4F9UA

Structure of glycosylated glutaminyl cyclase from drosophila melanogaster
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
305
structure length
298
Chain Sequence
b'QWRDDEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGLGFQTEVDEFKQRVPVFGELTFANVVGTINPQAQNFLALACHYDSKYFPNDPGFVGATDSAVPCAILLNTAKTLGAYLQKEFRNRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLASKRSPRNIDRIEVLVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNNNMFLSRVSGGLVDDDHRPFLDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYLKRHTSPVNLRF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG32412
publication title Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase, hydrolase
total genus 110
structure length 298
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4f9uA00
2PJ9A 1CP7A 4EWTA 1Z5RA 1TXRA 4FAIA 3TX8A 3B7IA 3PB7X 2PJBA 2AFZA 1HEEA 3FMCA 2PJ7A 3IC1A 1UWYA 3FH4A 4P45A 4OC0A 2EWBA 4DJLA 3LMSA 1GYTA 2PVWA 5I4MA 2NSMA 5CBMA 4OC2A 4K3NA 4Q7AA 2ZENA 3NH5A 2ZOGA 1TKJA 4ZYQA 2DEAA 1M4LA 2V8HA 4PXEA 4TNUA 3SI2A 3H8FA 2QJ8A 3KHZA 1LAMA 1LCPA 3CPAA 2C6PA 1YMEA 1VGYA 5JM6A 4ONWA 2O53A 3ISXA 5DS0A 2JBJA 4NGQA 4EFDA 4MCQA 4PPZA 4P4EA 4JZ0A 4PXDA 5HVHA 4F9UA 4FBEA 4ZX8A 2F8HA 4MHPA 4OIDA 8CPAA 3QNVA 5D29A 2V8VA 4OMEA 1ELLP 1H8LA 3PB6X 3RZAA 3D4UA 3D67A 2C6GA 4UF4A 4FWUA 3GUXA 5HVGA 2I3CA 2JBKA 4W9YA 5LRJA 4LQGA 3VH9A 3KR5A 2ZEEA 4ZX9A 1QMUA 4DUKA 2Q51A 2ZEOA 3KL9A 4PQAA 4P4DA 3GB0A 1YW6A 5D8NA 3B3CA 5IB9A 5LYDA 2PJ6A 3WC7A 3SJXA 4H2KA 1VIXA 2POKA 2XEFA 2FVGA 4UEEA 4OC5A 3D7DA 1TKHA 2GLJA 3BXMA 3D7GA 4ZY2A 1Y0RA 1OBRA 1QQ9A 2PJ3A 1LANA 5LRGA 1CP6A 1KWMA 3CPXA 4YWYA 2PE3A 3IEHA 1F2PA 4R7MA 4R6TA 2AFWA 3BI0A 3LWUA 1AMPA 3FJUA 1ZG9A 2GREA 4F9VA 1ELMP 2GU2A 3D7FA 5LYFA 1TF8A 4UEZA 4NFRA 4O23A 3B35A 4TWEA 4A39A 4IHMA 3WABA 1XBUA 1F57A 2IJZA 3D68A 4MRIA 2ZEMA 4NJRA 2IQ6A 5LYLA 2AFUA 3PBBA 3FVLA 2WYRA 1JQGA 5K8OA 4A94A 1YW4A 3N5FA 2PJ4A 4MHNA 4MHYA 4OP4A 5J1QA 3V7ZA 3D66A 4NGSA 1ZG8A 6CPAA 2PIZA 7CPAA 3PRTA 4OC1A 4AXVA 1CX8A 1DE4C 2ZEDA 3PFEA 4P4BA 1R43A 2BO9A 3PFOA 4B6ZA 2HC9A 5LRKA 2CF4A 1Q7LA 3SJEA 2O4HA 4MCRA 1R3NA 2XEGA 2ZEPA 5LYIA 4NGTA 4P4IA 2Q4ZA 3V38A 2G9DA 2OOTA 1BPMA 1CG2A 3S9MA 1F2OA 3CDXA 2QYVA 2CTBA 2C6CA 3GLJA 3T8WA 4WJBA 4OC3A 1BAVA 5JGFA 4ZI6A 3B3VA 