4F9TA

Ribosomal protein l1 from thermus thermophilus with substitution thr217ala
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
228
structure length
226
Chain Sequence
PKHGYRALLEKVDPNKIYTIDEAAHLVKELATAKFDETVEVHAKLGIDPRRSDQNVRGTVSLPHGLGKQVRVLAIAKGEKIKEAEEAGADYVGGEEIIQKILDGWMDFDAVVATPDVMGAVGSKLGRILGPRGLLPNPKAGTVGFNIGEIIREIKAGRIEFRNDKTGAIHAPVGKASFPPEKLADNIRAFIRALEAHKPEGAKGTFLRSVYVTTAMGPSVRINPHS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title [Crystal structures of mutant ribosomal proteins L1].
pubmed rcsb
molecule tags Ribosomal protein
molecule keywords 50S ribosomal protein L1
total genus 65
structure length 226
sequence length 228
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00687 Ribosomal_L1 Ribosomal protein L1p/L10e family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.190.20 Alpha Beta 2-Layer Sandwich Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase 4f9tA01
3.40.50.790 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4f9tA02
4REOA 1MZPA 3QOYA 1I2AA 4QVIA 3ZQJA 1DWUA 4LQ4A 1AD2A 4DFCB 4F9TA 1ZHOA 3FPNA 3U56A 4QG3A 1CJSA 2HW8A 3TG8A 5DM60 3U4MA 1U63A 5DM70 3UMYA 4QGBA
chains in the Genus database with same CATH superfamily
3WLIA 1Z5PA 4B3JA 1KFBB 2YYSA 2F17A 4Y9TA 3U1VA 2BFFA 2G8LA 2DLNA 2IYXA 3UY4A 1WCWA 5JYEA 2CF5A 3U80A 1IXKA 1T0UA 1I1QB 1TMYA 3DAFA 3PDHA 1O0BA 1GNPA 4MUKA 3R40A 1HH4A 5LNK1 1G7TA 3ZE1B 4EJ6A 1JKJA 1NVXQ 2AIRA 3KLNA 2JG3A 5DEOA 4RW0A 2QDXA 3FKJA 4UE3S 5ALSA 4AQDA 1JHMA 4EWLA 1NXWA 3DH0A 4UNNA 4UCXA 1L4BA 1NRXA 3MQ2A 3K96A 4IIDA 1T0IA 1V3VA 3VI3B 1KI4A 1P2UA 2ZW9A 1YKGA 3PXEA 4CM8A 2FN8A 3Q10A 1FCJA 4HNAB 4OP1A 4ZQIA 2BD0A 2QVYX 3PENA 2AWOA 2G1JA 2YXNA 5CB0A 2AZXA 1FFXB 2YJ5A 1A1SA 1CB0A 3DTTA 1SHJA 3O1LA 4G4GA 1OBFO 1O87A 2RB4A 5G4LA 1GU1A 3C48A 4GPBA 4Z4FA 1GRVA 1XL1A 3WLMA 1U5AA 10MHA 1QZ3A 1MJGM 4DLRA 1W85B 2ZJZA 4X1KB 4D9NA 1KERA 2H18A 1HYHA 2AXPA 3CH7A 3CPEA 2A1UB 4PN7A 3ID6C 4LHVA 2JAUA 3HN6A 5JWRA 2AT1A 2CK3A 2PUEA 3EDCA 4E2XA 4CW7A 1HMYA 3LDAA 4E7OA 4GYWA 3C15C 5DIFA 1DIHA 1ISJA 3DXFA 1IQUA 2GYVA 2R97A 4WAUA 3M5PA 1DXOA 4L1KA 3A36A 3U4QA 4AG3A 4W8OA 1QO9A 2QUHA 1NIJA 2OL4A 2RHCA 4LRTB 3MC1A 1QRSA 1RMYA 1RBZA 4HH1A 3L8CA 4KXUA 5T64A 1N3YA 3IIKA 3TMKA 1EFRA 2D2XA 3MUEA 5IAGA 1EM8B 5SY9A 3S1LA 1SVLA 2MMCA 2R6R1 3E5RA 2AR7A 3F46A 3ZHVA 4BKRA 2XUFA 1K7EB 1VI6A 2ODQA 1JJIA 5FULA 1JR2A 3T5GA 3KZXA 3N86A 4I55A 4WL0A 1ZOOA 3H86A 2FLKA 2FZCA 3DE3X 5EQDA 3PL5A 4QXMA 1Z4QA 1C3EA 1MB3A 2ZRKA 4ZEWA 2OYCA 4JP2A 4ND6A 5G1NA 3CUEF 4YJ3A 4K9LA 5AJVB 1D03A 4AI6A 3N0VA 3WYFA 1XJQA 4EW2A 1IULA 2OSBA 5B57C 3OT1A 4O8CA 1TYCA 2VRCD 4RESA 5DO9A 3RASA 2V55B 4F96A 1CZKA 3CZPA 1ZJWA 4ARIA 4IDAA 1Y89A 5FOTA 1PS9A 1YBAA 4L8VA 1M6EX 1NBMD 1RAAA 3M49A 4K86A 1M5RA 2M98A 1RAFA 4M0KA 3CA8A 1NAHA 2FSSA 2R86A 3E2PA 4NMWA 3WBBA 4CIXA 2WF5A 5JIBA 6REQB 3H5NA 1NRWA 2PFGA 1E94E 1LPMA 1M9NA 1OI4A 1PJCA 2HLHA 2ZR7A 2NUTA 4F1JA 1RWPA 1RXYA 1ZCJA 3LRTA 4N41A 3L8FA 4RMIA 4C2UA 1KH2A 2VHVA 3OUTA 4RQAA 5LFAA 3RF6A 3AM1A 2XIJA 5FPTA 2GLUA 2IEDA 1QR2A 1IOLA 3GJ6A 2ROQA 4QHTA 5DISB 4UATA 3V1LA 1PS8A 4IDDA 1JKJB 1I6LA 2PA3A 3Q9SA 2HW8A 2FUCA 1LF5A 1WD5A 4IHKA 2Q5EA 1PLJA 2CXNA 2RGUA 3CE6A 3OY7A 4W7SA 4HV4A 5GMOA 1W7AA 4BE4A 1S3FA 4FCVA 3VDQA 2ZBRA 4LKRA 4NOJA 1UM8A 5BR8B 4Q3OA 2Z57A 4U63A 5FYQA 1NVUQ 2CFOA 4AYWA 1PFUA 2JGAA 3U40A 2CVPA 3EC2A 3CFYA 2L0XA 3OM9A 1G2PA 4XQCA 4ZAXA 4GKBA 1W85A 1M0SA 1F20A 2QTLA 2WIJA 2GZHA 4HWRA 4JJ7A 2CFSA 3C3BA 4YRCA 3WIUA 3KYDA 1E60A 4K28A 4PIPA 4TLEA 3I2KA 1LVUA 5I9BA 3WRXC 2Y0BA 5B7NA 4G0OA 3DUWA 1UL1X 4BEWA 2EJVA 2I3DA 2PBRA 1G291 2HJSA 1UZMA 1XZBA 3IUNA 3HFRA 4FGWA 4KN8A 3SQWA 3AFIA 3LFHA 1ZX1A 3ESXA 1L5QA 3DYBA 2MOKA 3U4MA 1OKKA 5BRAA 2BUBA 1H3EA 4BXOB 3IAAA 3VHXB 2V7UA 3IOEA 4F46A 1OFUX 2WWTA 5KOJB 3IOMA 2V3VA 3F9IA 4AL4A 1E2IA 1L7DA 5JZMA 5LZ9A 4QUBA 4QPZA 4EHDA 2AG1A 1E2BA 3QF4B 4F86A 3HWRA 1YZHA 4IIJB 1MAAA 4WERA 1ZU5A 1C4OA 3DDOA 4X66B 2OGTA 1KO4A 4DXDA 3GWGA 1C9DB 1V41E 5EFOA 4KP7A 2V9PA 3OQ6A 2NV0A 4DREA 4ZMSA 4NLLA 4H35A 2OXRA 3AUYA 4OJKA 4CQMA 2H4YA 4IIEA 1ULSA 2RJOA 5TARA 1XDWA 2AG5A 3M3HA 1Q0HA 2W6OA 4A1OA 4B3XA 5JZOA 1E2FA 4HNHA 2FRDA 1YUBA 3W8RA 3WGMA 5JRDS 4IHAA 1CVRA 3N05A 2GK6A 3FTPA 5HMLA 5I7EA 1SZJG 4FT2A 1Z0AA 4R81A 5JSUA 4Q6BA 4KEAA 1PAUA 3JQAA 4BATA 1Q7TA 2ZPUA 4B46A 3QSYA 1G59A 4Y6OA 4TMFA 3RK4A 4EBFA 4ND5A 1UWLA 4FOTA 4QASA 1NZFA 2VLBA 4OJNA 4KLNA 5DGHA 2WIFA 2HU2A 4E5NA 2ZB7A 4M76B 4E08A 5EJ9A 4NFLA 1JLMA 3BXPA 3RWOA 3TR5A 1EG7A 3IALA 4JL5A 5F77A 4Z7OB 4JQZA 1C0LA 4P2GA 5F1PA 3P0EA 5K0FA 4AC9A 5LOVB 4MPRA 1N6KA 1BRMA 4BNTA 1OH5A 1XZCA 4NEGA 2ZI5A 3K9WA 3DKVA 4YXFA 2Q9UA 4JHLA 4XX1A 3DNFA 4WEQA 3ZE2B 4I7EA 5AXAA 3QYAA 4PW0A 1CUIA 2MSDB 2ZSDA 4KBGA 4JR2A 1U1FA 3KQSA 3NFRA 4V0QA 1ILEA 2G06A 5LOVF 4JYBA 1QAMA 1YC5A 2OZLA 3LXMA 4H7EA 4O8ZA 4NRDA 4FYWA 5ARCA 2PUTA 1F4LA 3IQZA 2EIHA 5LP1A 2DP4E 5C1DA 3A4IA 4GI5A 4TS4A 3DKIA 3W5JA 1AHNA 1J5PA 2IOHA 1ZHOA 2JFQA 2LTAA 3RSSA 3D1LA 1JILA 2CEKA 2WK1A 3R5SA 5ETJA 4C5AA 1SEPA 3I2IA 3KOMA 4MJ7A 1B3RA 4MKIA 3W4KA 2ZBQA 3BF8A 3EEYA 3HKDB 2HQ1A 3MWDA 2JI9A 4FN5A 1J99A 