DA 2UAGA 4FDAA 2BY4A 5B6PA 3KO8A 1EWVA 1Y9EA 1U3VA 2P9JA 3TFWA 4E46A 2JFYA 4CM4B 4XR9A 3WDSA 1DAHA 1G41A 4PLCA 5C0OE 3HFRA 4ZO8A 2ZUTA 2BFWA 1TAUA 4Y18A 4FNOA 5C3MA 3S28A 1U63A 2KS6A 3I5AA 3MWFA 2MSEB 2E4YA 4UEQA 2O1SA 1NSYA 3GAFA 4U4AA 3KQOA 2MHCA 3T7DA 1Z22A 1DDGA 2QRJA 1H1DA 1DKRA 4YK7A 2J3LA 1ZCZA 3AZPA 3VR5D 1ND6A 2VYNA 3VZPA 1QQTA 2V6IA 4EPWA 3WAGA 1JYFA 3LTNC 1WHTB 2H06A 4ECEA 5KEIA 1OA0A 4R2XA 5DNCA 5J2UF 2DZDA 4GR5A 4Q15A 4YRGA 2G7MC 1JECA 4CDGA 4I6EA 3IULA 4L5IA 4QICA 5IM4A 1ZXLA 3I6QA 2OG1A 5YASA 1TX4B 3ZDZB 4RMHA 5JISA 1OZ0A 2OV4A 3WADA 1XQXA 4N40A 2UYHA 1NU8A 2OGWA 2PYIA 2VPPA 3NOQA 4G0NA 3QOWA 3NMUF 1CJSA 1YU9A 2XSZA 2G08A 1ZOOA 1W5FA 2CV0A 1EU1A 3DWIA 2P2CA 3GY0A 1RXEA 2EERA 1EESA 3AFGA 3ZCRA 2J5BA 2RHRA 1OIWA 3MXTA 4PYJA 4BVFA 2HR1A 2WSMA 3K73O 1RZUA 2AQIA 1EK5A 3CW8X 3DLTA 3FPBA 1DKNA 1U31A 3CX4A 4KFSA 4DG9A 3EWIA 4FOOA 4AQYB 4KHPB 1J2EA 1WBJB 3BRQA 3CGGA 5CH5A 2UUBB 1PR4A 3KHTA 3KT8A 2V65A 1A7AA 2ETXA 5TPZD 1ZO8A 2WVAA 2OBYA 1PLKA 1E60A 3EHDA 4GYYA 2H9IA 3DOFA 3KC2A 1QFMA 5LBUA 2EGHA 1B6RA 2PVSA 3A4VA 4RWZA 3ZWPA 1PFUA 1OUMA 1Q0QA 1NXTA 1SURA 1EBFA 3C6QA 3FHLA 4HH0A 4IYRA 2LPMA 1K08A 1L7BA 2H00A 1TGVA 3ZI4A 1MAWA 3G49A 5JSHA 1WCIB 1AS2A 5E0OA 3DE6X 4TV8A 4L2IB 3TTTA 1GG8A 3ASUA 3CVJA 2QD4A 1CB7A 1ESDA 1HGXA 4GOLD 3DEHA 1PJCA 4B6OA 1CUDA 3G5AA 5M34A 2ZYDA 4R8KA 2E4ZA 4XIGS 4N41A 1SEPA 2WB2A 3WJAA 1QKJA 1SHJA 2HO5A 3GJ8A 5TEVA 4XJVA 3FPHA 3G9XA 4OK5A 2A5JA 1L0BA 4LI0A 1JWLA 2VHJA 3ACCA 2CLKB 4RSGA 4GM0A 3B6JA 3UCFA 2O57A 4Z3KA 4JHXA 5KVQA 5J4VA 4RTSA 3HDQA 3WOVA 2F9FA 3TNJA 4MV1A 1TKRA 3SDBA 4H31A 4G4SO 1WBBA 1PQUA 5ERXA 4N7BA 4EG4A 4PHHA 3GRKA 5FPYA 2ISSD 2WJPA 4MVJA 1ABBA 3GWZA 3KYJB 1FUIA 1P7PA 3RRXA 4PF1A 3NKFA 1A2OA 2JIRA 1TT5A 4J94A 5CB4B 1GGMA 4NU6A 3RBAA 1GPNA 1ZXXA 2DTEA 2H7CA 2X0NA 1DBPA 2BHRA 4LBYA 4UBOA 3MERA 1B74A 1G5IA 2PHZA 1D2CA 3U7IA 1SPXA 5IM4F 4HDNB 4B2LA 4M60A 2AJBA 2Q50A 2HL6A 2YYYA 3EF1A 1R4NA 1G21A 3M1IA 4FFVA 4OQPA 1N2ZA 2SKEA 2MDTA 1ZDMA 3GL9A 4MGYR 5KAMA 3H9JA 4YMIA 3GUCA 3ZPXA 1H6DA 2A14A 4GP9A 4XGRA 4ZCIA 1KJWA 4KUEA 1J70A 1XDGA 4CM3A 4M9UA 3V7FA 4F0JA 4QDXA 1Z8HA 4J2OA 1L7OA 5H5JA 1W6RA 2R8YA 2XWPA 4K05A 1BOOA 4ZREA 4YLYA 2OGUA 3H17A 3QLUC 1CUFA 3FLEA 4RU1A 1DGQA 3A14A 1F4LA 1ZM2A 1KR5A 3HPQA 1KI9A 3DE5X 1OBVA 4N5DA 1EQ2A 2Q3LA 3LWZA 4LXHA 4RFSA 1DKPA 3K1AA 1ZK4A 1ELOA 1M9NA 3CRQA 5ALOA 2KLHA 3ECAA 3S29A 4F04A 2VG8A 3BB3A 1RC1A 1YZFA 2J45A 5FD8A 5KX5A 5DWVA 1WG8A 4BQSA 5HBRA 4PN7A 1VYTA 2VWHA 2UYQA 3MJRA 4NYJQ 1FMTA 1TYDE 2D74A 3C14C 4BN4A 4F5YA 4INPA 2JLYA 4EJFA 1U5CA 3WSVA 1JKFA 3GMTA 5B5SA 4B79A 4QPZA 3TXAA 4UFPA 2IWRA 5BN4A 2VYND 1ODCA 2GHRA 4CTJA 1E20A 4H3SA 4BNWA 1D9XA 1YE5A 3HCRA 5EHQA 4TV8F 1F4PA 4WHMA 1C30B 3L7AA 4HGYA 4K6MA 5AVVA 5P21A 5BW4A 5BURA 1T9ZA 3MOSA 2UZ3A 2I7CA 4XPIB 4TZKA 2Y71A 5JXJA 1KNXA 2ETVA 3TR5A 3Q3IA 4I4IA 4HGPA 2X42A 4BO4A 1S2LA 3QWIA 4I4NA 4UNPA 4URFA 1LJUA 5E1MA 