1IY7A 2PJCA 2RFHA 2EK9A 2IMOA 5K8PA 1ARMA 3FEDA 1HDQA 5HVFA 2PCUA 2PRQA 3CT9A 1FT7A 3L2NA 4NGRA 1XRYA 2ZEFA 3B2YA 1RTQA 4MXUA 4ZY1A 2ZEGA 2PJ8A 4NJQA 3MN8A 4R76A 3KASA 2AFMA 4OKOA 1Y7EA 2ZELA 3NFZA 3IFEA 2PJ0A 3KQXA 4NGMA 3NA6A 5ELYA 4P44A 4MCPA 3HUVA 2ZOFA 4A37A 5K8NA 2AFSA 1TKFA 1HDUA 2ZEHA 2CTCA 3WT4A 1IGBA 2PJ5A 3WC6A 3B3TA 2F7VA 3MRUA 4IK2A 1PYTB 2EK8A 3H8GA 3VATA 2WZNA 4EMEA 3BI1A 4P6YA 4OIWA 5HXDA 4P4FA 2C1CA 3KI9A 1XFOA 1PCAA 2CIJA 1ZLIA 1YLOA 2BCOA 1VHOA 1Z8LA 1EE3P 4WWVA 1Y0YA 2PIYA 3IJ3A 2ANPA 2OR4A 3BHXA 3SJFA 3IO1A 1FNOA 3DLJA 2V8GA 3PBEA 4X2TA 1CBXA 3S9NA 4PXCA 3K2KA 3WC5A 2PJ1A 3FEEA 5F09A 4IAVA 5K8MA 1Z2LA 4YU9A 4RUHA 1CPXA 3S9LA 2AFXA 3NH4A 5JH9A 4UIAA 2PJ2A 1XMBA 3SI0A 3DGVA 2PJAA 5CPAA 3H8EA 2V77A 3HLPA 4KSIA 1CPSA 4F8ZA 2NYQA 2QVPA 3NH8A 2AFOA 1LAPA 2VL1A 3PEIA 4X3RA 3KHXA 3PB8X 4FUUA 4BD9A 4NGPA 1ZG7A 3D7HA 3JRUA 4ZY0A 4CPAA 1LFWA 1VHEA 2Q43A 3KZWA 4MCSA 1BPNA 1TF9A 2V8DA 2RB7A 3RAMA 3FF3A 1BLLE 4P4JA 3I1UA 3KQZA 2XEJA 2JEWA 2PVVA 3RBUA 2GLFA 2XEIA 4NGNA 4OC4A 3KGQA 1XJOA 4JYWA 1NSAA 3FECA 1AYEA 1LOKA 2HB6A 3FX6A 3SJGA 1DTDA 3PB4X 3KR4A 4G1PA 4A38A 1YSJA 2ABZA 3ISZA 3SI1A 3IIBA 3IWWA 4UIBA 4DYOA 4MHZA 3B3WA 4R8FA 2BOAA 3PB9X 4GM5A 5THWA 1ZLHA 3K9TA 4UEFA 4MMOA 3TC8A 3B3SA 4X8IA 3VARA 4P10A 4Z65A 2J9AA 4PXBA 1ARLA
chains in the Genus database with same CATH superfamily
2PJ9A 1CP7A 3FBUA 2B58A 4EWTA 2PRBA 2P6EA 1Z5RA 1TXRA 5F48A 4FAIA 3TX8A 1Y9KA 4B12A 2R1IA 3NE8A 4L89A 5H86A 3B7IA 2OU2A 3PB7X 3TO7A 3TOAA 2PJBA 1S7FA 2AFZA 3FYNA 1HEEA 3W91A 3FMCA 2ODFA 2PJ7A 3GY9A 2G0BA 4B14A 3IC1A 4KOWA 5KTCA 1UWYA 1XF8A 3FH4A 4P45A 4OC0A 2EWBA 4DJLA 3LMSA 4FD5A 1GYTA 2PVWA 5I4MA 2NSMA 3UY5A 4F0YA 5CBMA 4OC2A 2P6GA 4K3NA 2VXKA 3D3SA 1ZO0A 4Q7AA 2I00A 2ZENA 3NH5A 2WUUA 2ZOGA 1TKJA 4ZYQA 2DEAA 3EO4A 1Q2CA 1M4LA 2PDOA 2V8HA 4PXEA 4TNUA 4AVAA 3SI2A 3R96A 3H8FA 2QJ8A 3KHZA 1LAMA 1M4DA 2ZXVA 1KUXA 2Z0ZA 1LCPA 3FB3A 4NEXA 4KUAA 3CPAA 1VKCA 2C6PA 1YMEA 2Z3KA 1IU8A 1VGYA 4A30A 5JM6A 1YVOA 2OZGA 4ONWA 4LX9A 2O53A 5DWNA 3TO9A 3ISXA 2ZW7A 5DS0A 4DNCA 2JBJA 5J8CA 2Q7BA 5ISVA 1MJAA 2DPSA 3GYAA 4NGQA 4KZTA 1YLEA 4EFDA 4MCQA 4PPZA 4MI4A 1SQHA 1MK4A 2FCKA 3EFAA 1XOVA 5AG4A 4P4EA 3T90A 4JZ0A 2JEVA 4UCPA 1LRZA 4PXDA 5C88A 1K4JA 3I3GA 5HVHA 4F9UA 4KLWA 4UCNA 4U5YA 