4M9ZA 5YASA 1HYGA 1YBVA 1QQAA 2XV1A 2ILTA 5F3DA 4F3TA 1FYFA 1RKXA 2PSFA 3U2QA 3RM3A 4M8IA 3QKRB 1XR3A 2O05A 1GGNA 3P2JA 1A27A 2B83A 2ZJ3A 2BH2A 1Z6TA 1X3LA 4UVGA 1AGXA 1VLZA 3PGJA 1Y3BE 3CLSC 3CNNA 3IVAA 3MJ4A 2X40A 3LX4A 3K6RA 3LCRA 2IS4A 1M2WA 3HXPA 1HT1E 3WGQA 3TZBA 5A3JA 2ZG6A 3N7UA 4OQNA 2ODBA 1A9ZA 4EHFA 1EZZA 3WLJA 4XB6B 1EGQA 4OJTA 5C9ZA 4OFWA 1P75A 2PV7A 4KPYA 2CLLB 1ST3A 3K2QA 4KPFC 3T7CA 2YYAA 4GF5A 1POXA 1OE0A 3GU3A 3PVSA 4L51A 4G5FA 5B3AA 2B7BA 3SSMA 3WMRA 3T3IA 2XWBF 5HFNA 3HJAA 2ZRFA 2AXNA 1TTQB 1GL3A 1OTHA 1XTKA 1VJTA 5JCOA 6PFKA 3IYLW 4YT2A 3G1UA 3BWDD 4YRGA 4ZU6X 3TDMA 1H6CA 1G2QA 3CIOA 3LP6A 4YLYA 1WSWA 2YXEA 4ZQFA 3WNZA 5GAJA 1CEQA 5G41A 2P68A 2YIDA 1DXHA 1IQ0A 1V1RA 4JFRA 4D81A 1XNQB 4GRIA 4IR7A 1GLNA 3KV3O 4FNAA 3AMVA 4MVJI 4OHBA 5JS8A 5JYDA 3AIMA 5KSYA 5FI1B 4EAQA 3AFGA 5DXJA 3W2TA 2JFGA 3KJXA 1BX1A 1HI9A 1OT5A 1ONPA 2E1RA 3G17A 3PEYA 3ESAA 5AJUA 4KJZA 3SFZA 4QNRA 3L4EA 2QL5A 1SKQA 3MRTA 4PG4A 3NRBA 2BSQA 1U04A 4JYPA 4D99A 5G0SA 1C9KA 4IXDA 7MDHA 5D1HA 1Q21A 1OB2A 2I4OA 3TR0A 3HUUA 3GLIA 2C20A 2I3BA 3DLAA 1JDBB 3H4MA 1SCJA 3B1KA 2XUKA 4N6OA 4CE6A 4Q9JA 5J2UF 4TN1A 3VV2A 2AG0A 2PJDA 3PS9A 5GJCA 2C3PA 2B78A 1SB9A 3MEQA 2Y4OA 1YHYA 4IYRA 6NULA 4KYVA 3FB4A 2EBWA 3FHCB 4JKYA 1TLFA 3GGDA 3HXOA 1YOBA 1E6CA 2FDCA 1F6BA 3NIWA 3ZZNA 4KWHA 3UHAA 4BC0A 3WMXA 4PYNA 1J7KA 2P8JA 3K0BA 3F47A 3F7NA 3GGSA 3BZUA 3JQEA 5D86A 3SKXA 3ZHSA 3UMYA 2BTQA 4DV2B 1CERA 5FLYA 4F1WA 3IA7A 4OBWA 2I1LA 2OP1A 4CF5A 1BKYA 4ZHSA 3ICEA 3KD2A 3HUDA 5B4VA 1PDVA 2A0KA 3G3EA 1FXUA 2W2PA 1R9GA 1YGPA 2IYYA 5ALOA 4ASUD 4G41A 2PUDA 3MILA 4H18A 4NBKA 3DVAB 2B34A 3CCBA 2KLHA 4LQCA 4D0NA 1QCCA 2R00C 1WS6A 2CXXA 3VPDA 1JIKA 3PEEA 4TLBA 4YFYA 4OOEA 1OH7A 3LUCA 1Q7BA 3HXQA 4GZLA 2R6FA 1TVCA 4Z9BA 5BT9A 2BELA 2XMBA 1ZOSA 1YDFA 2PTHA 3F49S 2CDAA 3CH6A 4NU0A 4DMMA 1QX4A 5HUJA 3ANNA 1OJLA 5ALHA 1JXOA 2JFUA 4YRQA 2PU7A 3NALA 4OYYA 1QKKA 2ZJ7A 4JDPA 3Q72A 2LW7A 3RT9A 3WNDA 3I58A 1N2JA 4L8WB 3S0JA 3ZYCA 1QYVA 2XAUA 1UBEA 3TSZA 2C9MA 3C7CB 3IT3A 4P8RA 2HA0A 5DASA 4R9SA 4MW9A 1LPSA 3SPXA 3EW9A 1R0YA 3R77A 1PW5A 2PQMA 3LQKA 3U39A 1QWOA 2AK3A 1KA9H 4Q47A 4DSTA 1MG0A 3OZSA 1Z0ZA 5I45A 4NU8X 3C7TA 4H1UA 3SS8A 1R0LA 3WADA 5HTOA 4R8MA 3OCVA 4IH4A 1G3UA 2VAXA 5IAKA 4K7JA 1R6DA 2QLMA 1SUSA 3PGLA 4KPEC 2A33A 4A23A 1VPEA 5B2ZA 5H68A 3FTEA 4X1IA 5A9SA 2M6LA 3KQOA 2JAXA 2Z0MA 4UUNA 1Z3IX 1E3WB 3AETA 5FBZA 1LI5A 3C5HA 1MPTA 3RVDA 3UMGA 5BV0A 1AHPA 2XZDA 1QORA 1NNEA 1AKMA 2LDBA 2H31A 2ZE5A 1VBFA 3R3ZA 5KDLA 1XDUA 2XRZA 4ER7A 2OK7A 4Z86A 1YQEA 2JVJA 2YWGA 3QVXA 1DC3A 4CLOA 3L4SO 5C8VA 1CX9B 3I9NA 3KLPX 3NBKA 1H2BA 2DRIA 3IV7A 3IXMA 2EZUA 4CKEB 5LQJA 2I5PO 2Q3CA 1Z2CA 2C8VA 4MAMA 1YCFA 2ID7A 1KVSA 4ZO6A 3T3NA 1MHTA 1E6LA 1XMOB 1BG6A 1TAHA 5KUTA 5ENVA 1Q0QA 3FX2A 1RAEA 1UH5A 3KDPA 4OUDB 5K8TA 2RARA 2C7GA 2K7ZA 3ESCA 3P19A 4OLHA 3KYDB 3QVTA 3L0ZA 4Q7JB 2H11A 2QROA 4JX8A 2OPHA 3UXEA 1YR9A 4ZVNA 2XRMA 3REFA 5I7HA 4QZVA 2ZWMA 4M9SA 4X63A 2HX1A 2ZJFA 2R751 2WHQA 3FGPA 2BI8A 4M86A 4LOHA 2JJQA 4JLPA 3ROXA 5CD1A 4GPD1 5L3RA 4BXOA 3VHXA 2HHHB 1THGA 5EIBD 1V3TA 3CV3A 4PNPA 1JH9A 3S68A 1RZVA 3RVMA 1Z2OX 1PF7E 3N0XA 1KU6A 1VA4A 3UFXB 1C3XA 3OMWA 1F9EA 2QTFA 1YQXA 1SKYB 1IQRA 1PG5A 3B3JA 3OTWA 3SBEA 2ZJ6A 4RKEA 3U4DA 2ZREA 1XMSA 3KKMA 3WYCA 4YI5A 2EARA 4QT0A 3S2UA 2PWZA 2YVQA 3AUFA 3LQFA 2IV7A 4Q4AB 5F1OA 4G1EB 4IX1A 1EH5A 4CJXA 3CW2A 4G5QA 4MPJA 3PGKA 1DQNA 2PGIA 1NBIA 2IZ5A 4N3AA 1Z06A 5IM5A 4FWBA 2XUGA 4OK6A 4U6QA 5DRYA 4M8KA 2QTVA 3ND9A 1ZHHA 2A6PA 2X3UA 2ZRIA 1MRNA 4H0FA 5FI0B 2E4XA 4W5JA 3VAAA 2CMHA 2WV9A 3IKVA 4F0HB 1QIJA 4HDOB 4HY3A 4POAA 1F3LA 5DX0A 4WCVA 2HRZA 4J76A 2ZGVA 3ZDEA 2DE0X 3BK2A 1XEXA 1HTTA 4X61A 4UM7A 4DNQA 2PKCA 3IEXA 4M1EA 1P5HA 4B34A 4L0QA 1HSZA 3K20A 5EE3A 1F8UA 1Z8FA 3WAKA 3JQGB 4GBMA 2XNHA 3S4YA 1UM9A 4EW3A 2GRUA 5B1HA 2Q4OA 1QH8B 4D9CA 4ESVA 2EKBA 2Q4EA 1Y33E 3G02A 3SDSA 4D74A 1AURA 2WDZA 1UMCA 1P9OA 4ABTA 5A9SB 2B6NA 4DXAA 4NK4A 1KKMA 4C01A 4ZAYA 2ZKIA 2ZBPA 2ZWOA 1OD6A 4L8FA 1N4AA 5A62A 4PGGA 1ZWLA 4FR5A 4UNSA 4KO2S 5B4UA 5CG2A 2FEPA 3K09A 1L7XA 1TI7A 2EF0A 2EL7A 4HZIA 1Z73A 4JROA 4MA4A 1OIVA 3RUAA 5KJ6A 2IHZA 2J0UB 1ZJ5A 1SRQA 4PZ9A 5KYUA 4CM7A 1RXWA 1PKXA 2OXCA 3C3WA 3DE6X 3HVJA 5IT4A 4LFCB 1JXMA 2JD0A 5ALVA 4LW8A 1W88A 3I61A 1FP6A 1KFJB 1XQ6A 2NTYC 2OBLA 4LXXA 4PO1A 4AN0A 1M10A 2BCGY 3A6GA 2Z4TA 2QZ9A 5HGJA 3R7BA 1H2FA 2R48A 1C41A 1RYHA 2BSXA 2IBMA 2J5KA 1ATZA 3F71A 4KMOA 4ECAA 5ITWA 1U0JA 2VTEA 1WBDA 4ZO9A 3D5TA 3DMNA 5TMDA 1LDBA 4RIHA 3CF2A 5AK4A 4Y0VA 4U0JA 3QFSA 1NA5A 1SFRA 1I4OA 2R44A 2YS7A 3BXZA 3KJEA 4M54A 4J49A 4ON9A 1LDMA 1GZSA 1ZICA 1V5FA 2XWQA 4M8SA 1ZGBA 1L4GA 3JVEA 4CQMD 5JQGF 1P19A 4C87A 3AF5A 3K1TA 1U8FO 2HSZA 2X15A 4LE0A 4U39A 1DHTA 2UV8A 2IHTA 3R6DA 2Q1WA 1AY0A 2ZSIA 3A37A 1L5NA 4CKWB 5HWSA 4IWNA 1U4SA 3L06A 3I83A 5CUQA 5JD3A 2IE8A 4U7PB 3R9KA 1P1CA 1ND5A 1SVIA 1YDGA 4IHQA 2XW6A 1L4NA 3KZNA 2OB1A 4W5WA 4YPFA 1K63A 3BXOA 3K2IA 4TV8B 4AY3A 3E7XA 1NULA 4N5MA 2PUHA 3ZWPA 1V0JA 4QTXA 2A94A 3O74A 1R16A 3B3QA 2O8NA 3GRYA 4B85A 3MQ4A 2ZYAA 4EJSC 3HWWA 2YVAA 3E8SA 4J9UE 2IBSA 4G1UC 5C34B 3TEFA 1LU9A 1RJEA 4JGIA 