4NRDA 4LY0A 3KQNA 4KBGA 5JXIA 1OC4A 3JARA 4KIUA 2P9BA 4QBIA 3WLMA 2QYOA 2XSZD 1B16A 1MKYA 4KMRA 3EGOA 5FWAA 3OQIB 2DJIA 2FPIB 5E1OA 1Y3DE 2R6FA 4XR4A 5AQ1A 1AHNA 2VJYA 4M6WA 5DT2A 2V7UA 2WTUA 1O4VA 2R8EA 1KF0A 1NAHA 4NBNA 5ALRA 1DQYA 4JU8A 1Y9DA 2HB6A 2NMVA 2XUJA 2YJ5A 1OFIA 2HSZA 1XI2A 2WKRA 3QVGA 3M5CA 5F77A 4KCGA 2Z83A 4AURA 5ICCA 2FSGA 4PYOA 4P3KA 4DIEA 4DSZA 2H2DA 3K1YA 3FRIA 3K9QO 4OQXA 1A50B 5DBEX 3B7PA 3DFIA 3BGVA 2XVXA 1ATZA 2I3AA 4V3CA 4EY7A 2HYIC 1A5SB 3MFQA 1ZN2A 2H7YA 1DOAA 3A06A 4WXEA 1CZLA 5FNVA 4O0MA 3NPMA 5FEUA 4YV1A 5IDXA 3EK2A 2CLDX 3GMIA 2QZ4A 2ATVA 3K15A 4P53A 1W5TA 4BKPA 4CM8B 2A1IA 3M6AA 2Q1SA 2BYTA 1S2MA 3IT0A 2AMYA 4Q6BA 3WB0A 2HMUA 4JC0A 4R8RA 2B1RA 1JP7A 2FPLA 3ITNA 5CK4A 5BSUA 1QOPB 2HJWA 1G5TA 4UM9D 2JLXA 4MS4B 1DTWB 2XUZA 1OPXA 3MT0A 1YGYA 4XCXA 3U19A 4BO7A 1DG9A 3Q5EA 1NVVR 2ZP1A 1THTA 4C0LA 2VO1A 3H87A 3SYMA 4PE5B 5IS2A 3N0XA 1U2GA 5G1NA 1OB2A 3IURA 4JQCA 2VQSA 2UZ1B 4QJ4A 3GYGA 4ZAWA 4E4YA 2J3JA 3IAM1 2FQWA 2YOGA 2XGOA 2W42A 2IQ5A 2JFOA 5IC5A 3MIIA 3A70A 5KX5F 2GVDC 2QLNA 4F96A 4MVJD 3WDLA 5J4YA 2WZQA 1XCJA 2PJZA 3DOEA 5HXAA 3NZEA 4M36A 1DHRA 3LT2A 1J8YF 3JWPA 3QK7A 4RO0A 3RG2A 3ZWWA 5I7EA 3CLTC 4HAYA 4BVEA 3ZD9A 4YI5A 2HFKA 3OCJA 2ZSJA 1XPOA 1JLHA 1FPMA 3E03A 3T7KA 1QDEA 3E9MA 4E33A 1JSZA 2AKAB 3OG9A 2HMVA 1K6EA 1TW3A 2FPWA 1NKVA 5HTOA 1JA1A 2XWQA 3FMOB 4FLMA 4UBLA 5BN3B 1YL6A 2C92A 2JEZA 1DUSA 2C0PA 3CLUC 1GGEA 4NPHA 1KMHB 6ADHA 5IW8A 3F6RA 1ORVA 2GD2A 4GBJA 3FNBA 4JP8A 3A2NA 4MAFA 4YWJA 3G8CA 5H82A 1L5NA 4CF6A 3NHZA 5AH0A 1KDTA 1OLXB 3I2GA 1WXIA 1KEPA 4K9RA 1K27A 1C41A 4E11A 3D2BA 4L4RA 1AVTA 3BMNB 2F8MA 1N2XA 1JAZA 1R18A 3ITDA 4K9KA 3MTAA 5HSGA 1F0PA 1NLYA 1NX9A 3NASA 3BWVA 3IP3A 4JUCA 1TZCA 3OJEA 1GN9A 2H16A 1I6WA 3O5AA 2NW6A 4L73A 3WNBA 1LC0A 1Z28A 3QFRA 2FFJA 4YDRA 3T34A 4XQ0A 1Q12A 1U6IA 4L0QA 4NE2A 5A03A 4M0MA 4PQYA 4NDAA 2QVZX 3IV6A 5T4EA 1KH2A 1LWNA 2YNMA 2W2KA 4IIDA 1RLCS 1GZUA 3EY9A 4JP1A 5EPUA 2X3FA 1G8PA 3JYLA 1N92A 2C00A 1DBVO 2VP4A 3IKMB 3JQ6A 1P2UA 4NZPA 5DKFA 2XZDA 4YY3B 1T6NA 1K4YA 4FB5A 5AK6A 1MABA 1BHO1 5ES4B 1CDZA 1ULHA 4FWBA 1C7IA 3KZ1E 5FNVF 2QG4A 3U9TA 4P82A 1P1HA 1MC8A 1MJGA 4WXMA 2GS9A 1EP3B 1RQ2A 1BMQA 2IYSA 3PTZA 5AW0A 1CUCA 4Y3UA 1LDYA 3B5IA 4G1VA 2RHJA 3I37X 2DJ5A 3QKSA 3IIEA 2VQDA 1REQB 5AVTA 4JQOA 1EDEA 1Q57A 2BRUC 2HK8A 4D9NA 5E7MA 5ULLA 3T9DA 4C0QC 5TC4A 1KHTA 1G1MA 5H68A 2P5SA 4C4YA 5A6VA 2NQ2C 3OLWA 3GRPA 2A78A 1G55A 2NU6A 4M22A 1YFLA 3D8TA 1JF8A 2PZGA 3EBLA 2HGZA 1YRBA 2VAXA 4MPDA 4KNVA 4QQRA 3SJZA 2Q8QA 3MGGA 3KVYA 4MV4A 3A9VA 5EHNA 1Y4SA 5THQA 3JD2A 3VR6A 2BGGA 3RAEC 2QLTA 2GPNA 1WO8A 1XPJA 3FGNA 1YRHA 5EP1A 5EHXA 3BHNA 3JQRA 1QVVA 4NFYA 2VXYA 1XDWA 2WPNA 4MYCA 4ZQHA 2DB3A 4EL5A 2VYCA 3GBSA 3OU6A 3I9LA 3FMVA 1Q44A 3RS5A 3PPVA 1JW9B 4JBLA 4Y2PA 4FOPA 3KTOA 2IL1A 1ORWA 2ZT5A 3HN6A 3PNPA 3Q2OA 4WERA 3PCXA 3QTTA 4KVGA 2OHIA 1DIHA 2VA8A 5T8KA 1OXVA 1PS9A 2ZVQX 5C35A 