4ZX8A 4FBEA 2F8HA 2D4OA 4MHPA 3JVNA 4OIDA 3RO0A 8CPAA 2G3TA 5HMNA 1S60A 1V0CA 3QNVA 2O28A 4E8OA 1P0HA 2OZHA 5D29A 4GS4A 2V8VA 1YGHA 5FVJA 4OMEA 2P0WA 1ELLP 1H8LA 3PB6X 3RZAA 3D4UA 3D67A 3DNSA 2C6GA 5DWMA 4JJXA 4UF4A 3RNZA 4FWUA 5EC4A 3QAYA 3GUXA 1YQEA 2Q04A 4CAVA 3RYOA 5HVGA 4KVME 2I3CA 2JBKA 5AG5A 4XPDC 4X5KA 4W9YA 5LRJA 4LQGA 3VH9A 4OLLA 3F5BA 3KR5A 2ZEEA 4ZX9A 1IYLA 1QMUA 3MGDA 2Q51A 4DUKA 2ZEOA 4MFQA 3KL9A 4PQAA 2FL4A 2REFA 2QIRA 4P4DA 3GB0A 1YW6A 1Y7RA 2D4PA 5D8NA 1IIDA 1FY7A 3B3CA 2DXQA 1NE9A 4PSWA 5LYDA 5IB9A 2EUIA 2CNTA 2PJ6A 5G1ZA 3WC7A 3LD2A 5KTAA 4CYNA 3SJXA 4H2KA 1VIXA 3ZJ0A 2EBJA 1B6BA 1S7NA 3R9GA 2POKA 2XEFA 4A31A 4RN7A 2FVGA 2NMTA 4UEEA 1Z4RA 2WPWA 4Y49C 4F6AA 4OC5A 5JQ4A 1KUVA 4NSQA 3D7DA 5AG7A 1TKHA 2GLJA 3BXMA 3D7GA 4E0AA 2EVNA 2CNMA 4M85A 4ZY2A 3DR6A 4CGPA 2Z3OA 1Y0RA 1OBRA 1QQ9A 1QSTA 4R9MA 4MFKA 2PJ3A 3LACA 1LANA 4U9YA 5LRGA 1Z8XA 1CJWA 3N7ZA 1CP6A 1KWMA 3CPXA 2G3AA 2GANA 1XE4A 4YWYA 2PE3A 5JPHA 3IEHA 4C2YA 1F2PA 2ZW5A 4R7MA 2VZYA 4R6TA 2AFWA 3BI0A 3LWUA 4YGOA 2FE7A 1AMPA 2PR8A 4IUSA 3FJUA 5F46A 1ZG9A 2GREA 4F9VA 1ELMP 2AE6A 2BEIA 1Q2DA 2GU2A 3D7FA 1Z8WA 4R3LA 5LYFA 2FIWA 1B87A 1TF8A 2B3UA 4UEZA 4NFRA 2VZZA 4M6IA 1YR0A 2DF5A 4O23A 3PZJA 2QECA 3B35A 4TWEA 2BUEA 1S5KA 4H6ZA 2Z3NA 4U9ZA 4A39A 2AJ6A 4IHMA 4JXQA 4PV6A 4ZGYB 4KOXA 5GCNA 3WABA 4A32A 1RO5A 4B5PB 4M3SA 1XBUA 2X7BA 3D8PA 1F57A 4KORA 1S7LA 2IJZA 3D68A 4MRIA 2ZEMA 4NJRA 3SHPA 4AG9A 5AG6A 2IQ6A 4R87A 5LYLA 2AFUA 3PBBA 2B4BA 4AG7A 2GIVA 5J8FA 3FVLA 2HUZA 3BJ7A 2WYRA 3D2PA 1JQGA 5K8OA 4A94A 4BINA 1YW4A 3N5FA 2PJ4A 4MHNA 4MHYA 4OP4A 5J1QA 4II9A 3V7ZA 3D66A 4NGSA 4YRHA 4C2XA 5IX3A 1ZG8A 6CPAA 2PIZA 7CPAA 4Q36A 3PRTA 3VWDA 4OC1A 4AXVA 4FD7A 4H6UA 5HH1A 1CX8A 4KLVA 1DE4C 2ZEDA 4L8AA 3PFEA 2ZPAA 3NE7A 4UWJA 3R95A 4JLYA 4P4BA 4C68A 1R43A 4AB7A 2K5TA 2BO9A 1BO4A 5ELYA 3H5ZA 3PFOA 4B13A 5F47A 5I0CA 4B6ZA 2HC9A 3IGRA 5LRKA 2Z3PA 4ONUA 4A33A 2CF4A 1Q7LA 4CGMA 2F5IA 3SJEA 2O4HA 3W6SA 4F0XA 1TIQA 2EO8A 4UBRA 4UCMA 4MCRA 1R3NA 4CAWA 4XNHC 2XEGA 2ZEPA 5LYIA 5H84A 4NGTA 4P4IA 3G3SA 4JXRA 1YREA 2VEZA 2Q4ZA 2YNDA 3CXPA 5G20A 1M4GA 3V38A 4PSXA 2G9DA 3FNCA 2HV2A 2OOTA 3ZZIA 1BPMA 1CG2A 1P4NA 1F2OA 2Z11A 3CDXA 4MFLA 3S9MA 2QYVA 2IL4A 1M44A 2Q4VA 2YNEA 4QVTA 3S6KA 1ON0A 2CTBA 4HNXB 2C6CA 3GLJA 