5H81A 5JO0A 3V2IA 1GL7A 5F78A 4FFLA 3MRVA 1C4KA 2A7QA 3KOXA 5REQB 5JTTA 3VZRA 5JECA 3BXHA 1C3OA 2ZVJA 3DEJA 3JQGA 2CSXA 3C3DA 2C7RA 1E64A 1G5PA 4OAQA 1N33B 3E03A 3HXTA 3O82A 4FFDA 2ZUBA 2DPLA 4R1QA 1JSZA 1DWOA 2RKOA 3K5PA 2XGMA 3T95A 3FMGA 4LOAA 2B98A 4HLNA 5DI3B 3JS5A 4U0KA 3DW1X 3MYYA 4Q1AA 5ER6A 4FFWA 3SQDA 2O7SA 3F6CA 3WYNA 1SD1A 5LP6B 4LJ6A 5FOSA 1A4UA 3U16A 4E94A 3OFSA 1BHSA 3HJCA 4ZOEA 2B21A 4NBTA 5M7EA 1VIYA 1IY2A 4BO1A 1E3DA 3R5JA 1WTAA 1N77A 1OBOA 1C9NA 3V32A 3N6VA 4DT1B 3KU1A 4ZT2A 3DMDA 1F8FA 2P9JA 1E96A 2PMCA 2YMPA 1D1TA 1PG0A 3BKXA 3GJQA 3GT3A 2JBWA 1S3IA 4PGMA 3IVCA 3C39A 4ZVTA 1RZ3A 2ZEJA 1Z0DA 4HX9A 3BCHA 1C0PA 4EH1A 3ZE6A 4UD6A 4CGZA 3S28A 2XCOA 5TIIA 4QBGB 1QU3A 1A69A 1TVKB 3QTLA 3GUUA 4CMCA 1Z0SA 5LMCA 4G9EA 4XD2A 2W8BB 1AUVA 3HXKA 4US1R 2G5TA 2AEFA 4MVJA 5GGXA 2ZJYA 1JDVA 4DV5B 1JJAA 3VKUA 1VYTA 2NZYA 1I6MA 3SI7A 3D6VA 2CFIA 1CKEA 5SZJA 3UUGA 3HJUA 3QEKA 2FMKA 3FA2A 5KYXB 3DB1A 2X6QA 3SLKA 2GDZA 4X62B 1R5OA 2C2ZA 2YQZA 3IQIX 3NAMA 2OZKA 2FRVA 1NVWQ 2WTMA 5T4HA 4BKOA 1Z4IA 1WY5A 3CX7A 3WLEA 3JQRA 4XYMA 2RBKA 1VMAA 2SCUA 3NI2A 3U9TA 5K8JB 1EFRD 4PZYA 5IJ0B 3ZGZA 3ABOB 3PQ6A 4BO4A 3X1XA 1E2PA 3OZCA 3CWZA 1Z25A 1PEKE 1RE1A 1T5LA 2IIBA 3O8LA 4NMLA 4B76A 5HZHA 1KIFA 1UXOA 9ATCA 4E3WA 1Q0LA 2HIAA 2G9UA 3Q1LA 4NH0A 1HOTA 1T5TA 2OUIA 1N57A 2ZBFA 3H1EA 4TV8A 1TQDA 1FDTA 2EX1A 4GXQA 4TL8A 1DAIA 5KTSA 2ZIGA 4F21A 1G7CA 1II8A 1NJ5A 3PR2B 1JG7A 1EDDA 3PHIA 4KUGA 5DGCA 4C4PA 5KX5F 3HXLA 4UMDA 2X58A 1DG1G 3GLIE 2XLCA 3OSZA 4O1HA 5JU6A 1H1DA 3GOHA 2P9EA 2FY8A 1JQKA 3LHKA 2YYYA 2JFZA 4JB2A 2FMFA 5P21A 2RHRA 4LC1A 4HHEA 4TYMA 4L3WA 3IHWA 5AVJA 3GN2A 4XKJA 4RMJA 4LRWA 4MUNA 2I78A 3C5CA 3EJWA 4HWKA 5TY0A 1E3WA 2W58A 1C8KA 4QULA 1YZUA 3ZW7A 4C4AA 1X94A 2AB0A 1GCUA 3CSUA 2G9NA 4DE5A 2BGTA 4R9UC 2CNBA 2W6PA 1XPRA 3JQ8B 4WLVA 3FCCA 1Q7GA 1RWQA 3LGSA 3TD2A 3T7JA 4ZCRA 4YRFA 4I9NA 2DR3A 5CXSA 3FM9A 5DV9A 3U7IA 1MX5A 2FQXA 4RY9A 5JNRA 3VR2A 1VPLA 1A3CA 2WWWA 5CP8A 3N2LA 5D6NA 1FTSA 2A8YA 3G8DA 3FFBA 1NN1A 3M1AA 1PGOA 2ODNA 1M8FA 2XE8A 3RFVA 3G0BA 3AYZB 2NO6A 2ZTVA 4XWWA 3E7PA 1Q20A 4C22A 2BHLA 1KR2A 3G1TA 1Z2AA 3VR1A 1C50A 5ALPA 2C4VA 4KYIB 4B71A 1FZTA 4ZV4A 4GYJA 2D1YA 3HV2A 3P9CA 4FMDB 3GN1A 2J8ZA 3AUUA 4CLEA 4KGVA 3F4LA 4RLSA 3TR6A 5BXQC 2ZWPA 1WHTA 1TZJA 2JLQA 2FXIA 1K8YB 1K66A 3OQJA 5DBFA 2X0FA 4EB0A 2O52A 3RHZA 5CG1A 4YRAA 4RTLA 2K7FA 4KX5A 1DRUA 2AG6A 2R65A 3OCWA 3MBIA 2BFCB 4Q9HA 1T43A 5CNJA 2POCA 3KEGA 3UXHA 1KMIY 4INZA 1XMQB 3ZNQA 4V0KA 4M37A 3F7MA 3QBDA 4NBLA 5EXSA 3T7TA 3KETA 6Q21A 3VNUA 5HRCA 1UKCA 1ZMXA 3BTSA 4LBVA 3ZI4A 2PX3A 1XTSA 2YZKA 4KWTA 2YV3A 2JKZA 3LU1A 3P9SA 4G1MB 1STOA 4D98A 1U0HC 5I8WA 4ND8A 2XNCA 4JODA 3AL2A 3BEDA 3C7KA 2OQVA 2ZUWA 4TN5A 4TTPA 2P9GA 4CF7A 2NG1A 3K9HA 4E2YA 1DEXA 3EASA 4JR0A 3DHYA 1LK7A 2WMYA 3D81A 1UAAA 4DYHA 2G09A 3PDIA 1F0PA 1U5BA 2E9SA 2CNOA 2P0YA 4JHXA 1XEXB 1XJ0A 1N5JA 3H84A 3W2IA 2BKEA 5JAZA 4LECA 5ELXA 4TS9A 5JBIA 1VJRA 3AEYA 2JHCA 3VU3A 4MIYA 1ZKMA 2QTCA 1UM9B 3S7TA 4TMWA 5C32A 1VE6A 1VLQA 1DS6A 3HH8A 5FL7D 3HZHA 3WB2A 3WL6A 1QRUA 4AZSA 2NWQA 2P2YA 4FWIB 1ORVA 1WXQA 1TK3A 1XN1A 5EHXA 1N2IA 3CEJA 4CTKA 2QJRA 2ZJ1A 2QMEA 1G20E 4PSCA 1JDTA 3OESA 2QL6A 1WCXA 4G01B 1M66A 4MYCA 4U9HS 5FPSA 2ZSEA 4QFMA 4F9FA 4KCGA 2B1IA 4OO3A 1MNQA 5J2TF 1EFKA 2V9ZA 3SBOA 2J0UA 4LWQA 1JG2A 4NAVA 2R4QA 1P6XA 3BQNB 3MT9A 1ORHA 2V65A 3LC1O 3UOGA 5HJEA 5ALXA 4OYLA 4B5LA 4ZPJA 1EBUA 4G86A 3OZBA 3OIFA 2A0WA 3KTDA 1T2AA 1XB2A 3N2KB 4XQ9A 5ES3A 4ECEA 1TTTA 1BS2A 3ENVA 1MX9A 4JJFA 4DYDA 3AXSA 2AGVA 5B37A 1XRRA 1BVUA 2XNDD 3GFPA 5CXUA 4CXMA 1KVTA 1FBTA 5KTRA 2XE6A 4NICA 3SVZA 5LXTB 4KSYA 4J8PA 4KAFA 2GFIA 2FGJA 2W2XA 1OAKA 2HRDA 1GN8A 1E89A 1VKRA 4KNWA 4A0GA 4U7HA 4GUAA 1UK7A 2AJTA 1FU4A 2IY7A 4TYWA 2PX6A 4ZOQI 5ERGB 1W76A 3DDSA 3Q0TA 3QU9A 2ZZKA 3UUFA 2R3SA 4BC1A 1UMBB 3O8QA 3AI7A 4LUCA 4E07A 4ZFNA 3SHVA 5EJ5A 1NJ2A 4MH0R 4INPA 1FC0A 2QLBA 3T1HB 3LLSA 1BEUB 3WP1B 1E2UA 3GUYA 4QGBA 3TZ6A 5E1BA 3T1TA 1HNNA 2D8AA 3DVRX 4KFSA 4IDEA 3TIXB 1PT8A 3TIVA 4ZRNA 1L2TA 4MUJA 2WJ4A 2HCTA 1G20B 3E5NA 3PXGA 2UUBB 1JJVA 2LKCA 3QKWA 4LIPD 3JD2A 4DLVA 1UOOA 3V7WA 2AOTB 5LB2A 2XZTA 1RCTE 2IYTA 3HWX1 1TFUA 2RCNA 3NBXX 1KJIA 4ITVA 4JJ4A 2R8ZA 1CVLA 1YJCA 3HKCA 1IOWA 1E6KA 1LDNA 1XQ1A 3ABZA 4C7MA 3PHHA 3VR0A 1PJLA 1GZVA 1YMUA 3C3KA 4J2TA 1PJ8A 2FUG1 1ORDA 1C3OB 2Y1XA 4YJ3F 4DV1B 2XB4A 3KSAC 1QPZA 2ZIAA 3ICPA 3ZHUA 2PEZA 2OCDA 4S2UA 4X60A 1NMZA 5KJEA 3D3WB 4B48A 3E9EA 1ODKA 2IKSA 5DI3A 4U4AA 3L6UA 1EWYA 1RJFA 3DOJA 4JNCA 1NONA 3ZYZA 4HMQA 1L5VA 5FUWA 3D7LA 3D6MA 2HHJA 2V74B 2MYPA 3KAJA 1V4BA 4DWWA 1YQTA 3ELYA 3FSJX 5CJ2A 1RLCS 3DAOA 5AKKA 3Q6IA 1PTJC 2O9JA 1REQB 1HFEL 4ARZA 3F67A 1YJ5A 1VIMA 3EX7C 2JAPA 1NP7A 4P7KA 1RLOA 5ICFA 1EWQA 1NW3A 1UK9A 1J6UA 2KQUA 2AL7A 2H0AA 3AOEC 4Q19A 3PUYA 4RPCA 3TNDA 5IJ9A 1P29A 3NT5A 3OIVA 3UT5A 4OHWA 3ZUGA 1HEUA 4YPVA 1GDDA 1V48A 2AG8A 1RYMA 3Q87B 3ZCTA 4EB8A 1T6NA 1GUDA 3L4BA 1G8YA 1YHNA 2P0AA 3H97A 3SGLA 3ZG6A 3O4GA 4YYEA 2OR3A 1X7ZB 1H1TA 4NS1A 5JPIA 5I7AA 1EP2B 2I8CA 4G0XA 3B1ZA 1H6BA 3DL2A 1PQUA 3ROEA 3VR3D 3W9BA 2CCGA 4F0KB 2IC5A 2OWEA 3EHDA 4YUZA 3LHSA 3N8HA 