2DSNA 2J6IA 3FDXA 3JYQA 3K9HA 2GN9A 4AYXA 4DSAA 1VLHA 2G1UA 4LOHA 4YCBA 5TS2A 2ZJ6A 3SLRA 3AVYA 1E9SA 2WM2A 2YWEA 1YZQA 1SKYB 1PNQA 5HFAA 5KUTA 5DRYA 3QX3A 4ZCPA 2AFIE 2HW8A 7ABPA 1RHQA 2A7XA 2B83A 4H7KA 5KWJA 4QUIA 1YZNA 1X7WA 3LRTA 2V6GA 1QO7A 1UOQA 2W6ZA 1YQQA 2GO7A 4FOLA 4H4DA 1DS6A 2FPSA 1G0OA 4MRRA 2HK6A 4N18A 3UQYS 4NZZA 2WHXA 4PC6A 3Q98A 1K6XA 2WE7A 2CL0X 3AJ9A 1G6Q1 5TARA 3TD6A 3VOBA 4QOIA 5T41A 1YS1X 4MYDA 4YAGA 4HQ0A 1XK6A 2PSJA 2Q9UA 3HJBA 3DHNA 1LTHR 5I5EA 4CKCB 1NLFA 2GO1A 1RRFA 2JS7A 1LDNA 5FH9A 3CURA 2YDXA 1NC3A 4IQ8A 3EEFA 3WL8A 2GK7A 1Y82A 1T9CA 4Q5IA 3VJLA 5CJPA 4O2BB 4U9HS 2RHHA 1USIA 4JYMA 2ZBFA 4QOEA 5E4TA 3WNCA 5KCZA 2F43A 3HXLA 1NW8A 3F5DA 3G79A 3HFJA 2V5VA 4IIBA 5AI8A 3CZPA 3MQFA 4BNMA 2AXPA 3RIMA 3WGQA 1DBQA 1OXKB 8GPBA 5J4HA 1DEXA 1P77A 3C8UA 4GVXA 1KY4A 3Q9SA 3CFYA 4PRYA 4DAOA 3KTDA 3RGWS 5DNUA 1IBSA 3H1GA 2CVPA 4UJ5A 4X92A 4E5NA 1WKVA 2J6BA 3STUA 5B3LA 1QPBA 5C5DA 3FA2A 2WI8A 1ID8A 3ZBTA 4ZCTA 4IDGA 3EQ6A 2IHNA 2VAVA 2Y4OA 4D25A 1I7DA 2G36A 3D8UA 5T4BA 1ZLYA 2Z5FA 1ICIA 3UAVA 1THMA 2PR2A 4C7BA 2QD1A 1T2NA 1ZOSA 5KO2A 3WYDA 4C3UA 4J8PA 4K1LA 1G9TA 1QYVA 4QUAA 5CT4A 3IEPA 4BRZA 2YNMD 3SR4A 4EEZA 3SQDA 1UT5A 5K8LA 3TW0A 1PI3A 4TUYA 4A0QA 3C1AA 1BDHA 2XDWA 5FB3A 1U02A 2OZEA 3KYDB 4J6FA 3DE0X 3KT3A 3O26A 4W82A 3ZJ4A 4EM6A 4HY3A 4CEJA 1FFHA 4BB9A 3IKJA 1MTZA 1FW6A 4V02A 1QBKC 3MMSA 4WUTA 3PNQA 2OLKA 3ONNA 1ZJWA 1BD4A 1I0LA 4S1NA 1IY1A 3L4BA 1F5NA 2BTOA 4ER5A 3RO7A 4DV0B 2Z58A 3INTA 3LQ1A 1E4EB 4ISCA 3PGJA 5F7ZA 3EY4A 1ZH6A 4TS4A 1Z33A 2AC7A 1JDTA 1E3EA 1IHUA 2E37A 4Q93A 1FPQA 2ZYHA 4ENSA 1NVEA 1DV1A 4BHTA 2W2MA 4P32A 4WDQA 1PK8A 1U94A 3PF8A 3KUUA 4X97A 1P1CA 1X9IA 2BEWA 3B70A 4FMCF 4NVRA 5SYNA 3R09A 1IXZA 1SUSA 2NV6A 3E8XA 3HB7A 3UWMA 1YGPA 1W94A 3VA7A 3HABA 1C81A 4B8WA 2GZ1A 3AJ8A 2GUGA 3FCAA 1FF9A 1TTQB 2QN7A 2YV4A 3BMQB 4NAVA 3RIYA 3VR6D 2D5IA 4OM7A 5ELMA 5JSZA 3T3NA 4XTCS 1P0MA 2WSYB 4X94A 5JWOA 4RAQA 3D3KA 3PFNA 4HYQA 5JBNA 4DIOA 4P4UA 3FFBA 1YVPA 3HDHA 2A5YB 3IQEA 3LBNA 5E7IA 2I76A 4KFCA 3B1XA 2CHUA 4QBGB 2WKWA 2F17A 1AMNA 1A9PA 2GZMA 3HTXA 4XLZA 3RRYA 1SUIA 4OBBA 3A0RB 3FR8A 3H5IA 2IXDA 3PE6A 4DXHA 5ITWA 2DFKB 1BS2A 4JLBA 3DKVA 1DELA 2H54A 4KYUA 3VHQA 4DT1B 2JW5A 1QP0A 4LDQA 1I13A 1GK8I 1H23A 1WY7A 4UNQA 3PSAA 1W5EA 4GHWA 4GKAA 5TQ2A 3VU8A 5FO1A 2JEOA 4AF7A 4CQLA 3FBGA 5DB4A 3GROA 3NC0C 2QTWB 1DQSA 4DBVO 4WNIA 1L7VC 1SQ6A 2JRLA 1Z4NA 2ZCVA 3G8DA 3I9V6 3O1IC 4HDSB 2J9ZB 3CKYA 4XYLA 3HP4A 3O31A 3HDYA 4Q02A 3WLIA 1NNUA 2ZSIA 4D4LA 2CSXA 4CT4B 2B1QA 3FMIA 3FFXA 4DV2B 1ZUWA 1GGVA 2VIIA 2F1RA 3IUEA 5JAPA 1DKQA 1HOTA 1KK2A 1NNEA 2P2NA 4TKVB 3JD3A 4BGVA 4RGVA 3C7TA 5DYGA 2EG9A 1YBAA 2ZW9A 3WZ2A 1GNTA 3RHTA 3ZDXB 4PS0A 2LCIA 3D8NA 1XRQA 2QPOA 2X2OA 4QTUB 2V8BA 4XUGB 1E66A 1Z36A 4O2RA 4NR0A 3GPLA 2M6SA 1MG0A 2KYRA 3HHEA 3MCTA 1ECCA 1LSJA 4ESEA 1E0KA 3DYBA 1LFDB 1KSHA 1XDBA 3K0FA 1NKSA 2BFCA 1BDIA 5HOQA 1IYZA 4M0UA 