2B5GB 3T8WA 4WJBA 4CRYB 3JUWA 4OC3A 1BAVA 5JGFA 4LUAA 4UFWA 4ZI6A 1S3ZA 3B3VA 4XPLA 4R57A 5BWAB 1IY7A 2DPTA 1U6MA 2Q4YA 3C26A 2HQYA 2PJCA 4KVOE 5A28A 4NF1A 2RFHA 3EXNA 3W6XA 2EK9A 2IMOA 5K8PA 2RC4A 1QSOA 1ARMA 3FEDA 1HDQA 2JDDA 1M4IA 4HNYB 5HVFA 1OZPA 2PCUA 5G21A 2PRQA 3CT9A 1FT7A 3L2NA 1VHSA 3QB8A 3A9LA 3F0AA 4HPSA 4NGRA 1XRYA 2PC1A 2PQ8A 4JWPA 1MJ9A 4OADA 2ZEFA 3P2HA 4XPKA 3B2YA 1MJBA 1RTQA 4MXUA 4ZY1A 3PGPA 1NSLA 4RI1A 2VQYA 3TTHA 2ZEGA 3TT2A 1IOFA 2PJ8A 4NJQA 3D2MA 4UFXA 3MN8A 4R76A 1JWQA 2AFMA 3KASA 4OKOA 4KS9A 1Y7EA 3V8IA 4C7IA 3R1KA 4XPDB 3DR8A 2KCWA 3EC4A 2ZELA 3NFZA 3IFEA 2B4DB 2PJ0A 3KQXA 3B8GA 4MFJA 3NA6A 1Z8TA 2R7HA 2VI7A 4NGMA 1N71A 2I79A 4P44A 4ORFA 5EMIA 3BJ8A 4FD6A 5EBVA 4MCPA 4A2ZA 3HUVA 1PUAA 2ZOFA 2FS5A 3IU1A 4A37A 2OZUA 4CYPA 5A27A 3OWCA 5K8NA 4PK3A 1QSRA 2WSAA 2AFSA 3CXSA 1TKFA 1HDUA 2R8VA 3TFYA 1R57A 3S6FA 2VBQA 3CXQA 1Y9WA 2JDCA 2ZEHA 2CTCA 3WT4A 1IGBA 2PJ5A 4Y49B 3WC6A 4UWIA 4CGNA 3B3TA 2YNCA 1Z9UA 3VWEA 2F7VA 3MRUA 4IK2A 1PYTB 4NCZA 3I9SA 4B5PA 2EK8A 3H8GA 2ZW6A 4M6GA 3F8KA 4H89A 3QAHA 3GIUA 3VATA 4QBJA 2WZNA 4EMEA 1Q2YA 2YNCC 5C82A 3BI1A 4P6YA 4OIWA 3TCVA 5HXDA 1QSMA 3E0KA 3S6GA 1Z4EA 4P4FA 2C1CA 2BL1A 3KI9A 2QMLA 4QUSA 1XIXA 4KOUA 1XFOA 3GKRA 4MJ8A 1PCAA 3G8WA 2CIJA 1ZLIA 2FXFA 1YLOA 3SXOA 4Q38A 5AGEA 5G22A 4CAEA 2BCOA 1VHOA 4MBUA 1RXTA 1EE3P 1Z8LA 1IB1E 4ZBGA 4WWVA 4B11A 1Y0YA 2PIYA 3IJ3A 2YGWA 3TO6A 4MY0A 2ANPA 2OR4A 3BHXA 3SJFA 3IO1A 1FNOA 1CM0A 3DLJA 4CS0B 4A95A 2V8GA 3PBEA 4YFJA 2P6FA 4X2TA 4CYQA 5IV0A 3S6HA 1CBXA 3S9NA 4EVYA 1XEBA 1WWZA 4PXCA 3K2KA 1BOBA 3R9EA 3DSBA 4IF5A 3WC5A 2PJ1A 3FEEA 3JTKA 4CYOA 3LODA 4IAVA 3KKWA 5F09A 5K8MA 1Z2LA 3T9YA 2J8NA 4YU9A 1IICA 2PSWA 4RUHA 1CPXA 4CGLA 3S9LA 2AFXA 4KOYA 1YK3A 2A4NA 3NH4A 4UIAA 5JH9A 2PJ2A 4PXBA 3FIXA 2FT0A 1XMBA 3SI0A 3DGVA 2PJAA 5CPAA 4QB9A 2WPXA 2Z10A 4QC6A 3H8EA 4HKFA 4KUBA 2B5GA 3PP9A 4KOTA 2V77A 3SXNA 4CGOA 4E2AA 3HLPA 4KSIA 1CPSA 1YX0A 4AVBA 1UFHA 4F8ZA 2NYQA 2QVPA 3NH8A 2AFOA 1I21A 1S7KA 3BLNA 1LAPA 3IU2A 2VL1A 3PEIA 4X3RA 4R3KA 3WR7A 5CNPA 4BMHA 3KHXA 3PB8X 2Z3LA 2GE3A 4KSAA 4MHDA 3DDDA 4FUUA 4XNHB 2CNSA 2J8MA 4RS2A 1KUYA 4BD9A 2OB0A 4NGPA 3TOBA 4J3GA 1KZFA 2H5MA 1ZG7A 3D7HA 3JRUA 4C7HA 4ZY0A 2REEA 4CPAA 1IOIA 1LFWA 1VHEA 2Q43A 3KZWA 5F49A 1WK4A 4LQ6A 4MCSA 