4MW4A 3WS7A 3QIVA 5EKTA 2J5XA 2SKDA 4HFMA 5H02A 1HA3A 3UGQA 4EGCB 5DOZA 1WXIA 3VPAA 5EWLB 4ND4A 1H65A 3NETA 3L92A 3LQQA 1QJCA 3NDIA 4XM2A 2GEVA 2JIPA 1XPOA 2J3MA 1KYZA 1N5DA 4C2AA 2FF7A 3EZNA 1KO1A 3UMBA 5L4SA 1K9VF 5C3MA 2VDOB 5CVTA 5KU7A 2CC2A 2FQQA 3S55A 3PZRA 4HPXB 4L0MA 4E3ZA 4H27A 5JCJA 3M9WA 3LRXA 1ZUD1 2XMGA 9MHTA 3FCOA 1D2EA 3AI1A 2VP9A 4LZOA 5HYVA 2NO9A 4DZRA 3RC7A 2Z83A 3GB9A 2UYGA 3V3KA 3OQBA 4IXWA 1H9BA 2FPOA 3HCRA 3OPVA 1MOQA 1R6UA 1WWKA 2OSVA 2V6BA 3CJQA 3KKNA 5AUQA 1DDGA 4A73A 3JAKA 3HSKA 1HM5A 2TMDA 3M6IA 4IFEA 2WWRA 4RVFA 3T5BA 3FIJA 3Q8KA 2IP1A 3PHGA 4D80A 1WF6A 4YQFA 3CVJA 3QJ5A 3DDHA 1LQTA 5C1OA 1UPPI 2HOQA 3KDSE 1YZVA 3WL4A 3BJIC 5JS7A 4KKVA 1EDZA 3JSAA 3Q5DA 4OBBA 2GF2A 1QE5A 2AXEA 1T2UA 1W5BA 1A5AB 1N5MA 2MJLA 1WF3A 3R7LA 2RJ3A 3ELBA 4PYJA 3AEXA 3IEKA 2QZZA 2QTTA 1GQRA 3QUSA 4N9WA 3TIFA 5HR5A 5DN9A 5M2QA 4O4IA 3LA6A 5IDVA 1FMCA 2I2FA 3VOAA 2RKWA 3G0CA 3TFQA 2OD7A 3HNRA 4H17A 2I99A 1EWVA 1HDEA 4DIFA 4QEDA 3U56A 5IT5A 3UJDA 2PEYA 3G5UA 1YA8A 1ZJ6A 1ZL0A 1E3SA 5FHQA 3ZWVA 5JHGB 4JKIA 5CBPA 3ZV4A 1PNQA 1LNZA 2XKKA 4PTLA 3TOCA 3EXHA 3URKA 2WF8A 5A5EA 5IJ9B 2XD9A 4MJXA 5HZGA 1EUCA 1XDZA 4EHJA 3CE9A 4MDYA 5ALLA 1X7XB 4OPMA 1QPGA 3MFQA 3E48A 3Q8MA 2ONCA 2VBGA 3DOCA 1KDTA 2R8PA 1OTYA 4HNGA 3WLAA 5HXAA 4E6PA 2PQ2A 4KIGA 3RS8A 2NUBA 3TFOA 4QPDA 1S89A 2F43B 1XX6A 2OFPA 3IP5A 1IN4A 3B89A 3ELWA 3FHLA 4GU5A 2FG6C 4WY5A 4URXR 1YRAA 4CEHA 1J2UA 2I8LA 4YJKA 3M70A 3EFOB 5EE1A 4ZVOA 3R5HA 1UDCA 3GRVA 2XUIA 1ABEA 4MIEA 4YCBA 5E95A 1E5TA 1KZ6A 3RR2A 1GZDA 2AN5A 5IC5A 4AJ2A 2ZR9A 3N58A 4JA2A 1YR3A 3DLHA 1GUBA 3CX4A 4OI2A 3RB8A 4PLFA 3QE9Y 3TVDA 1DEAA 3L8MA 1KMMA 1ZC4A 1ZL2A 4GPZA 1X74A 4YRZA 3F78A 2NO1A 1RP7A 4WOJA 5A03A 2FSHA 1PT7A 3TINA 1O96B 2QQEA 3GVXA 1JG1A 1CU1A 3KAQA 3G2LA 3S2YA 1P7VA 2VPPA 3DM5A 4YWHA 1ORRA 1Z16A 2J07A 3GG2A 1AA1C 2R4TA 1CS0A 1P2BA 1XMIA 1MLDA 3B6ZA 3PC6A 3M8KA 5EGNA 4YV7A 1H0SA 4DTCA 1KPIA 3R23A 2V3CC 1DC8A 1UZNA 1VBMA 2DGDA 1SU4A 2RK4A 2O4UX 3CLRC 4CIDA 1K7SN 1NDHA 1M7HA 1SCAA 2C07A 2IHKA 2SBTA 2V5UA 2WOOA 3A25A 4P7BA 3T99A 3W34A 5EVCA 4CFYA 5L9AA 3FNIA 2UVQA 5CH3A 2C4WA 3EMKA 3MG9A 3TAHA 1NUPA 4PCUA 3HP1A 3GT0A 4MO2A 1RI5A 4HUJA 3PKIA 3A6LA 2CNWD 2IIPA 1PGNA 2ZAOA 2FYTA 3QFFA 3UK6A 1ZN9A 2E49A 3GEMA 3GP3A 4W1PA 1ZKDA 1WA5A 2IPOA 3RYCB 1E1RA 4E6EA 1VM6A 5IBCA 4XYGA 2YW2A 3P1JA 5DHTA 5JRJA 4IOJA 3CNHA 1ILWA 1OPXA 4BMOB 3WOHA 4TVBA 3MS4A 1SVOA 1NXPA 2IPLA 4XLLA 3CZMA 4YREA 2IP4A 4AVYA 2UYHA 2HWXA 4DPLA 1MAWA 2JZOA 3UB3A 2J5BA 2Q6KA 1CRPA 1U0SY 1J70A 2FZ4A 1NJ6A 4QOHA 1HDCA 4FFVA 1BWQA 1FRNA 1TZMA 2B4AA 3KOWA 4LJ5A 1XSEA 3FPCA 4IYJA 1VG1A 4YV1A 2PX2A 5LSAA 1XDSA 4DUPA 3JWJA 4HDKB 3K6SB 3DKPA 1Q0ZA 3EBOA 1TM1E 4L6CA 2YICA 4HXFB 4F06A 3U17A 9ABPA 3WSWA 2FKAA 1GYRA 2BY4A 3AW8A 3BB3A 4JQSA 1ZIXA 1ZLYA 3HFGA 4GI7A 2BEKA 2JGMA 1THMA 3O3CA 1HDXA 1L6RA 2EERA 2C8KA 1HC7A 5JO9A 3TRHA 5KVCA 4Q9IA 2UYQA 3GFFA 3ZZTA 1M2KA 1T5SA 3IAHA 3O8QB 3LM8A 3KJZA 4G25A 4EFNA 4LXYA 5EI5A 3C3PA 3HQ4O 1CUBA 4I46A 1WDLA 3G0HA 2M9MA 4B4KA 3LP8A 4FSDA 4L07A 1PQYA 3ZXSA 2UUOA 4NYMR 1E5VA 4H7HA 3AFMA 4LFAB 5JNSA 4FYJA 5EMLA 2W83A 3FCXA 1W8IA 4S1NA 1G6KA 2A9PA 5TGDA 3UANA 1JJBA 3UJ6A 5T6BA 2R6JA 3AQIA 3MB8A 1XLTA 3O2SB 3R5KA 2B4RO 2ZXUA 4EHNA 2VCYA 5AHOA 1V96A 2VYNA 1BJKA 3GNTA 2XYVA 2FSUA 3HA3A 4J0FA 4BZXA 3P8ZA 3W4IA 4LNUA 4CLXA 1CS0B 2P2DA 5HKAA 4KXWA 4RK7A 5I47A 1V7ZA 2C95A 4U2FA 3V42A 5IXYA 3FMOB 4PO8A 3AT1A 3V2UA 4E5YA 4TXLA 1T4CA 6REQA 3I9MA 4IIBA 4KC0A 3D3KA 5BRNA 1QKIA 1UC5B 4Y2VA 3U7QB 5LKAA 2ZK7A 4KU4A 5TDHA 2DPYA 2HDNB 1RZRA 4IV5A 1N0WA 4MWTA 4EIWA 1AM4D 2REQA 2A9JA 2HZBA 4IV0A 2YOGA 1WZUA 1CUAA 1DIBA 4OA8A 2QORA 5LQNA 4TUYF 2H1SA 1PZGA 5IW8A 1RXSA 1FPMA 2VHWA 5EESA 3A7EA 3VA7A 3UCFA 2R6HA 4BU1A 3AEKB 3MGKA 2V7QD 4IEEA 2AMLA 4I08A 4QUIA 3V8MA 1XGKA 2K6GA 2WLTA 1ZK3A 1KYVA 2CFCA 2W6JD 3GZNB 3BXEA 3IESA 3ONWA 4HLQB 4ITRC 2O6HA 3BH6A 2B99A 2HLDA 3M34A 3GGPA 2GOYA 4C6HA 3JQQA 4S2EA 3AINA 5LYYA 1TKRA 3WL8A 821PA 4IOLA 1YB1A 2O3SA 4GLOA 1L5WA 2NZUG 2C3OA 1HQYE 2HA5A 4HVTA 1WY7A 2O0MA 1XFDA 1MB9A 2J09A 4HAXA 2W0SA 1SZPA 4DZZA 4YUXA 2GEBA 1VL6A 3VMFA 4B74A 3I04M 1ZESA 1X7ZA 2B4QA 3WLPA 4BLQA 4MUGA 4WXYB 2WHPA 5FWXB 3BORA 2HJHA 4BX2A 4IF6A 4QO8A 2JFHA 2WYWA 3QUBA 4IJWA 2QRVA 1SBHA 5DF1A 4X3PA 1JHUA 3BGIA 2EC5A 3WWOA 2BEUA 4LHSA 2FWMX 1EGMB 2DPGA 2PHZA 3E8MA 4NU6A 4DUZB 2HYIC 4LF8B 2C5EA 2X4LA 2VCEA 3FPLA 3HO6A 5D3MA 4KPGA 1HK7A 5KDDA 4AWXA 4MRRA 1WV0A 2IYAA 1I7PA 3UN1A 3EGVA 5KNBA 3H2JA 1SKUA 3B52X 2G0NA 4MRVA 3K31A 3HP7A 5BOSA 5DHQA 3ANYB 4IH1A 5HCNA 4EGSA 1R9MA 4EELA 3FAKA 1OXSC 4OGFA 1BHJA 3UJ8A 1PLLA 5FUYA 1ITZA 2GBIA 3MLBA 2D2FA 1ENOA 2JATA 3QVVA 5CJPA 5LZ8A 5U9CA 2DPHA 1Y8QA 4DILA 3HA5A 1Y9DA 3UIEA 4I1IA 3T9DA 3KSDO 2JIDA 1NTRA 3FI9A 1JGTA 5ENDA 3CR3C 3UCEA 1Z9BA 2P4EA 3FKQA 3OMLA 2GK3A 4F5EA 3DDUA 4IIFA 2V59A 4K9KA 4PSAA 2VQEB 1KMCA 3JXEA 1OV6A 1BMTA 5DNAA 1M1NB 4LRYA 2RD2A 1J97A 5TNXA 3B3FA 2XZOA 3L77A 3CBGA 2H9AA 4LGCA 1YL7A 3EWSA 5TGTA 4KIWA 3GDGA 4HXEB 5F1YA 1A8PA 4DDVA 2DBVO 5FNVA 1JS1X 3GFGA 3G2IA 3RBXA 5ERYA 3RBAA 3C0KA 1H05A 3K6KA 3VU1A 1XTBA 4YVFA 3N2NA 1VP9A 3WGTA 1NQWA 