3IP1A 2E48A 4CDMA 4OHPA 2GA8A 2RGYA 1T4BA 3C74A 3OLXA 1C2YA 3LZDA 5DTIA 5JEDA 3P26A 1NXSA 1VKJA 4WL0A 5DI3B 1ENZA 2QYSA 4L08A 3REGA 5KVAA 1P4GA 2P3QA 4MGKR 2H3EA 4X3OA 1Y89A 1IUOA 4Q7EA 4RFVA 3RUDA 3T6KA 4TYMA 2NO4A 3WR5A 4RF2A 3TAXA 5AO9A 2FN4A 2REOA 4DN6A 3ASZA 3T1HB 3IAEA 3QXCA 3WSTA 2V55B 3OCWA 3TCKA 2PX2A 1XIVA 3FUVA 3CLHA 3IHKA 4TMYA 5KJ1A 3GP8A 1E59A 5JE8A 3WWDA 4J49A 3R77A 1RDFA 1YJBA 1W88B 2PMWB 1EE9A 4BC1A 3EEBA 1V5IA 3KSRA 2WYWA 4WA7A 5E7QA 4KL8S 3ENNA 3KOZA 5KQSA 4C43A 4TRJA 4TOIA 3IB3A 3MHTA 2Z3VA 4IIUA 3HMKA 3TQIA 2BTQB 5JWHA 5LYJB 4PPNA 2E4XA 4Z9YA 3DB2A 3CBQA 3EUFA 1OYVA 4GI5A 5CDGA 2CLFB 5HNKA 5CLLA 1RTKA 3LP8A 4RHCA 2O0JA 5DU2A 2UUCB 1RWBA 4DCMA 1WRBA 3PHJA 4F3NA 2BUAA 2OD2A 3G1TA 4FDTA 5BWBA 1A88A 4WXPA 5IJWA 2FZWA 4L0DA 5HS6A 3N2ZB 2WD7A 3IP9A 1NUAA 4LPKA 4RXTA 3WL5A 3FCOA 1LFAA 2WTMA 2QN6A 1W4RA 3MC1A 1MJHA 4U7GA 1QH9A 3BJIC 4MUBA 2HLPA 4I55A 4E88A 5FX2A 3M6VA 3F6BX 3IBSA 4OFZA 3SKXA 3V2UA 1PL7A 2W4MA 5IULC 4NCBA 1FMJA 2A0XA 1NG1A 3QLVC 4H1UA 4FU0A 4H35A 1K92A 4RAOA 4KXVA 1SPBS 1RTTA 4JP5A 5KIAA 1JIJA 3DKPA 2Q5HA 1ZOLA 5FT9A 5J47A 1X3SA 4QU0A 3QW2A 1GDDA 5JXHA 1WW2A 2I8CA 5HUHA 1AKQA 4ZK6A 4TQGA 3O75A 4NAHA 1CVLA 2H29A 3JV7A 3L0DA 5IC6A 5EJ6A 3JVDA 1LBEA 5DF1A 1E6CA 1T8SA 1HMPA 1LRLA 3PQCA 1EFDN 2A58A 5B1YA 1D8AA 4HFMA 4M87A 4L78A 1Y7HA 1TE2A 2JIDA 3T1QA 1JNYA 3V2GA 4ZJYA 3PQ6A 1FYEA 1ZL0A 4TS1A 1IUNA 1Q7GA 4C0SA 1GGJA 4AJ4A 3ZVKA 5K99A 4TN5A 2V8OA 3PFCA 1F0NA 2CXUA 4HD8A 1JMVA 4NATA 4CNBA 2GZ3A 3OETA 4OHUA 4WCFA 2DXIA 2JLVA 1MHTA 1CKEA 1Y7LA 3TGPA 2XUFA 4GVPA 1X7YB 3FCXA 1IBCA 2PZKA 4U02A 5E3IA 4C7MA 4DEXA 4ILEA 4FEYA 2QL5A 2J1LA 4EHIA 1NLMA 5KAPA 1A76A 1PDWA 4FGSA 4Q34A 3SX4A 3OPQA 1T6XA 4CR7A 4O25A 5EIBD 2JJ2A 4B3GA 2HJHA 2VPXA 3AWIA 3BZBA 3QENA 4I3GA 3WO1A 3AI3A 3THWA 4QC2A 1PE0A 3LF1A 4GMFA 1UOPA 1BO6A 1W0CA 3CZ4A 3L18A 3MCWA 3R5HA 2H5JA 1HZZC 4QFDA 5CIQA 5AM1A 3UJAA 3EULA 4RTQA 3BILA 1E6WA 1O5OA 5G4KB 5G0SA 3RUHA 3S2UA 3TW8B 1C9EA 1R5NA 2ZULA 3I0ZA 2FUNB 2A5FA 1KDRA 4HHEA 1X0XA 4I4TF 4Q4AA 4ZCLA 2FP3A 1JHXA 3GLKA 1G9XA 4TXMA 1RQRA 1U99A 4KX3A 5D01A 1AKEA 2ZB4A 1NMYA 3DGFC 3MGAA 1XWFA 3CT6A 4FFSA 1R6TA 1YDMA 1NN0A 1WP4A 2NADA 2WJZB 3AESA 3JQAA 1MQAA 4MWBA 1EVLA 4MEJA 2NTVA 1GAWA 1XALA 3AF5A 3R20A 4QXAA 4HT3B 2R86A 4P3YA 2V69I 1APBA 5AVZA 1ISGA 1ZIDA 2BT4A 2C83A 3I64A 2V45A 2R00C 3AO0B 1MP0A 3OM1A 3OQBA 2GCEA 1QE3A 4Q6WA 2H59A 4QARA 2J0UA 2XTJA 3U0VA 3ET5A 1T2EA 5AW8A 4YROA 2PGIA 3DOUA 3OCZA 3A6GA 4IM7A 3ZGLA 3HKDA 4LQ4A 1N77A 4D9IA 3DEAA 5EWJB 3CUVA 4LWZA 1DTEA 2NO7A 4MR9A 5E6SB 2E1PA 1I36A 3BFPA 2XDAA 3QTBA 3WV5A 4TROA 4FE3A 2H4JA 2EEZA 3AP1A 5CVUA 1HUQA 2A1UA 2EL7A 1CZRA 4CIWA 2AEJA 1BE6A 3A9RA 5MFZA 5IZ4A 5FBVB 2QTHA 1R9JA 1VB3A 4DIUA 2I9PA 5ETJA 2LGJA 3D6TB 4I7EA 4EUNA 4NECA 3OIVA 1H42A 5DM1A 3UY4A 2YW2A 3TKYA 3JY6A 3VO9A 3CC8A 4CV3A 1XHLA 2AJTA 2HBZA 4KIJA 1BDMA 4CW7A 1YOVA 5BOSA 2XUQA 3T4PA 3U4QA 2Z5GA 2COUA 