1BPNA 3IWEA 1TF9A 2V8DA 2RB7A 3RAMA 4FD4A 3FF3A 3H4QA 1BLLE 4UFVA 2C27A 4P4JA 3I1UA 2B4DA 1X10A 2OH1A 3KQZA 1PU9A 2XEJA 4OAEA 4GXHA 2JEWA 2GFQA 2PVVA 5E96A 2GLFA 2XEIA 3RBUA 4NGNA 3FRMA 4OC4A 1I12A 2ARHA 2B3VA 3IWGA 1XMTA 3R9FA 1X12A 3KGQA 4MFPA 1XJOA 4JYWA 4CAFA 1IYKA 1NSAA 3FECA 1GHEA 1AYEA 1LOKA 2HB6A 5IB0A 3FX6A 4KVXA 4NXYA 4B5OA 4HNWB 3TE4A 3SJGA 2Q7SA 1DTDA 3PB4X 1I1DA 4AVCA 2PR1A 2JLMA 3KR4A 2CXAA 4G1PA 1QSNA 1NMTA 1YSJA 2ABZA 4A38A 3ISZA 3SI1A 3IIBA 3IWWA 4UIBA 4DYOA 1A2ZA 2Q44A 1J4JA 2BSWA 3EY5A 2FSRA 4MHZA 3B3WA 2Q0YA 4CAXA 4R8FA 4C2ZA 2BOAA 5KTDA 3PB9X 4B10A 4KOSA 4PK2A 4GM5A 5THWA 1YVKA 1ZLHA 2Y0MA 3K9TA 4UA3A 2ATRA 3FXTA 4UEFA 4MFZA 4CRZB 3CZXA 1L0CA 4MMOA 4BBHA 4K30A 3K9UA 2FIAA 2CY2A 4JD6A 2R98A 2ZW4A 3TC8A 3B3SA 4KOVA 1AUGA 4X8IA 2J8RA 4M6HA 3VARA 3P2FA 4I49A 4P10A 4Z65A 4MY3A 2Z3MA 1M1DA 2J9AA 4KSFA 1ARLA
chains in the Genus database with same CATH topology
2PJ9A 1CP7A 4EWTA 1Z5RA 1TXRA 4FAIA 3TX8A 3B7IA 3PB7X 2PJBA 2AFZA 1HEEA 3FMCA 2PJ7A 3IC1A 1UWYA 3FH4A 4P45A 4OC0A 2EWBA 4DJLA 3LMSA 1GYTA 2PVWA 5I4MA 2NSMA 5CBMA 4OC2A 4K3NA 4Q7AA 2ZENA 3NH5A 2ZOGA 1TKJA 4ZYQA 2DEAA 1M4LA 2V8HA 4PXEA 4TNUA 3SI2A 3H8FA 2QJ8A 3KHZA 1LAMA 1LCPA 3CPAA 2C6PA 1YMEA 1VGYA 5JM6A 4ONWA 2O53A 3ISXA 5DS0A 2JBJA 4NGQA 4EFDA 4MCQA 4PPZA 4P4EA 4JZ0A 4PXDA 5HVHA 4F9UA 4FBEA 4ZX8A 2F8HA 4MHPA 4OIDA 8CPAA 3QNVA 5D29A 2V8VA 4OMEA 1ELLP 1H8LA 3PB6X 3RZAA 3D4UA 3D67A 2C6GA 4UF4A 4FWUA 3GUXA 5HVGA 2I3CA 2JBKA 4W9YA 5LRJA 4LQGA 3VH9A 3KR5A 2ZEEA 4ZX9A 1QMUA 4DUKA 2Q51A 2ZEOA 3KL9A 4PQAA 4P4DA 3GB0A 1YW6A 5D8NA 3B3CA 5IB9A 5LYDA 2PJ6A 3WC7A 3SJXA 4H2KA 1VIXA 2POKA 2XEFA 2FVGA 4UEEA 4OC5A 3D7DA 1TKHA 2GLJA 3BXMA 3D7GA 4ZY2A 1Y0RA 1OBRA 1QQ9A 2PJ3A 1LANA 5LRGA 1CP6A 1KWMA 3CPXA 4YWYA 2PE3A 3IEHA 1F2PA 4R7MA 4R6TA 2AFWA 3BI0A 3LWUA 1AMPA 3FJUA 1ZG9A 2GREA 4F9VA 1ELMP 2GU2A 3D7FA 5LYFA 1TF8A 4UEZA 4NFRA 4O23A 3B35A 4TWEA 4A39A 4IHMA 3WABA 1XBUA 1F57A 2IJZA 3D68A 4MRIA 2ZEMA 4NJRA 2IQ6A 5LYLA 2AFUA 3PBBA 3FVLA 2WYRA 1JQGA 5K8OA 4A94A 1YW4A 3N5FA 2PJ4A 4MHNA 4MHYA 4OP4A 5J1QA 3V7ZA 3D66A 4NGSA 1ZG8A 6CPAA 2PIZA 7CPAA 3PRTA 4OC1A 4AXVA 1CX8A 1DE4C 2ZEDA 3PFEA 4P4BA 1R43A 2BO9A 3PFOA 4B6ZA 2HC9A 5LRKA 2CF4A 1Q7LA 3SJEA 2O4HA 4MCRA 1R3NA 2XEGA 2ZEPA 5LYIA 4NGTA 4P4IA 2Q4ZA 3V38A 