2B2NA 3A9SA 1HX7A 4GDFA 4AIIA 3IPYA 4Y30A 1B8OA 3QPVA 1QWSA 3TRIA 3FHOA 2LCFA 1NQXA 5F3RA 2E4VA 4FE4A 4RORA 2JANA 2XUZA 1V3UA 1C29B 3DZIA 1YL5A 2XZLA 4MULA 1O95A 1WW8A 3OPQA 4TMZA 3AVYA 3HLYA 3CLTD 2XCUA 3RS9A 2QVZX 2Z1NA 4DPKA 4RY2A 5EVJA 5LZ2A 2I55A 4GT1A 3ICVA 3NEPX 4GNKA 3O3MB 3DULA 3SC4A 1W581 5FTKA 2ATEA 2GETA 3H8SA 4URVR 3E58A 3HKBB 3H8VA 5JSQA 1Q7EA 1QOZA 3GGOA 1M1ZA 1DEKA 1ZC3A 2GO7A 4F72A 3BMNB 2WD9A 3LXRA 4AP5A 2WP0A 1RMQA 3I5MA 5IANA 4RF3A 3NRCA 2BW0A 2ZBGA 3BIFA 2VHEA 3W3AA 3C45A 4A15A 2JJ1D 1OIWA 5THQA 1EB8A 4G23A 6AT1A 2YZ2A 4E15A 4DMRA 3OX4A 4K6MA 1PHPA 3RKRA 3TL2A 3QBTA 4Q9NA 5AM5A 4ZIRA 2Q41A 1Z63A 1RJ9A 4U02A 1GPWB 1FVXA 4LCJA 2A5DA 1FE8A 2H48A 4MWOA 1L8OA 3L9XA 1GZHB 1KQ3A 1MO2A 1TYZA 1DJPA 1Q3KA 4JP5A 5DX8A 1KJQA 2Q3MA 4PG8A 1ZM4A 2DQZA 1GSOA 4NBRA 1J8VA 2TSYB 2Q2QA 2CD7A 2V54A 3E6AA 3MOSA 3PC4A 5DRTA 4R9RA 4X1KA 4KQFA 4EUSA 1X8JA 3WWCA 1KGSA 5LBIA 3FLBA 1O96A 2WZCA 1OZAA 5BNIA 4UDOA 4N40A 1ADBA 4JJ6A 4BBAA 3AU9A 1E2GA 2MYUA 4FSXA 4RA6A 3CEAA 2EATA 4ZEOA 1Y8QB 2XB8A 3A2MA 3HDQA 3KEFA 3ZDBA 3MTAA 3BIOA 1DUIA 1R0CA 3QKSA 1QUFA 4R8KA 3V2HA 4B81A 4HEA1 1SULA 1SVDM 5DCLA 1MOPA 3BQMB 3G79A 2ZDHA 3M5CA 5JJ5A 2O54A 3DOEA 3GRUA 4MX8A 1G8FA 4TLLB 4U6NA 4ZJPA 2UYOA 2X8AA 1UFQA 2Q8QA 1I0IA 5EEGA 3FFWA 4FFRA 4EAAA 4EFDA 4Z7NB 3ZTWA 2Z2ZA 4AMGA 1ZN2A 5ICSA 2JNWA 1K8ZB 1WMDA 3OHMA 5A5GA 4I55B 4L3OA 4EFKA 2IRWA 3NG1A 3PX2A 1QF7A 2WSSD 4V1CI 5DN6A 1YJXA 3L2OB 4XPIB 3TL6A 1UANA 3OJEA 5AHWA 2DOKA 1Y7TA 2VATA 5L3QA 5BSFA 2XVZA 2XZPA 4B87A 3R7SA 2E2WA 4ERNA 1PD0A 3GNLA 5JBQA 1E2JA 1IUPA 1LKZA 3UT0A 5F9MA 3T4XA 3VDMA 3AERA 2FVXA 4FBGA 1CFZA 3V9AA 3EPPA 3H5IA 3A4LA 3GP5A 5A5DA 2P9TA 2I7XA 3AUTA 1PBTA 3N87A 1ZZEA 3H1TA 4N3GA 5C46F 1X7HA 1E9RA 1YAJA 2BHRA 3AJDA 5T8KA 5JEEA 1E1LA 5KNDD 5CCXA 1ZVVA 4BUJA 5DTEA 2AOUB 2JGLA 4JY7A 4OEHA 4F4FA 1D1PA 5D3ZA 1ZXBA 2QMYA 1LC0A 3N5KA 3EH2A 2EJBA 2NUTB 4OXQA 2I8AA 1Y1KE 2RI1A 3P9KA 2JRCA 3K6SA 2HNBA 5K4GA 4LVCA 4YXWD 3BMNA 5L4NA 1OZGA 4MS3B 1U0GA 4IV8A 1QXSA 5EN4A 3SZUA 1YDEA 4EI9A 4C7KA 4BZPA 4ZO8A 1ZJZA 4R1TA 4CWAA 1KKUA 1NVVR 1TK9A 1S8AA 2XKBA 3M6FA 4RX1A 4EG0A 5D3QA 2IYEA 1DIGA 2KSQA 2WTXA 4C43A 1IH8A 4CQNA 2PKRA 2H92A 2H51A 1GGFA 1VSTA 3BK1A 3LT2A 4K0RA 4KYUA 4YRKA 1LPPA 2OYSA 3NXKA 4K03A 3KVOA 3QOWA 4ZI7B 4KLZA 5FI5A 4E1VA 4EUFA 1KJ8A 3ACCA 4W6ZA 1R0SA 3WVNA 1Y5RA 1ZA1A 1SBTA 2LIVA 2QN9A 4CNBA 1SVKA 2DLDA 2RI0A 2GD6A 4GI1A 4AZWA 5KS2A 3G0IA 3H9EO 3DPUA 4GOJA 1J5EB 3L1VA 3L5KA 4CF4A 4MTCA 4YJDA 4YMHA 1BN6A 3C6QA 4J29A 4KQIA 4CQLB 1W34A 3A1VA 5CFZA 3NBAA 3ZIAA 4IDNA 3GLQA 3KIPA 3MWKA 1T2EA 3ZS9A 1K75A 2J3KA 3U3RA 1Y4ZA 1MC8A 3O8CA 1JSCA 3FF1A 3PEVA 4LZAA 3LWNA 4IMRA 4JOBA 4MV7A 4M0UA 3TLEA 3VO9A 1M5TA 1YIAA 3WK4A 1GCOA 1X6VA 3MGGA 3A8TA 4HS9A 1XZFA 1T4CB 3TVYA 3S1AB 5A5FA 1TO2E 4EJ2A 2VAPA 3AHCA 4DVGA 1GAQA 1TD1A 3E5HA 2V7EA 3E23A 2VF4X 3KB2A 3FTNA 1CRWG 2WJAA 3FIUA 4UARA 5AH0A 5IK2A 5B1EA 1N2BA 5L6LB 1DNPA 1GFWA 3I6ZA 1G2IA 4BVKA 4BMXA 4EF4A 2CXHA 2JGJA 3LTEA 1U8UA 3KPVA 3OKFA 4WLOA 4YX9A 1L5OA 2JC3A 1EIZA 3DMFA 2D0PB 4OREX 3EGIA 1EJ7S 4ZVKA 2GX6A 3GZNA 3ORSA 4KNVA 2WQ6A 2WSIA 1LDYA 1WVIA 1JAXA 5COAA 5TRTA 2G80A 1FSFA 4WY8A 3BFKA 2X8JB 3W5IA 4KO1S 4A9AA 2I29A 4CF6A 5KNDA 4HDNA 5AHXA 2QJFA 2W6JA 1YOVA 4KR7A 4BTVA 4QPPA 4RDCA 4QOGA 3QE2A 5EIAA 3IAEA 4RDHA 1U99A 2FPMA 3FVQA 4ZT4A 3ZZ0A 3NYQA 1N3BA 1CUVA 2RC6A 1MO4A 2W6NA 2WVGA 1DV1A 3L7JA 3LHFA 1E1CA 3NUQA 3QFRA 5IUJC 5LQCA 3PWTA 4WINA 3E2MA 3M2TA 3QVSA 5BRJA 1E9AA 1ZITA 3JWGA 3N2GB 2XUPA 1V43A 5IKXA 5L95A 2NPIA 4Y2GA 3JRXA 3D6UA 3ZQUA 2DH5A 1U11A 3ZVKA 1KI2A 1P1JA 2ZDGA 1BE1A 2AI2A 4LYHA 5H1YA 3RU7A 4OA5A 1TQ2A 2D3WA 3MD9A 3ZXUB 4BX3A 2W2VA 1CNMA 3AXKS 3R41A 3VZDA 1I2MA 5LL6P 4FHEA 4Z99A 1QQ5A 2WKRA 2WQZA 1SG9A 5CTJA 3X1ZA 5D3MB 2X5OA 3LY5A 3AR8A 1X2BA 3STYA 3LQ2A 3GT7A 2CY0A 5E1DA 5IVIA 3JAMA 2YBVB 1T9AA 1DKOA 1NQUA 4UZEA 5HQJA 4COOA 1YC2A 5CIWA 4I4IA 1T10A 1W5TA 5ECWA 5BN3B 3FTCA 4I1PA 1DRVA 3NB0A 3ZLBA 2GAIA 1OIXA 4LYFA 1UBSB 5AVZA 2DXIA 2WFLB 1JT2A 4F8YA 5BYBA 1LX6A 2X2FA 5KHOC 4QBKA 4LWZA 2NVUA 3OF2A 4BNDB 1O1YA 5JCZA 3USES 2A58A 1WCYA 3D7NA 4UNPA 1RRMA 3F9CA 1IBCA 1PR6A 1YA4A 4R3UC 4GGOA 3UQZA 2YJ4A 1Q84A 2V96A 3DMTA 4V24A 2ATIA 2G1UA 1SUPA 2NZWA 5JAHA 3K8OE 1P1RA 4H6XA 2WR8A 2CLOB 1QF9A 1FRVA 3UTDA 1CUGA 3PFFA 4DLKA 1V2HE 2HK8A 1J0DA 1NKVA 2VYCA 4IVPA 4CMEA 4D9EA 5DNUA 2XXBA 4IIUA 1JAIA 2W6IA 1JEJA 3EF1A 4ALKA 1BD4A 4NZPA 3K73O 3ROQA 2HGSA 3O3OB 1JXQA 1OZFA 4QXOA 2VUUA 4X94A 3UTCA 1F5SA 4WZBB 2XUHA 1GSAA 3RU2A 5AJWA 1AMOA 3G2KA 4NXMB 3N2EA 5F33A 4FYXA 4O2LA 3LT0A 3T0FA 4A82A 2HSEA 1ADGA 4PQYA 4KRYA 2ATXA 3IRVA 2ZE6A 3VR5H 1KP3A 3GAZA 1ANKA 3VVMA 2EKLA 1QQ7A 5JQGA 3CTPA 3LUFA 4MUXA 4RD4A 2O8CB 1XU7A 4K40A 3PF9A 3FMVA 1CY8A 1E5DA 2XCTB 5F35A 4G0VA 3KHTA 4XEHA 3BXXA 4NFHA 3ZHCA 1E6UA 5TQVA 2QW8A 1EGVB 3EVFA 1KH3A 1N2OA 5B58C 2FDRA 5T4EA 4OI4A 2PY6A 1WB4A 5I8ZA 3ZXXA 1O89A 1Z82A 2QOEA 3EDOA 2BMWA 4MB2A 4MMYB 3H87A 1PWXA 2JA2A 2QEQA 4R1MA 3D0OA 2VTKA 4KFTA 2W8ZA 4UAUA 3T3EA 2WTUA 2HPVA 1TQ4A 1KRXA 4KACA 5JT1A 1N9ZA 4RZ3A 1QO0D 3L18A 2WU4A 1RZUA 1BMFD 1OSNA 5DCWA 1FDVA 1RP1A 1X1RA 2HK6A 4FX2A 3T34A 