1ZU4A 1E2QA 1NC1A 1L1RA 4DLRA 4B17A 5BNIA 1JHVA 3QBJA 3RUAA 5JJ5A 1AN0A 3RYCB 4JY7A 3CH6A 4HVAA 3D7MA 3RRZA 4ALNA 3JQGA 4D0GA 4YRIA 2W71A 2ZI6A 3E8SA 4KXMA 2B69A 5EUBA 1G4UR 3TMKA 4EBBA 4JYZA 4MI3A 3MJCA 4J1NA 1WMEA 2YJ6A 3A28A 1W7AA 2VYQA 3H42B 4EMSA 4CKZA 5A1JA 5FHRA 2FP4A 3OC0A 4LE1A 4CBVA 4RQUA 5L53A 2YCBA 2JNWA 1XCOA 5EP2A 4N54A 1MFZA 3GXBA 3DFKA 1WHSA 3F90A 3V8EA 5K0BA 2V7PA 1TW2A 3BIOA 3IAM6 5LP1A 3VKGA 2FOXA 3EWSA 1TZ2A 2QNIA 2QTLA 3AFOA 3IXLA 3OESA 3R5SA 4H16A 3UG6A 3N76A 5BUQA 5LYYA 3ZX4A 3HZZA 3AOEA 4EVRA 3BIFA 3PPWA 3ASYA 4MJLA 3JQPA 3F8SA 4NOKA 1JHQA 2QE6A 4XPZA 4YMSA 1QGYA 1DT3A 2IYNA 1BH6A 2Z5VA 4BV8A 2A86A 3AINA 1JIIA 4LXGA 4KRFA 1JAXA 2Q21A 3R3HA 2RHOA 1XU7A 2FWBA 2ZE5A 2PRYA 3KDPA 2PFKA 1QAMA 3DEFA 4KR7A 1ZZGA 1F20A 3U4CA 5CFNA 1YMUA 2BGRA 1SELA 2FEPA 2HCRA 1YB1A 2W11A 4R01A 2GCPA 3DCIA 3G2PA 4IVPA 4TLCA 4Y7CA 1DRUA 4YT8A 2H92A 1V8DA 5AM3A 2VYVA 3MK31 4QU9A 1KI3A 3U17A 2C3OA 4ALMA 3GRCA 1Q3TA 3D6JA 4WQMA 1EBBA 1V3TA 3RLFA 1DJPA 3MWDB 2CJFA 3ELDA 1KVSA 2ECQA 3F3SA 5KNCA 3M4XA 3TEFA 4HWRA 4LSWA 3WFZA 3FCEA 4ZYVA 1M1UA 4F86A 1FU4A 2FOLA 3N9IA 2HIGA 1PWEA 1SQ5A 4FHZA 4E0BA 3COSA 5B3JC 2JJ2D 4QGBA 3X2FA 4ES6A 1C9DB 2F9LA 5CEEA 5DEIA 2LNDA 1UKBA 2GBPA 2WU3A 1NBIA 3JAKB 2C2BA 1UFOA 5CCBA 2I9KA 4OHMA 1LZLA 4HNAB 3WJ7A 2ZBEA 3IP6A 4OH1A 5IKOA 3QEMA 4QGFA 2QQEA 3EVEA 4UZFA 4A6XA 4UM7A 2F7SA 4RJTA 4L6CA 2WYVA 2XD9A 1QGAA 4WFIA 5CFRA 2DMRA 3D4OA 3AILA 3P2MA 4RKRA 5GQSA 4AKIA 2V0NA 4D8TA 2FJPA 1KA9H 4XIFA 4ZU3A 2VDHI 4EMUA 2LVBA 2XV1A 1L2TA 1RACA 1T2DA 4NK5A 4DRXB 3ERCA 3FKSA 5H3HA 2I6UA 3JQAD 4IF6A 3BWXA 1G2PA 4LOIA 3GCWA 1WXHA 4HGZA 3OQOA 2WR8A 1MAAA 1DG3A 2V9ZA 3UHJA 5EVJA 3ZXSA 4RK5A 1HE2A 2Q2WA 5GONB 4DQUA 3IL2A 1P5HA 2VP3A 3EAQA 3E35A 3IEMA 1JPUA 4JELA 4N7RA 1YK0A 3R41A 1MW9X 1TOAA 4P5EA 1XU9A 4L22A 4R31A 2V1XA 1C9YA 1EXMA 3KSUA 1JPNA 1XMXA 1RADA 4TTSA 3FLMA 3UXYA 2PS1A 4Z49A 4M89A 1NXVA 4CN8A 2OXIA 4RBNA 3EMDA 3K9WA 3M0EA 2Y1KA 3CF4G 4ESOA 4A2CA 4HADA 1CP2A 3PXEA 4EMBA 1GFZA 3HFSA 1EJ2A 2XB2A 1R9NA 3K0CA 3M1AA 3ZE8A 3TSAA 1JZTA 3II6X 2VHTA 4AP6A 2G3YA 3ZHXA 4KR3A 2BMVA 1L9XA 1RZRA 2OQVA 1Y3CE 1PEDA 4GYKA 1BVYF 2BI4A 4KQMA 1VIVA 3HN2A 3SC2B 1UPCA 2BBOA 2ZBPA 5EIAA 4J4BA 4NJEB 5A02A 3UK7A 4CM6A 2R7MA 1GAQA 1TAGA 5IBRA 5KTSA 3CPJB 2QGNA 3UGTA 2VR1A 1NJ2A 2DOKA 4BWVA 4REQB 3MJ4A 1JG6A 1EX9A 4A8JC 1QJ4A 2V63I 2JLCA 4DW8A 3DE2X 2OXTA 4UVHA 4TKUA 5L3SA 1Y6GA 4RF5A 1VLJA 4Y9UA 3UXEA 3OQMA 3WQRA 1BCRA 4LDJA 5E6UA 3SK0A 3WLTA 5JMOA 5AR1A 2CJXA 2IEGA 3F8TA 4IGKA 3QFFA 1HBJA 4NENA 1B8NA 2RAVA 3UUEA 1IOZA 4C22A 3A31A 4PRKA 2ET6A 3H11B 3GGDA 4MA5A 5KTOA 3P0JA 4HL6A 2O8CA 3FRJA 1KPGA 3TGWA 4EQZA 1WCV1 3Q7EA 4HSGA 5KHLB 1RLDS 5E8JA 1ECJA 1QOZA 2R2GA 3GA5A 5ILGA 3VPBA 5M29A 1LV8A 5EMHA 1E2KA 2P1ZA 3P2OA 4UHDA 2QTCA 4WESA 3OECA 5F2KA 5TXGA 4ARBA 2GGSA 1QSGA 3IMEA 521PA 2X0EA 3VC7A 4CCYB 1L7QA 2BFEB 4BCBA 5IHPA 2GEDA 1PYDA 1O9BA 1G3RA 3QY9A 