2G9DA 2OOTA 1BPMA 1CG2A 3S9MA 1F2OA 3CDXA 2QYVA 2CTBA 2C6CA 3GLJA 3T8WA 4WJBA 4OC3A 1BAVA 5JGFA 4ZI6A 3B3VA 1IY7A 2PJCA 2RFHA 2EK9A 2IMOA 5K8PA 1ARMA 3FEDA 1HDQA 5HVFA 2PCUA 2PRQA 3CT9A 1FT7A 3L2NA 4NGRA 1XRYA 2ZEFA 3B2YA 1RTQA 4MXUA 4ZY1A 2ZEGA 2PJ8A 4NJQA 3MN8A 4R76A 3KASA 2AFMA 4OKOA 1Y7EA 2ZELA 3NFZA 3IFEA 2PJ0A 3KQXA 4NGMA 3NA6A 5ELYA 4P44A 4MCPA 3HUVA 2ZOFA 4A37A 5K8NA 2AFSA 1TKFA 1HDUA 2ZEHA 2CTCA 3WT4A 1IGBA 2PJ5A 3WC6A 3B3TA 2F7VA 3MRUA 4IK2A 1PYTB 2EK8A 3H8GA 3VATA 2WZNA 4EMEA 3BI1A 4P6YA 4OIWA 5HXDA 4P4FA 2C1CA 3KI9A 1XFOA 1PCAA 2CIJA 1ZLIA 1YLOA 2BCOA 1VHOA 1Z8LA 1EE3P 4WWVA 1Y0YA 2PIYA 3IJ3A 2ANPA 2OR4A 3BHXA 3SJFA 3IO1A 1FNOA 3DLJA 2V8GA 3PBEA 4X2TA 1CBXA 3S9NA 4PXCA 3K2KA 3WC5A 2PJ1A 3FEEA 5F09A 4IAVA 5K8MA 1Z2LA 4YU9A 4RUHA 1CPXA 3S9LA 2AFXA 3NH4A 5JH9A 4UIAA 2PJ2A 1XMBA 3SI0A 3DGVA 2PJAA 5CPAA 3H8EA 2V77A 3HLPA 4KSIA 1CPSA 4F8ZA 2NYQA 2QVPA 3NH8A 2AFOA 1LAPA 2VL1A 3PEIA 4X3RA 3KHXA 3PB8X 4FUUA 4BD9A 4NGPA 1ZG7A 3D7HA 3JRUA 4ZY0A 4CPAA 1LFWA 1VHEA 2Q43A 3KZWA 4MCSA 1BPNA 1TF9A 2V8DA 2RB7A 3RAMA 3FF3A 1BLLE 4P4JA 3I1UA 3KQZA 2XEJA 2JEWA 2PVVA 3RBUA 2GLFA 2XEIA 4NGNA 4OC4A 3KGQA 1XJOA 4JYWA 1NSAA 3FECA 1AYEA 1LOKA 2HB6A 3FX6A 3SJGA 1DTDA 3PB4X 3KR4A 4G1PA 4A38A 1YSJA 2ABZA 3ISZA 3SI1A 3IIBA 3IWWA 4UIBA 4DYOA 4MHZA 3B3WA 4R8FA 2BOAA 3PB9X 4GM5A 5THWA 1ZLHA 3K9TA 4UEFA 4MMOA 3TC8A 3B3SA 4X8IA 3VARA 4P10A 4Z65A 2J9AA 4PXBA 1ARLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PJ9 A;  1CP7 A;  4EWT A;  1Z5R A;  1TXR A;  4FAI A;  3TX8 A;  3B7I A;  3PB7 X;  2PJB A;  2AFZ A;  1HEE A;  3FMC A;  2PJ7 A;  3IC1 A;  1UWY A;  3FH4 A;  4P45 A;  4OC0 A;  2EWB A;  4DJL A;  3LMS A;  1GYT A;  2PVW A;  5I4M A;  2NSM A;  5CBM A;  4OC2 A;  4K3N A;  4Q7A A;  2ZEN A;  3NH5 A;  2ZOG A;  1TKJ A;  4ZYQ A;  2DEA A;  1M4L A;  2V8H A;  4PXE A;  4TNU A;  3SI2 A;  3H8F A;  2QJ8 A;  3KHZ A;  1LAM A;  1LCP A;  3CPA A;  2C6P A;  1YME A;  1VGY A;  5JM6 A;  4ONW A;  2O53 A;  3ISX A;  5DS0 A;  2JBJ A;  4NGQ A;  4EFD A;  4MCQ A;  4PPZ A;  4P4E A;  4JZ0 A;  4PXD A;  5HVH A;  4F9U A;  4FBE A;  4ZX8 A;  2F8H A;  4MHP A;  4OID A;  8CPA A;  3QNV A;  5D29 A;  2V8V A;  4OME A;  1ELL P;  1H8L A;  3PB6 X;  3RZA A;  3D4U A;  3D67 A;  2C6G A;  4UF4 A;  4FWU A;  3GUX A;  5HVG A;  