2XMPA 4RTNA 4ND3A 1RIIA 1BOFA 1XVUA 3HACA 3PWZA 3OBBA 1QHHB 4L8LA 5F12A 4D9IA 3BE4A 3DDWA 4RTRA 4H1VA 5CB4B 1GG9A 5DI9A 4YRNA 4M8LA 3SE0A 1DT5A 221PA 2Q3HA 3ELDA 3OTIA 3DV2A 4U9UA 4OQ4A 2BZ0A 5JRZA 2XB9A 5JYCA 1NXTA 4DQLA 2VPQA 1GG2A 3LBNA 4NPHA 1A96A 3HM9A 2XCSB 3AKEA 4OSEA 4DMCA 1EWKA 1P7WA 1SQ5A 3ZU3A 4EG3A 4X90A 3TOXA 3H0EA 3D4LA 4P5PA 3W2GA 5C8YB 4N76A 1SPXA 3E9ZA 1Y5NA 4YT5A 4ZQEA 2NVUB 4HGZA 1NOIA 2IELA 1EJ6A 2DUNA 4LYYA 4Y9RA 4HOYA 4OLFA 2IITA 1M2NA 3PSHA 4FMCF 4PEVA 3ONVA 1A2BA 4FEAA 1SZCA 3CZ5A 1C3JA 4MQ4A 4OXYA 4YJ2B 2G3YA 1IATA 4PE5B 4DB2A 3N07A 1QG4A 5U4XA 1DOHA 1HZZA 1SUCA 3JWPA 1N6IA 1JDUA 3DEAA 4XB1A 2QQ0A 5HCUA 1BWVS 3S1SA 1S2IA 1JHVA 2ECFA 4YCAA 4U7DA 2H7XA 3GOQA 5FJIA 2CVOA 4H7IA 3N2IA 3MCAA 1A9TA 1VCHA 3RH0A 2GK4A 4H6WA 1EP9A 1RHRA 3PCRB 4DBZA 1OFVA 2OAQ1 1KFCB 3VO8A 1H4SA 1E6WA 2C2BA 2CD9A 5GP1A 1IHUA 4J0EA 5AM1A 1SG0A 1QAOA 4DG8A 1WW2A 1EXVA 1XEAA 1OC2A 3RS0A 3UB4A 1XELA 3DT8A 4MCAA 4MWSA 1IY1A 5HKKA 5IX8A 4KSBA 1WXGA 5AK6A 4BMVA 3RGGA 4FTWA 4UULA 2IOFK 4ZVQA 4L7QA 2ARKA 3M3PA 3M4XA 7YASA 2QRMA 1H2AS 1KY5A 3A6PC 1EUZA 1XTPA 4C4TA 3VC1A 3DKKA 2Z5LA 2OD2A 4M7RA 4YMWA 3TAUA 2B1JA 1KJZA 1ODIA 3PDCA 3WLTA 3PF8A 1W52X 1T3TA 2IF0A 3OKCA 1SBQA 4OXKA 2F3QA 1E8NA 4ER3A 3T7SA 1ZONA 4PINA 1I51A 3F3SA 2C4NA 4UVEA 2QSYA 3NH6A 3QA3E 4GKJB 1G60A 3R3UA 2EOAA 3CONA 1ZJJA 1Y7IA 2FN7A 3EGDA 2VJMB 4OK3A 2YMLA 3HMKA 2QP4A 1EP3B 2JHPA 3VJRA 3TBKA 3IO5A 1XZNA 2VF2A 3SJCA 1E0AA 1SQ0A 4OXRA 1X1AA 3NUGA 3SWWA 2ZR0A 3UAZA 3KXIA 1VLJA 2WAYA 3BERA 1QHNA 3GZJA 5LZ5A 2RIRA 3NGLA 4A16A 1LPOA 1M54A 2C88A 4N48A 1G21B 1Z22A 5FL7A 1Z2EA 2BR5A 4J6FA 1B0ZA 5JFOA 3ZCPA 1O2DA 5KPDA 3C1TA 1AZTA 2Z04A 3O90A 4JP1A 2YIJA 3NIGB 4LX0A 4OMFG 2XQFA 4ZGGA 4ZYLA 2RHTA 4UQOA 3KT3A 2DU8A 1OB5A 5KNCA 1NR7A 1XXHB 3H4TA 3QOYA 2RHBA 4JASB 3OU2A 4ACAA 4QXRA 2YHAA 2AYXA 3IUMA 3HLKA 1RTKA 4Y9SA 4YDRA 2VHXA 3RAPR 1N25A 3KQTA 3TXAA 2QXUA 1PL6A 3I64A 5L45A 1F9AA 1Q0SA 2I3AA 3EMDA 4GPAA 4FGKA 1KEEA 4TM8A 4WGFA 3GLHB 2BGRA 2YZMA 5LWHA 4W8GA 4QJ5A 2BMFA 1CQIA 5CFQA 4F6LA 1JEYB 3ULKA 3VR4D 4DLBA 4LGMA 4FU0A 4B3SB 5M29A 4BFLA 1Y8RA 2NX2A 2YDXA 3KHUA 3TKAA 1LSJA 4EZIA 2IYOA 2JARA 4TPKA 2OG1A 1XJ5A 1Z2DA 3NHWA 3ONEA 4LHXA 1FB5A 2H85A 3C6ZA 4XSVA 1QUEA 2X41A 3R7NA 1OHHA 4HAWA 2NSJA 3A6FA 3QJGA 1Y48E 3HEAA 1E0SA 1VRCA 4NE7A 4GZ3A 5FUXA 4ZVRA 4JWKA 1PZXA 3OTQA 4NDNE 4QU0A 4LYEA 2Q6OA 3ET4A 2I1QA 2IYNA 1OI7A 2OPBA 5GM2A 4AJPA 4PO9A 3I32A 1VCMA 4UTVA 1NHGA 1D9XA 3CS3A 3T3OA 1G55A 1TIKA 3E2IA 4KMRA 4LOLA 4EEZA 1UC4B 4EG6A 5KZMB 1E1CB 1O0CA 2Y76A 4A3SA 3ACDA 3G5AA 3L0DA 3OJ0A 1LBEA 4IFBA 3SXPA 1OBVA 2B92A 2ZBDA 4OMUA 1BDIA 1U4NA 1CR0A 4ZCPA 2VNIA 3LKVA 3Q3EA 2ID9A 4IVNA 1QH8A 3G82C 2Y1OA 3LKZA 4OL0A 2JHAA 2OV6A 2WBLC 4MQEB 3SSNA 5J2UA 1NQVA 4GVPA 4N49A 4IPTA 4PYIA 1UQTA 2EWMA 3H4VA 5DPMA 5I3CA 3ENNA 4KO3S 4MR9A 3H3JA 3TQIA 4A5SA 2B20A 1G16A 2A78A 3QJYA 1HE3A 3LY9A 1P74A 4G09A 2TYSB 1EUQA 1COZA 4QFDA 3ZHYA 1AVTA 4DLNA 3C98A 4DDKA 1KHHA 2IHBA 1DTWB 1JAZA 1VXRA 2BBWA 1U7TA 3DPSA 1R6AA 3PT5A 3T35A 3BGVA 2D54A 5KYUB 4Y2SA 3RVRA 4R01A 2YY7A 5DNEA 1ZISA 4AZ3B 3SHFA 1M0EA 1MIHA 1NJ8A 5EXTA 3HCPA 3UB2A 3ZDRA 1D7OA 3TWOA 5DYGA 1QH9A 1T0HB 3W8NA 1OPRA 1QYXA 2OKGA 4FW9A 2VH5R 1AZLA 1D8AA 4FZVA 2ASEA 3B6MA 5FPHA 1GTZA 2GESA 1HNZB 1DFGA 4WCDA 1WUIS 3DDZX 2ZJ0A 3PC8C 5FTWA 1QIHA 3RRJA 1HT3A 2Q5LA 3GLSA 5JARA 1MABA 5IP5A 1RADA 2IT1A 2EQAA 4MUYA 1JKFA 1HE5A 2J9XB 5AI0A 1NJFA 2E21A 3LDHA 5ALQA 4B40A 4LFBB 3TMYA 3K4HA 1T91A 1MDFA 1P45A 1JR4A 3K4PA 1FY2A 1LW6E 2QTNA 1KF0A 3A32A 4LYDA 3EBLA 4XI9A 1KFKB 3VM6A 5JMOA 2FK7A 1O5TA 2QRLA 2HLDD 3PUJA 3UJPA 4D45A 3C16C 4F38A 4CKWA 4OI0A 3D6HA 3BGOS 2H2GA 5E2AA 1MFZA 3QNMA 1XCOA 4KXFB 1LQ2A 4K81B 1FRFS 2VXYA 3B78A 1UQRA 3EEQA 3L40A 2Z3VA 3A1EA 3DTNA 1L7NA 4NWIA 2CYAA 2OLEA 3KG2A 2DHCA 2QG9A 4MS4A 4WT7A 2GPBA 4ALIA 1O0SA 2DSTA 4HFNA 1E7WA 3D59A 1Z8NA 4AW9A 4A1FA 3GFRA 1JJ7A 4OHVA 3RBVA 4IH9A 4AJ9A 4HEQA 2J9ZB 1IONA 2UVDA 3T9CA 4UU0A 4ZGBA 1V9CA 2BBOA 3H42B 1GG8A 3KALA 1R4AA 3WGOA 1MW8X 1LFDB 1D6SA 1N2ZA 2NN3C 1GNSA 5L3ZA 4TS3A 5EKUA 4DIKA 4YR7A 4ZYZA 2Q8PA 4IXMA 1E2DA 1AUOA 1E9VA 3IGFA 1YWGO 5K3DA 1H3NA 4JP3A 3R9IA 3R74A 1GTRA 2D1QA 4D97A 4EHHA 5LU9A 1KXZA 2F9MA 4HGPA 4MR9B 4UC0A 1IN1A 4RMGA 3BSSA 2ZZMA 5L40A 3SHQA 3TVTA 3FUXA 4X6UA 4F3CA 1F0KA 5CB4A 4OLBA 4PIVA 3DEIA 4GNRA 5AT1A 1DOZA 4MKGA 4G2TA 2QPLA 1ICEA 2X9GA 4W1SA 4AMYA 1BS9A 4ID3A 1L5MA 2FWJA 2UUAB 2H3HA 2HF8A 3EEIA 4Z4CA 1NR5A 1ZGHA 1UKAA 1W35A 1GKIA 4FX5A 2C03A 2XUJA 1OLUA 1V8ZA 2C5HA 2QTMA 3CO5A 3L84A 4UEQA 2CNKA 2E3JA 2PD6A 1E1MA 3HEMA 2ERYA 5EIEA 3EAGA 5FAXA 2D4HA 3AF1A 3RNLA 3IOYA 1CNEA 2OHXA 1PNTA 2YWHA 3WKCA 4ZN6A 2RHWA 4CM9A 2AMVA 3OOWA 2OE2A 4YMIA 5EL0A 3V55A 1IVSA 2EBFX 1INLA 3UV6A 1KI8A 4O1MA 2PS1A 3L1HA 3IXLA 3HDTA 4AK9A 2ZE8A 4HLDA 4UHEA 4RIIA 1G6Q1 2WT8A 3GNQA 3IBTA 3LZDA 4A0FA 2FWIA 4O08A 3CRRA 1LJLA 3NM4A 2W2MA 4IL5A 4TM7A 3SX0A 3UO8B 4S05A 1E9BA 3L7IA 5KYXA 3L49A 1TL7C 2VBCA 1FVOA 3ETGA 1THTA 1SCNE 3GPIA 1ISIA 1VL0A 3DTVD 4J3FA 2VSYA 4J75A 4Q7LA 2ZJ2A 2I34A 3OPNA 2SCUB 1LEHA 5TX7A 4YCSA 5ICMA 4PZLA 1KORA 4DADA 3OICA 3FE2A 1ISMA 5LLTA 5LP6C 4P4SB 