3I72A 2F9MA 5H81A 3H2KA 1AQJA 3RYHA 1JG3A 1WZNA 2PX6A 1JKXA 1UZAA 3G2MA 4MIOA 4G0UA 1CPYA 1SA0B 2K87A 3W9SA 3I6YA 1UW9C 1EGQA 5EKXA 1UC5B 3HGQA 4KGXA 2C96A 4OJNA 3RSZA 4F1KA 5JO0A 5K09A 2X0JA 3LY5A 1YTLA 5HFJA 1L5ZA 1NG9A 2D0OB 2GETA 3RFFA 1Q0TA 4MUHA 3JAWA 1PJTA 5IXJA 2IHVA 2ZG6A 1K7YA 4MKFA 2NVWA 1ADGA 2RC5A 4NMHA 4RA9A 5DTEA 3FX2A 4LE2A 5THXA 3T4UA 4GLBA 2L69A 3ZJYA 3PX7A 2F4VB 4RE5A 1C2TA 2O6HA 2OCKA 3IALA 4X6LA 3PEWA 4RHXA 1J0XO 2VYVD 3JWJA 1C1XA 3UHOA 2G1JA 2OCIA 1OLSB 2HJGA 3LCJA 2FKNA 4RXUA 1FX0B 3BXFA 4HBGA 1T1IA 2VLIA 5A0VA 2KWIA 5KNCD 3G8YA 1II8B 2C8JA 5ALKA 5D86A 5AKLA 3GGSA 3ETDA 4U2FA 3EE6A 4KQKA 5C4IA 5IASA 1J5EB 1E4YA 1PFVA 4DLVA 5BYKA 5BRAA 1OFVA 3E5NA 1T4CA 4R1PA 1GPJA 4BQOA 4LDNA 4DXDA 1J90A 4R68A 1UEXC 1ZK0A 3LCRA 1IM5A 4NH4A 3AU9A 3SHFA 1GL3A 3RYFB 1P7ZA 3L04A 5CLIA 1G5RA 1P2TA 1U9CA 3MCVA 2R8RA 3B6MA 4EFDA 4KSYA 3JQEA 4TX1A 4JJGA 4UXIA 3P4YA 1I94B 5JLJA 1LBQA 1XROA 3D43A 1GZ5A 3CWZA 3FKSD 2PKQO 3Q3EA 4JZYA 1NBOA 2VK4A 4W5JA 5EXEA 4GMGA 2WF5A 3PWTA 1ZL2A 5LLSA 3ZNOA 1PVDA 4P36A 4RZ2A 1U0TA 4R6XA 2ZXUA 2FWMX 1ZK3A 1DIBA 4B48A 2IBMA 2WZDA 3JZAA 2FPPA 4G5XA 3WFJA 1A72A 1N9GB 1OWPA 4B4UA 2AUTA 2ZE6A 3FTNA 4TS9A 5AW1A 3LCCA 1W0JA 2BDTA 2ZJ5A 4OGKA 4YCCA 4BXOB 1Y8RB 2ZS7A 1FFAA 2FMKA 1Z29A 2QPLA 4GX5A 5FQNA 4BQPA 5HZKA 3A2KA 1JPJA 2Y1FA 2FFQA 4NJMA 5G0VA 5CPBA 5IF9A 1XE3A 1ZITA 2RK6A 4U6NA 1RQLA 1SXHA 2ICAA 1USGA 2JFHA 2Y27A 3ESAA 2EZUA 3QIVA 4NBRA 1PGNA 4GMDA 3RT7A 3ZVLA 3J81A 4KE9A 2PGNA 4AZ3B 1QFYA 1H0RA 4LFCB 4K9QA 4B3FX 2JIBA 3O8RA 3ZGZA 1CR4A 1NL3A 3IC5A 3PKIA 4A8JB 6CHYA 2C61A 5DP1A 3C15C 2FFHA 2IDMA 4MWZA 1K8QA 4QEKA 3TQRA 4IWYA 1ECFA 5LR6A 2VDQB 4CKBB 4MV3A 1YQGA 1IL0A 2V7WA 3FYUA 4UFNA 4XX0B 2C1XA 1N5MA 2NTNA 2YWXA 1QUFA 3HDJA 1Y3BE 4TTAA 3GEMA 4XB6B 4N3BA 1KZ9A 1S4MA 3KQSA 1TEXA 4DUYB 2DLNA 3FCSB 2L42A 1TQ4A 1NVBA 4UREA 4TVOA 1TZKA 1ZN7A 2CE7A 3OEHA 5CNIA 5D5PA 4ZYTA 3H5TA 1NBWB 1GHTA 3PQ7A 3WL4A 1KDYA 1C9MA 1KH1A 3AGPA 1E0DA 3A32A 3DKKA 5ENZA 4B8YA 4TN1A 1ICEA 3BZWA 1FXWA 1L4LA 2FSIA 2QX4A 2R8OA 3UKDA 2ZSDA 3TLGB 2VNHA 4FD3A 5IZCA 3OD5A 4IV5A 2I7DA 1C0EA 1R4MB 2SCUA 1CS4C 3KXPA 2Y92A 4Y1FA 2MYPA 1PJQA 1SCBA 1O2DA 3G0DA 4X44A 3MN1A 1PTKA 2D7JA 1KAOA 4JXZA 3BEDA 1Z6PA 2P67A 2XOXA 1RVV1 4AUKA 2I2DA 3OLQA 1ZAYA 1ZVJA 4I1OA 2G9UA 1RJ9B 1YRAA 2WSBA 2W2PA 4HNGA 4WVFA 2O8EB 2QLMA 5ARCA 4Y1RB 3ET4A 5KZMB 5DLQC 4GX0A 4JJ8A 2OCXA 3D6FA 1MC4A 2GEKA 2VF7A 3D7RA 4Q7LA 4QPDA 1WXEA 4F45A 4ZI5A 1NBME 2WWVD 4JJFA 4DFCB 1XMQB 1ULAA 2BHSA 3U7FB 2DFLA 1Y48E 4ZVPA 2XQIA 4EKYA 1ZNWA 2WYUA 3I04A 1Y3HA 2VDPB 3L7KA 4JCOA 4WFJA 1CUXA 2WT4A 2ECKA 2X9GA 4I5IA 1WVGA 1UBSB 1FEZA 4Z4QA 3O6VA 4QAQA 1HDYA 5KC8A 2FSHA 3KPVA 3NETA 4F06A 5TY0A 2YV5A 4OHXA 1VJ0A 3CB2A 1KK1A 1O87A 5F4BA 2P6OA 4B43A 4YO7A 2CLSA 3QU5A 2QZPA 2WM9B 1N3BA 2Y6UA 3GARA 4NY1A 4JLPA 3LQQA 1EGHA 1A5BB 2B2CA 1ST2A 4MLDA 2XT9A 2HPZA 1FLVA 1SZPA 1H8EA 3NDIA 3WYCA 1RBZA 2C54A 