2I3C A;  2JBK A;  4W9Y A;  5LRJ A;  4LQG A;  3VH9 A;  3KR5 A;  2ZEE A;  4ZX9 A;  1QMU A;  4DUK A;  2Q51 A;  2ZEO A;  3KL9 A;  4PQA A;  4P4D A;  3GB0 A;  1YW6 A;  5D8N A;  3B3C A;  5IB9 A;  5LYD A;  2PJ6 A;  3WC7 A;  3SJX A;  4H2K A;  1VIX A;  2POK A;  2XEF A;  2FVG A;  4UEE A;  4OC5 A;  3D7D A;  1TKH A;  2GLJ A;  3BXM A;  3D7G A;  4ZY2 A;  1Y0R A;  1OBR A;  1QQ9 A;  2PJ3 A;  1LAN A;  5LRG A;  1CP6 A;  1KWM A;  3CPX A;  4YWY A;  2PE3 A;  3IEH A;  1F2P A;  4R7M A;  4R6T A;  2AFW A;  3BI0 A;  3LWU A;  1AMP A;  3FJU A;  1ZG9 A;  2GRE A;  4F9V A;  1ELM P;  2GU2 A;  3D7F A;  5LYF A;  1TF8 A;  4UEZ A;  4NFR A;  4O23 A;  3B35 A;  4TWE A;  4A39 A;  4IHM A;  3WAB A;  1XBU A;  1F57 A;  2IJZ A;  3D68 A;  4MRI A;  2ZEM A;  4NJR A;  2IQ6 A;  5LYL A;  2AFU A;  3PBB A;  3FVL A;  2WYR A;  1JQG A;  5K8O A;  4A94 A;  1YW4 A;  3N5F A;  2PJ4 A;  4MHN A;  4MHY A;  4OP4 A;  5J1Q A;  3V7Z A;  3D66 A;  4NGS A;  1ZG8 A;  6CPA A;  2PIZ A;  7CPA A;  3PRT A;  4OC1 A;  4AXV A;  1CX8 A;  1DE4 C;  2ZED A;  3PFE A;  4P4B A;  1R43 A;  2BO9 A;  3PFO A;  4B6Z A;  2HC9 A;  5LRK A;  2CF4 A;  1Q7L A;  3SJE A;  2O4H A;  4MCR A;  1R3N A;  2XEG A;  2ZEP A;  5LYI A;  4NGT A;  4P4I A;  2Q4Z A;  3V38 A;  2G9D A;  2OOT A;  1BPM A;  1CG2 A;  3S9M A;  1F2O A;  3CDX A;  2QYV A;  2CTB A;  2C6C A;  3GLJ A;  3T8W A;  4WJB A;  4OC3 A;  1BAV A;  5JGF A;  4ZI6 A;  3B3V A;  1IY7 A;  2PJC A;  2RFH A;  2EK9 A;  2IMO A;  5K8P A;  1ARM A;  3FED A;  1HDQ A;  5HVF A;  2PCU A;  2PRQ A;  3CT9 A;  1FT7 A;  3L2N A;  4NGR A;  1XRY A;  2ZEF A;  3B2Y A;  1RTQ A;  4MXU A;  4ZY1 A;  2ZEG A;  2PJ8 A;  4NJQ A;  3MN8 A;  4R76 A;  3KAS A;  2AFM A;  4OKO A;  1Y7E A;  2ZEL A;  3NFZ A;  3IFE A;  2PJ0 A;  3KQX A;  4NGM A;  3NA6 A;  5ELY A;  4P44 A;  4MCP A;  3HUV A;  2ZOF A;  4A37 A;  5K8N A;  2AFS A;  1TKF A;  1HDU A;  2ZEH A;  2CTC A;  3WT4 A;  1IGB A;  2PJ5 A;  3WC6 A;  3B3T A;  2F7V A;  3MRU A;  4IK2 A;  1PYT B;  2EK8 A;  3H8G A;  3VAT A;  2WZN A;  4EME A;  3BI1 A;  4P6Y A;  4OIW A;  5HXD A;  4P4F A;  2C1C A;  3KI9 A;  1XFO A;  1PCA A;  2CIJ A;  1ZLI A;  1YLO A;  2BCO A;  1VHO A;  1Z8L A;  1EE3 P;  4WWV A;  1Y0Y A;  2PIY A;  3IJ3 A;  2ANP A;  2OR4 A;  3BHX A;  3SJF A;  3IO1 A;  1FNO A;  3DLJ A;  2V8G A;  3PBE A;  4X2T A;  