1NVTA 1ZW6A 1W94A 1TE2A 2NTEA 4M1ZA 1USGA 4XUGB 3D1JA 3RS7A 3KR9A 4FLEA 4YP0A 4CCYB 4DQ0A 1XAJA 2PZMA 2NO0A 2VJBA 3D2BA 5FPKA 3C43A 3RJ5A 4A2CA 3FPSA 2X4DA 5TVKA 2JIQA 1TDJA 1F4VA 2C3MA 1B7GO 1G8HA 1YJ8A 3N8KA 2P5YA 4O2BA 4PPNA 1Y1RA 2X77A 1YH3A 2F3TA 3S44A 4B75A 4D6XA 1YQQA 3QH4A 2ZP1A 4Y98A 3S99A 5CBKA 1O97D 5KWEA 1QHFA 2AJ8A 4UAJA 3P2KA 3T94A 3UICA 1U0TA 4B2LA 5ICGA 1L4FA 4M21A 2EKQA 4PHFA 3GJZA 2ECQA 1M2EA 3LT5A 1FDSA 2D1RA 3B51X 3COSA 1U7UA 1Z7GA 3NEJA 1PS0A 5IC6A 4QYIA 5AVQA 1T2CA 3DBVO 2W4IA 5JASA 1E4EB 1BOOA 1N0VC 3OWXA 3A3PA 1JTVA 3NVAA 3SJZA 1YI1A 2HT1A 2OOSA 4I5GA 3RANA 3R0QA 4NFYA 4KGZA 4BMYA 1D9ZA 1OX4B 5BOVA 4JENA 2WAXA 5DGDA 1G21A 1I13A 2JCYA 1WCV1 1BW9A 4G4SP 3O75A 3OIUA 1TQ8A 1YUNA 2CJXA 4Z4QA 2GPNA 1EMDA 2AN3A 1QGDA 2EFGA 4KVAA 4RTMA 1IRXA 4TV9A 2PPLA 3DE0X 1B41A 1RYBA 1ZH4A 1YB6A 2BF4A 1PUJA 2CVHA 4D3YA 1P9RA 3EIWA 4EGQA 2VI5A 1OFGA 3T6KA 4WVLA 2QMQA 4PX3A 1PN3A 3ECCA 4JC4A 3VNAA 4EI8A 1L4KA 2O2XA 1J4AA 4UNRA 1N5RA 5CDFA 3UAXA 3ZWCA 3ZU5A 2FV8A 4WSOA 3M82A 3GLHA 4HAIA 4N8EA 1RJGA 2AKAB 3SQLA 2PZJA 2Q7XA 1NUHA 4CM6A 3U60B 1CJVC 4KR0A 4UUPA 1F3OA 3W5UA 5CVDA 3FSRA 2ZI3A 1X7WB 3D4PA 3RABA 4NENA 2MYNA 3CN9A 3AWIA 4P86A 1DV2A 1Y3FE 3USCS 4GKAA 1DBPA 4DMGA 4ERXA 1MO6A 1Q17A 4X0EA 3MGAA 3TGPA 2GGSA 1FRQA 2JLZA 3SLGA 2QPOA 5LIRA 1T1EA 1TJ3A 1XA0A 2CWWA 1KSFX 3ZK8A 1NF3A 3OFNA 1G5FA 4OQYA 4E33A 1N0UA 3H83A 1U8ZA 3ZBTA 5C37A 2WUGA 2YNMA 1E92A 4BO6A 2V7VA 1IXRC 1ESMA 1YSCA 1B73A 1QBKC 2VJQA 4AYXA 1APBA 1WDTA 1IBSA 4E4YA 1KP9A 4WW0A 1HXHA 2IE0A 4IHJF 2F1IA 4UEKA 1K8QA 2WICA 1A5TA 3CZ4A 4KK3A 2BYTA 1QRDA 3X1JA 3IBYA 1PGPA 3ER6A 4IGAA 1AKVA 2Z3ZA 1LLQA 4US2R 3EF3A 1P62B 2JFYA 2BKVA 3KOZA 3ZJYA 1GZ5A 2Y9MB 4XXHA 4PY2A 4HUQB 1M73E 3BFVA 4GBGA 3IQDB 1FVFA 2VSOA 4V38A 5DCUA 1M67A 1BKSB 1WSDA 1W6UA 3E3OA 4W1QA 1QAQA 5D01A 5H3HA 5UKDA 2JAQA 3KT8A 1XZHA 3LYUA 4C9BA 3N8GA 1IJKA 2OHHA 1LZLA 4RTPA 1GEEA 1C81A 1PU2A 3IBCA 3FFXA 4JLWA 1MTOA 5T6MA 1HSOA 4FJ2A 1XHFA 4OUKX 1SQGA 1QGZA 1QLJA 1QSGA 5K3CA 3E9RA 3U4CA 3SIWA 2C0PA 2GKSA 3SOZA 3TQTA 1L5HA 3KPJA 1OX4A 2BEVB 2CDNA 3O47A 4MI3A 4LK3A 4F4UA 4KSCA 3SZMA 3KEQA 4A26A 1CZHA 1P7ZA 4I6JA 4KQ9A 5HUQA 1TCCA 1MFPA 3SJ7A 1TAGA 2BMAA 1KBQA 1UXKA 4WCFA 4DGSA 3SK0A 2ZIVB 1PFQA 4RHTA 2N1BA 3JARB 3U26A 4D5EA 3HFJA 4Z7JA 3N2ZB 5EMHA 3UG7A 4GI2A 3VVLA 1JF8A 2J4CA 5C7OO 4M22A 1WEKA 1RWMA 3OKAA 4MWZA 2JFVA 4CG3A 1WU8A 1Z18A 2OHJA 3A11A 3IMFA 3STXA 4CBVA 1C4WA 4CN9A 3I9OA 3RRFA 5FNZA 3SQXA 2GJAA 2OCIA 3BTVA 1KNQA 1W93A 3NWJA 4HAUA 4IQ4A 1P5JA 3BJZA 3Q3HA 1X7DA 1ZAKA 4WDQA 4RU1A 4XJVA 4CLOB 2NT3A 4XVQA 2D62A 3FCEA 1Q3TA 1VE1A 2HQBA 2FUNB 3TLZA 2ZIXB 2H0QA 1DX6A 4TT8A 3WGYA 1AZWA 2C5SA 1IK4A 4MDFA 3TJZA 3U3DA 1XO1A 4CUKA 4HN2A 1K86A 3R9WA 3ZDQA 3RT1A 3HVRA 3PRKE 4O33A 3EQ8A 2VTDA 3BIXA 2AOTA 3L0OA 1TUGA 1TA4A 4PYRA 3BHIA 1E9EA 3H2KA 1DEHA 2CLMB 3I9FA 3PUKA 2QR3A 4NQZA 5ADVA 2ATVA 5ECDA 2F3RA 3Q7PA 3PGVA 2ESRA 4CT0A 1M6YA 4W9NC 1RPZA 1SVSA 1XRLA 2OFXA 4AX8A 1JSXA 1G2OA 2YFKA 2RGYA 3M1IA 4K2AA 1IZ0A 4Y2RA 1OR8A 3PNOA 3CXUA 3ED5A 3PJGA 4KIJA 4DBVO 5JLJA 3HC7A 3G1WA 3MAJA 1EX9A 1LI4A 2IPAB 3FVTA 4G5YA 1DT3A 1R6XA 1OZHA 2XBMA 1FTWA 1M72A 1MO5A 1PQWA 4E5PA 5KNBH 4LHWA 1ISSA 4D4GA 1UFOA 4ZP1A 3KQHA 1NYRA 1PR2A 3H2SA 3OHPA 4M7WA 4RVUA 5JQWA 1A9PA 4R1NA 4JIMA 4I9FA 2OFFA 3RTGA 2JEYA 3SZOA 1JU9A 3MLAA 2KHZA 1Y4UA 1WVMA 3A3OA 3HR8A 4LSWA 3OT1B 4I5IA 1DMRA 3LZCA 4LYGA 1N34B 4OFXA 3MS2A 1SCKA 1OLUB 1NFQA 2QTWB 3FMPB 2G71A 1M2OA 3K5HA 4OKNA 3VPXA 4YMVA 3PTZA 1A7JA 2ZJ4A 3LX8A 4XIYA 3W04A 4AECA 1O94C 4J2OA 1T9CA 1T29A 3X44A 5LKRA 1R64A 2F8TA 1UKBA 3OMXA 1DKMA 2CXSA 3JQPA 1VI2A 1HDOA 2GHTA 2WVJA 4JJGA 2PMDA 2YASA 2NU8A 1ABFA 2FRDC 3FPEA 3TKLA 4LWPA 4DCTA 1YFZA 3PTLA 2JAOA 4GSYA 1GA6A 1KAQA 3NTQA 4EABA 3AEZA 4I4TF 4QJ3A 1JG4A 3TQFA 4OHPA 3FWPA 3NHMA 1XTTA 3WDMA 3NASA 4LSGA 2IUTA 1T4GA 1MAVA 1Q7RA 1Z45A 4QHYA 3WLKX 2QVLA 1Q15A 4ADSG 5KEIA 1TJYA 3RAEC 2EFEB 2PUGA 1QNFA 3LP5A 3BRSA 3E5MA 4URZR 3KYBA 3ZUPA 4F93B 4MVXA 1PZNA 1UJ5A 4G3XA 7GPBA 1U6JA 4CNQA 2QD5A 2IDKA 1CQZA 3ILVA 1JEAA 1Y9AA 2OLJA 3JU3A 4EL0A 3L0CA 3OLCX 1FFWA 1D5WA 3BRQA 4RJJA 2OK8A 4JYZA 3J81k 3UAYA 2DJ5A 4UFNA 3DCYA 1SY7A 1VPWA 1GTG1 4TRRA 4NAHA 1SELA 5IKOA 1VOTA 2OCGA 1W48A 4ZTZB 2E87A 5BYJA 5I01A 3G7NA 3D0QA 1BSVA 1T1GA 4W9MC 1U2DA 1LY1A 1XXLA 5H8WA 4HAOA 4LXIA 5DK4A 4C7OA 1ECGA 3VKFA 2FW0A 1ZCBA 3M0EA 4HDSA 2EYQA 4R6WA 2BZ1A 5EXDA 5IG2A 4ILEA 4BJ6A 1EFPB 2PFSA 4TSFD 2X1HA 1AKEA 5SV2A 4KN6A 3QFHA 4ANFA 4DMHA 3G7SA 1X87A 1P6UA 4Y1GA 1OLSB 3C4JA 1PYOA 1L5SA 1XTJA 2BGKA 1ZINA 4P22A 5CIQA 4WXRA 3HHPA 3NQ41 1WW3A 3DF7A 1NLYA 2VSXA 5HS4A 3BMQA 1N8SA 3DB2A 4B7CA 1YVDA 2ZB8A 3P4YA 4N03A 1K27A 4C6TB 2AC7A 1Y6GA 4O4IB 2GMWA 1YKFA 5HFAA 2QV0A 1QE0A 1JUDA 2C0QA 1IOZA 2YS6A 1VJ0A 1I4EB 1G3MA 4TRMA 2YYZA 4YUWA 3UWPA 3HVHA 1R0ZA 3U3ZA 1C30A 1ECFA 1JE1A 1PR9A 2Y1WA 4YRLA 4LJKA 5K1ZA 2GJ8A 1XEWX 3I01A 3SIPA 1NE7A 3U9SA 3WBKA 4B3RB 3ER9A 4DQKA 2Y67A 1Q19A 1UDBA 4N6GA 1F2UA 2A84A 1KEKA 2BRUC 1LBQA 2FSVC 1C1YA 3H2BA 4N5NA 2VJAA 2QNRA 4ZREA 4RUBS 5GWXA 3TW0A 4HYEA 1FP4B 2CXPA 1KFEB 4DMUB 4ENUA 3RADC 2Y1KA 3HYCA 2CHQA 2EL9A 2H1CA 