4M1QA 4WNYA 1YTUA 5GM1A 1WS6A 4W1SA 1IN5A 4F9TA 3OLYA 3EOZA 2GEUA 2LZ0A 2ZJ2A 3MFYA 3P9SA 4IJUA 2OO3A 2OV6A 2BBSA 3ZU6A 4QAJA 4NS1A 2CMDA 2CVHA 2W00A 4QDZA 4I9GA 3PTAA 4KYTA 1NP7A 1MB9A 4Z0TA 1G19A 2O9JA 2F6RA 2O1WA 2WNHA 1BDJA 3EVBA 4R1QA 5IMBA 1K6IA 4EAAA 5K0SA 4MQLA 1ZXBA 3F6SA 1GRVA 2OM6A 2YOHA 1XDUA 3K4QA 4F12A 1A9RA 1N2HA 2BJHA 1SOWA 2ZIZA 2HQRA 4RKFA 4P33A 1IXYA 1J39A 1LJ8A 3GFBA 4F1JA 4ENRA 2W4IA 2AG6A 4GVLA 1ACMA 1CUUA 1JG7A 5CJJA 4U9IS 5IDYA 1YR8A 3R75A 1G8AA 2PBRA 4FMPA 1N0VC 1W0JD 4NBKA 3NBMA 4REOA 4OJTA 1FXWF 4M3NA 4XIIA 2QJWA 5JMTA 2I2FA 4KW7A 1ND5A 4ARUA 3U2QA 4ICIA 5EMKA 3CZMA 3R7NA 5JI3E 3E61A 5EKSA 4NABA 5AW2A 5B6JA 5HK9A 1T91A 4P34A 2V96A 3L4KA 2K2WA 2YJNA 4N3AA 1N78A 2TS1A 3RRFA 3VSEA 1R0KA 1V41E 5JSUA 2B8NA 4BLPA 1T1EA 1WUYA 3H1TA 4Y0NA 2H07A 4EKDA 5BNWA 1EH5A 4I1IA 1SWVA 2BLLA 3E8MA 1FQOA 4FT4A 4CMAA 4M8LA 3EPLA 3V7UA 2FWAA 1OXXK 3LLSA 4XRGA 1B41A 4HPWA 1DRVA 1FSGA 1VQ1A 3T0GA 3VOSA 4E5PA 2OMKA 2XUDA 4F2HA 5HZMA 3T94A 2VP6A 4INJA 3IV7A 2O1EA 4ND5A 4PO9A 2YYZA 3COWA 3FDFA 2YWGA 2BEVA 1Y63A 3UB4A 5D51S 5IKXA 5HEKA 2HN9A 2PE5A 2IIQA 3KEQA 4KXYA 5CFOA 1U2GC 3OEHD 1HC7A 4G84A 1TPYA 4MIYA 2XEXA 4CM5A 3WK6A 2O23A 1AV6A 3DULA 1OTYA 3AVUA 1N1GA 1P31A 5BVGA 1P9WA 3BUSA 3ETNA 3GJ7A 4FW9A 3SBXA 1TT5B 2NXWA 4IRXA 1TMGE 4F0MB 3GGJA 4X3CA 2HA7A 1KC1A 4RK1A 5AKJA 5ADHA 1SAYA 1CS0A 1HSOA 4WBNA 3O3OB 3UJHA 1SU6A 1H93A 4P31A 3VRHA 5K5EA 3KJNA 1K8ZB 5JCZA 3LUHA 3MMNA 2HRQA 3WICA 1OT5A 1WMSA 3PIDA 1DMRA 2LUOA 1ANKA 1IHPA 3JQBA 1K8RA 1BGVA 5AKYA 4EG3A 1R4NB 3B1YA 3AW8A 1CJCA 3GA0A 4JZKA 4PO1A 1G21B 3TLBA 3FOEC 2M6RA 1G4AE 1A2QA 4R2MA 1OAOC 3IGFA 2JLAA 2VPQA 3AVQA 4WKOA 1WD5A 3GAMA 4BVBA 3ZD8A 1YS7A 1TM5E 4B4KA 4X65B 4G41A 1KDOA 1NVAA 1JIXA 4C87A 1X1AA 4Z99A 4XJSA 1U1FA 3UW3A 2ECFA 3GAZA 3RS4A 5HRCA 3OQVA 3C3CA 1EUZA 1Y81A 1DBRA 2H57A 4GRAA 5ENVA 1NHGA 2DPGA 3K9BA 1I32A 1M10A 2PD6A 1GUFA 1XWWA 2PG3A 4RFSB 2NP6A 4YS6A 1K63A 1Q7CA 1IOVA 4JC5A 4WUVA 2BSXA 4QXPA 1RYBA 2PVCA 3TLXA 3KZCA 1NJ1A 1COWA 4R4JA 5KX5B 4Q7KA 1FVXA 2CDNA 2K4MA 4GSLA 1AKVA 4TL6A 4MW0A 1RMTA 1J42A 5JCOA 5BSHA 2P6PA 3BULA 5I4CA 2QN9A 4DCOA 3FPKA 1HPLA 1XAJA 1R6AA 1BX0A 2HXSA 2YNMC 4KTVE 3I8OA 5E1BA 3TW6A 3ZQJA 1C7RA 2H5EA 2YKGA 1OZGA 2AZTA 4LZLA 2JGJA 5BN4B 5EHGA 1TCUA 1U8FO 1KRXA 1JLKA 4BU0A 2EZ9A 4G0QA 3IKTA 3PEVA 4NU5A 4R84A 3AONB 4RTPA 3TTUA 2HHAA 1JEDA 2ZIUB 3HCOA 5JPIA 5AHRA 3PC2A 4M9XA 1H8ED 5EKUA 1MR3F 3I2KA 4GKVA 3L7IA 5DW0A 3SC4A 2XCSB 5CXQA 1YL5A 4RZXA 3P0EA 4MGEA 2IKSA 2W2LA 1MZPA 2JGFA 4IDPA 3U4HA 1EVEA 4RLQA 3DGEC 2IY8A 3JARB 4HEHA 3GFPA 4ZVRA 2NZWA 1VE1A 1Z0SA 1Z0ZA 2XE6A 4N0DA 4NDZA 5AOBA 1JTFA 3IXQA 4ER6A 3QYPA 2IX9A 1RC0A 3A05A 2AN1A 1ETUA 4LZAA 1L7EA 4M6WB 4UHEA 3GF4A 4YRTA 4YAJA 1EDDA 2XCUA 5BUCA 4HAIA 1SD5A 2C7VA 3OM9A 1QH8A 4L74A 4LY6A 5JC8A 3AHHA 2IBSA 1KSFX 2BVNA 3ZDDA 2UXCB 2EWWA 4M9RA 4MKGA 3DAFA 3EDRA 3RTBA 2NPOA 4KMOA 4WFQA 1JE0A 4WJKB 5A9RA 3QVGB 