2J9FA 1BHO1 2NXCA 3DZ8A 3SP1A 4QU9A 3F7TA 5T3YA 3WSTA 5JD4A 2ZI9A 1PEDA 4YO7A 4G07A 3W6ZA 1QFXA 3QX3A 3AVWA 2X4GA 1NM5C 4GMXA 3F3YA 4BB0A 2CE7A 3GJ0A 2EEZA 4R2XA 1SBIA 5BUQA 4DCUA 4OX9B 1SK8A 4CIWA 2P6RA 3EA4A 1YBFA 4W5QA 2Q9AA 4H1HA 1ONNA 4KOAA 1JVBA 2QVCA 3TB6A 2R8BA 4MRNA 2DCUA 2M6SA 3GY0A 3SKVA 5ALMA 5BR4A 1MR3F 2ZPAA 1FJGB 2HUPA 3NFYA 5CDUA 1O97C 1SOUA 3NC0C 4K6GA 4BWGA 1ZWKA 1V8OA 4NJEA 3S8EA 3OCYA 2D6FA 3AZOA 1D4FA 1SD2A 2AN4A 4RK5A 4UEWA 4UUOA 1VMKA 1ZXXA 2IXGA 2Q1SA 3C6XA 4HDMB 4FEGA 1EZ4A 3BDIA 2QR5A 4JC8A 4K9OA 4YTEA 4DEVA 2VVTA 3MWYW 3IT1A 1ISGA 1I1HA 4P81A 1NC3A 3F98A 3T3MB 3TLGB 3TLBA 4J16C 1LXCA 2FF5A 2G25A 4L9SA 2Q3JA 3RUDA 2EBUA 3SC6A 4QGGA 3X3HA 1GZ6A 2MCFA 4FXPA 3P0HA 4DDUA 2Q5CA 3L8DA 4XH9B 3RJZA 5MFPA 3U7GA 1GPYA 2GN8A 1WDDS 2HMUA 3UGTA 2F8SA 3QPDA 3C24A 2Y0EA 1WKVA 1DG3A 5AKIA 5ABPA 5IFKA 1KQFA 1YACA 2X14A 4ENQA 2ADOA 2J46A 4OB7A 4RCYA 1L5FA 2BFPA 5CM9C 2RGGA 3H1AA 1D0IA 4LVOA 3RVJA 3THRA 2VQDA 3Q7RA 4BDTA 4BWYA 4DR5B 2UU9B 3K92A 3U49A 4BIIA 5IF9A 1SK9A 1YB4A 2R00A 4YC7A 1EFPA 2W2KB 4NMMA 4RD6A 2DKNA 5KINB 2FPLA 4RSMA 3OLZA 2Q2NA 1OLSA 5I7FA 2VOEA 4IS2A 4B7XA 4CIBA 5E9QA 1ZVJA 4ZDKA 4WVFA 3PPIA 4D3SA 3OT4A 3A4NA 3BYZA 4YRRA 4B32A 2PR2A 2QGFA 4TKVB 1S1CA 3U7FB 1ZR2A 4ZI3A 3U4AA 4BNIA 1RACA 1G38A 3FPAA 3UBTA 1H2ZA 3KTAB 2Y0PA 5FLKA 1SD5A 1V37A 2WIDA 3KB6A 3NBYC 1LW7A 3IE1A 5FOXA 4RKRA 1T15A 3GHYA 3SZRA 1PYGA 3BXGA 1RHUA 4H3HB 2ZT6A 4QGAA 4ZMRA 4W82A 5TV2A 1Q14A 3QXXA 1AB5A 5DM4A 2MIIA 4BVLA 2KYRA 2ST1A 4NYIR 1MAHA 1C9JA 4Q03A 1F2UB 1NLMA 2CCKA 4TKUB 4YV0A 1JHOA 2GR9A 1RQLA 4J1TA 2V58A 1JG6A 5KKCA 1ECPA 4DC0A 4O4LA 2W6ID 2B82A 2JL1A 3L7CA 1K4KA 2XQKA 1DJNA 5FPQA 1UBOS 3LWBA 4KWEA 3NTLA 4R5MA 1ECCA 4PR3A 3C7AA 1MGPA 2Q1YA 1QV9A 2WFAA 5D51S 4Q39A 1IYZA 1ECLA 5EE5B 2CV1A 3FTDA 5I6DA 2WHYA 5J4KA 3FHTA 3JVDA 4G0WA 2VRCA 1YIOA 2D7CA 1KAMA 3RLIA 5LM3A 1O03A 3HN7A 4R0MA 2X9QA 2OGSA 3I05A 3M7IA 5TS3A 3UJ7A 3ZS8A 4OXXA 2XXAA 1V5EA 3OOJA 2XUDA 3WZ2A 3LCUA 3PXXA 4ACBA 3OF5A 4N0PA 3D7KA 5KTOA 1XTZA 4M4SA 1LTHR 4QATA 3AILA 7ABPA 2QTBA 3DOOA 4I4NA 1JDBC 4WN9A 1E2MA 3V80A 1G4UR 1T0PA 1JL3A 1AQLA 3F4KA 5CVUA 5C80A 1UBNA 2QA5A 3OD1A 3SM3A 4MV8A 3MWEA 3RBZA 1AUSS 1ICIA 5CAEA 1ACJA 2QMHA 2IWHA 5M34A 4EX6A 1DBQA 3AR6A 5G1OA 2ZB4A 3SVLA 1WQ4A 3IBSA 3JYPA 5AQEA 2CLFB 1DC4A 4PRZA 5DNDA 1I5EA 4KWCA 2QG4A 5DHUA 4EB3A 2VWPA 2IFTA 1KSGA 2MDTA 4KV7A 5B1YA 1H2RS 1LTQA 1R0KA 3B1YA 4UM9D 1NVBA 4X97A 4R2MA 3COVA 2BI7A 1BO6A 3MJEA 1YTUA 1OYOA 2AW5A 2WMDA 4I4LA 4IJVA 4U2BA 5DTRA 1B1AA 1MVNA 4AF8A 1NW7A 3HSSA 1N5IA 2XOEA 3N76A 1FZQA 3QHPA 1VIDA 2IIQA 4W63A 3JQ9C 2F7SA 3NYWA 1ES9A 5KNCD 5GVSA 4YV2A 3S81A 1JHXA 4HZUA 4WNYA 5KMGB 4JA0A 2J41A 1XCBA 2QMZA 5H0IA 2I62A 5K3FB 3I8OA 2B69A 4BGUA 2XHZA 2OCLA 5JDCA 4ZOAA 3B6JA 5EINA 1FJXA 2WNIA 3GEEA 1J0BA 4UM5A 5KX5A 1L3IA 3V00A 3QU5A 2H9IA 1NY6A 2XMZA 3GAMA 4RLFA 2BGMA 5DVZA 3ZPXA 1CYDA 4K8RB 1AXGA 5A6SA 2A0FA 3MN1A 4BKQA 3SHOA 2QN7A 1DRWA 1FQOA 1G1MA 4Q3NA 3I1IA 5DLDA 1XKTA 1Q57A 5JMTA 1M2OB 4RY8A 2XYPA 1VHLA 3PGMA 1DRKA 1T6ZA 1A98A 5BW6B 2MSCB 3QY0A 1PT5A 2HREA 4N18A 3KYCA 4OV6B 5KU1A 4EPTA 2WPNA 1QS0B 3AHHA 1JHDA 3C7DB 3ZOZA 2CGEA 4GOLD 5DLEA 1F2TA 3OIDA 4O63O 5CDSA 2EZTA 3S5JA 1SKMA 1GKLA 2IXBA 2O7NA 3I09A 3TMAA 5AUNB 1NX9A 1G8KA 4B3DA 2D7DA 2QUIA 2O2SA 2GI4A 5TSDA 3QSGA 3AXMS 2C57A 2C82A 4F4IA 1CYEA 3O7MA 3ONNA 3AETB 4PC1A 1LBIA 1JHYA 3FUWA 3LV8A 4PLPA 5HILA 4OQLA 3CNOA 2XNJA 1Y80A 4BN4A 1THZA 4N3CA 1Z6GA 5DNVA 3DLIA 3EVEA 5CJJA 4DSUA 1PWEA 5HKKD 3C6BA 1XQYA 1K3FA 4ZCIA 3TTYA 2CXQA 4Q16A 1NYQA 2OVBA 5ALDA 1PD1A 3I34X 5DLYA 1RWBA 1GKYA 1W9HA 2JDIA 1DCMA 1YKSA 2UYYA 2VAVA 3AONB 3D3JA 1AHHA 4FBMA 4XWGA 5K3SA 3K70D 3Q7TA 1R0BA 5EQFA 2I1WA 3K70C 1BGXT 2R5FA 3I52A 3JALA 3ZNNA 4HPJB 2NZVG 3MTIA 3ROMA 3V1TC 3ZWNA 4RSHA 4HQFA 3O4HA 1S8OA 4YH1A 4EFLA 3K71B 4LYJA 4LJ8A 5DTQA 5I7VA 3WL3A 5CITA 4LA4A 1JFLA 1DG9A 1E62A 3BKWA 1JNYA 1NBAA 1C8VB 1SXGA 4S1WA 1TTPB 1SXJE 2PRKA 4KLCA 1IQPA 4BBZA 4CUZA 4LKOA 4WBXC 4PR0A 4M55A 4OXNA 2QP3A 3O4RA 2HTFA 1TO1E 3TLCA 4HEJA 2B0JA 5AVSA 1ZNYA 4UBOA 3AVQA 3VYUB 1GGEA 3EXIA 2YIMA 3K6JA 4C0QC 2HO4A 4YJFB 3DLCA 4NCHA 2F64A 1HLDA 3LBYA 3K3PA 4RK1A 5A4FS 1JBKA 1ADYA 2XTZA 4YRJA 3UWDA 1F1JA 4DV6B 4I1UA 1OYVA 1KYXA 1XNGA 3GDWA 2INGX 1JG3A 1A50B 2Q29A 2A3NA 4UFOA 3KVRA 4QODA 1Y1PA 3LA8A 4EY8A 3C8ZA 1KZ9A 3TLGA 4J4HA 3HKEB 3V7NA 2VK1A 4TSRA 2XYHA 1HTWA 3FYUA 4YCJA 5F52A 3R6GA 5IRCD 1JQJC 3VVBA 1C30B 3GPCA 4BO9A 3RVBA 4UBLA 2JFBA 2LGJA 4G0QA 5E6RA 4KV9A 2JIZA 3QX9A 5A6SB 3TRJA 3STWA 2P2CA 5AVRA 1BXZA 3O1IC 4ZT7A 4C05A 4J0QA 3CWCA 1TCVA 1XF1A 4FOOA 5IVPA 4V0LA 2V0GA 4JBLA 1I6WA 2VO1A 3HKCB 2PN1A 1FP4A 2QGZA 4LPKA 4WKGA 2OEPA 4C2TA 1RWVA 1JHQA 1R88A 3D4OA 3LXXA 4MUFA 4L5YA 4Q4DA 4COKA 2JI6A 1M6VA 2OKCA 3MAGA 4GM0A 4HGOA 3OPYB 1X3SA 1TGYA 2V67I 4PFKA 2OYRA 3PHBE 4KX3A 4HADA 1F2TB 2REBA 3Q5GA 4H0NA 4OHCA 1Z35A 4LTDA 2YQ4A 4UHCA 3ZLUA 5AVVA 5B7GA 2A86A 3WBFA 1JLKA 2WVAA 3R3XA 4RUKA 5DMHA 1IHXA 5B3LA 1IY9A 1ULHA 3M33A 1KZ4A 5G4KB 3PNVA 4MKRA 4R1UA 4QOJA 4B8YA 2IZ6A 2R8YA 1REQA 3L7MA 1QG6A 4LJAA 4RYLA 2REXB 4B2PA 1P2DA 4HQOA 2R68A 3QIAA 4MVYA 4CHGA 3ZJVA