4TYNA 1H2BA 3NOOA 1HEYA 1P73A 2GX6A 3BMCA 5L3QA 2PWYA 4N6OA 4WT7A 4KN8A 4AN0A 2I0FA 3OFNA 4LZPA 4B87A 2FU5C 1J20A 1OAKA 3AEZA 3E1KA 2WG1A 4A1OA 5JHGB 2QXUA 1J0DA 1TA9A 2ZUBA 2R2AA 4QOFA 2BMFA 5FNVB 1OSNA 2H48A 1EX1A 2JIOA 1YMVA 4UHJA 5EPOA 3UV7A 2EEPA 5BW6B 3DTTA 3H1FA 5E7JA 4R9UC 5BQ3A 4LF7B 2JAXA 1V7CA 1GUAA 4M0FA 2BMEA 3ZGVA 6REQA 4NV0A 3U3KA 5T8KC 2HBRA 5AW9A 2B9EA 2Q0SA 1QNLA 1QO0A 1Q92A 3OT5A 5KQRA 3UIEA 4DIDA 2PY6A 1RYFA 3BTUA 4L51A 2B1IA 2GTIA 5IP5A 4JXKA 4WDRA 4MVJI 2RHWA 1SCIA 3UOGA 1D2MA 2PO7A 3KWLA 1LSUA 4OB7A 4YC7A 4P6VF 4WKCA 4JOBA 5I47A 1V5GA 2H8KA 2J9YB 3E1GA 1MH9A 1UZNA 3C43A 1GCUA 3CUTA 4U1RA 3ZIAA 5CEFA 4KDEA 2K2QB 3EVNA 3UB3A 1XLTA 2Q3HA 2RBKA 2XGMA 5BWOA 4RCZA 1ZN8A 4YQYA 1EHIA 1ZVVA 3NUGA 1UDRA 1SO8A 3LO5A 4M0PA 5LPNA 4K3UA 2WF6A 4IG4A 4S3MA 1QAOA 1SH7A 1LLCA 5AVOA 1P91A 1V4VA 3HBLA 3R5JA 1EP2B 4XJXA 4CZ2A 4JLWA 2IUEA 3S99A 2PX3A 5KJEA 3C3MA 4M99A 2VNSA 4BCCA 3HG7A 3FHTA 4Y30A 4I9NA 2I55A 2R6ZA 1RPTA 4BMCA 2P9FA 4W9MC 1KHHA 2Z95A 1IN7A 2BZGA 4RPIA 5TB5A 9LDBA 1Z0DA 2WFZA 5AXDA 1X19A 2QTBA 4PZ0A 3S55A 3K8YA 3SMVA 4TMXA 3NTXA 4G0MA 3QH4A 1Z0IA 5CP8A 1LLUA 3LWBA 2ZTSA 1UM9A 4I19A 1E18A 3HB9A 3LM8A 2QP9X 3RS2A 1MVLA 1PWZA 4DKXA 3TOSA 4U7FA 1U0SY 2B6NA 1JHAA 3O82A 3UZUA 4G8DA 2D0IA 3WGOA 3P9ZA 2FMXA 4TMVA 2P2DA 4GRIA 1DQRA 4JLUA 4WX2B 2VF4X 4ETIA 5JNSA 1U8TA 3NDPA 1ABFA 2W2KB 3TFQA 1COWD 4TTQA 2DR3A 2QU8A 2EZ4A 3CN9A 2QENA 1AQ6A 2IYQA 1CFZA 3B89A 3LFTA 4K3VA 4DJAA 3QPUA 3EN0A 1EYZA 3U7RA 3NEYA 3IR5A 4OUDB 2GVNA 4B2YA 1MABB 4C2TA 2HIAA 2XYRA 3Q9UA 1YCDA 3ZHSA 1RJGA 4WFKA 2PMDA 1M2EA 1DQNA 4LQCA 4MS3A 2DHRA 3MAGA 1NF9A 1P4HA 3BC1A 3L8GA 4IIFA 3MJHA 4MS1A 5K3AA 1F4VA 3HP1A 4ND8A 2GN4A 3AIIA 3L02A 5HIAA 1PR5A 1E1DA 4I50A 5DRTA 5T3UA 1M34E 1YFKA 1JAIA 5CT5A 3QKSB 1GNRA 4URVR 1NXOA 2DX7A 1M2NA 3MSXA 3FPJA 4OJQA 5BRNA 4DSTA 3JALA 4CTNA 3L4BC 1T0JB 4IMPA 5BSEA 1JKJA 1ZJ4A 2W2LD 3COYA 3NWOA 1XQ1A 4IOKA 3OTIA 2NU6B 3JAMA 5CJ2A 4BO1A 2IS6A 2Q1XA 3DDSA 3F71A 1B0ZA 1YR9A 3L8YA 2BWJA 2JCGA 1UFQA 3TOVA 3MWEA 1BWPA 2ZUUA 3D7LA 3UYLA 3VZRA 3GUYA 5I4KA 3HJRA 3PUYA 3RSLA 3ZX5A 3G9TA 5L4SA 2VSFA 2KHZA 3I05A 2DU8A 4URYR 4B3CA 1O5TA 4BFYA 1VRVA 5WRFA 3ZHVA 1YH3A 1CR0A 2WABA 3VPDA 3ZHTA 2AS0A 1CTQA 3KQKA 1UJ2A 1GVHA 3PLAE 3A1SA 3WHIA 5IAKA 3M6IA 1GZ3A 3IP7A 1QHFA 2J7KA 4L5BA 5JS2A 1XN4A 2WOJA 2CBGA 3BEOA 3OFND 1G59A 3ILSA 4F97A 4JH0A 1MW8X 3NUQA 1LPMA 2AR9A 1M7GA 3RLIA 4F56A 4PG8A 5BR1A 4CQJA 3KVOA 1XZQA 5DOVA 3ROQA 4TRRA 3GMDA 2HTFA 1R4ZA 4Y2XA 4BNLA 2E4UA 3ETLA 3OE5A 1GQ2A 1WX1A 4RMJA 4WZBE 2IHBA 2GK6A 1R0LA 1YF3A 1XCPA 5ALLA 1A4UA 4HKTA 4QQKA 1QO0D 2RH8A 2QVBA 3PFHA 3WQHA 2RJOA 2WA2A 3T95A 4YAIA 1KTIA 2ONJA 2VBIA 3K72B 3CH5A 3FLAA 4MWCA 4S0XA 4UOZA 1ZHFA 1COZA 3AV3A 2O8FA 4N6GA 4HVTA 1A98A 3A4NA 1X7WB 3V4OA 3SHWA 3UPDA 1Y8QA 4Q1VA 4Z7NB 3G2NA 3FMGA 1ZIXA 3M81A 4EA8A 8OHMA 1ODSA 1OY1A 3EGCA 2PRIA 4IICA 3TTWA 3ZIAD 1QPZA 2WWIA 1XTKA 1DV2A