1CBX A;  3S9N A;  4PXC A;  3K2K A;  3WC5 A;  2PJ1 A;  3FEE A;  5F09 A;  4IAV A;  5K8M A;  1Z2L A;  4YU9 A;  4RUH A;  1CPX A;  3S9L A;  2AFX A;  3NH4 A;  5JH9 A;  4UIA A;  2PJ2 A;  1XMB A;  3SI0 A;  3DGV A;  2PJA A;  5CPA A;  3H8E A;  2V77 A;  3HLP A;  4KSI A;  1CPS A;  4F8Z A;  2NYQ A;  2QVP A;  3NH8 A;  2AFO A;  1LAP A;  2VL1 A;  3PEI A;  4X3R A;  3KHX A;  3PB8 X;  4FUU A;  4BD9 A;  4NGP A;  1ZG7 A;  3D7H A;  3JRU A;  4ZY0 A;  4CPA A;  1LFW A;  1VHE A;  2Q43 A;  3KZW A;  4MCS A;  1BPN A;  1TF9 A;  2V8D A;  2RB7 A;  3RAM A;  3FF3 A;  1BLL E;  4P4J A;  3I1U A;  3KQZ A;  2XEJ A;  2JEW A;  2PVV A;  3RBU A;  2GLF A;  2XEI A;  4NGN A;  4OC4 A;  3KGQ A;  1XJO A;  4JYW A;  1NSA A;  3FEC A;  1AYE A;  1LOK A;  2HB6 A;  3FX6 A;  3SJG A;  1DTD A;  3PB4 X;  3KR4 A;  4G1P A;  4A38 A;  1YSJ A;  2ABZ A;  3ISZ A;  3SI1 A;  3IIB A;  3IWW A;  4UIB A;  4DYO A;  4MHZ A;  3B3W A;  4R8F A;  2BOA A;  3PB9 X;  4GM5 A;  5THW A;  1ZLH A;  3K9T A;  4UEF A;  4MMO A;  3TC8 A;  3B3S A;  4X8I A;  3VAR A;  4P10 A;  4Z65 A;  2J9A A;  4PXB A;  1ARL A; 
#chains in the Genus database with same CATH topology
 2PJ9 A;  1CP7 A;  3FBU A;  2B58 A;  4EWT A;  2PRB A;  2P6E A;  1Z5R A;  1TXR A;  5F48 A;  4FAI A;  3TX8 A;  1Y9K A;  4B12 A;  2R1I A;  3NE8 A;  4L89 A;  5H86 A;  3B7I A;  2OU2 A;  3PB7 X;  3TO7 A;  3TOA A;  2PJB A;  1S7F A;  2AFZ A;  3FYN A;  1HEE A;  3W91 A;  3FMC A;  2ODF A;  2PJ7 A;  3GY9 A;  2G0B A;  4B14 A;  3IC1 A;  4KOW A;  5KTC A;  1UWY A;  1XF8 A;  3FH4 A;  4P45 A;  4OC0 A;  2EWB A;  4DJL A;  3LMS A;  4FD5 A;  1GYT A;  2PVW A;  5I4M A;  2NSM A;  3UY5 A;  4F0Y A;  5CBM A;  4OC2 A;  2P6G A;  4K3N A;  2VXK A;  3D3S A;  1ZO0 A;  4Q7A A;  2I00 A;  2ZEN A;  3NH5 A;  2WUU A;  2ZOG A;  1TKJ A;  4ZYQ A;  2DEA A;  3EO4 A;  1Q2C A;  1M4L A;  2PDO A;  2V8H A;  4PXE A;  4TNU A;  4AVA A;  3SI2 A;  3R96 A;  3H8F A;  2QJ8 A;  3KHZ A;  1LAM A;  1M4D A;  2ZXV A;  1KUX A;  2Z0Z A;  1LCP A;  3FB3 A;  4NEX A;  4KUA A;  3CPA A;  1VKC A;  2C6P A;  1YME A;  2Z3K A;  1IU8 A;  1VGY A;  4A30 A;  5JM6 A;  1YVO A;  2OZG A;  4ONW A;  4LX9 A;  2O53 A;  5DWN A;  3TO9 A;  3ISX A;  2ZW7 A;  5DS0 A;  4DNC A;  2JBJ A;  5J8C A;  2Q7B A;  5ISV A;  1MJA A;  2DPS A;  3GYA A;  4NGQ A;  4KZT A;  1YLE A;  4EFD A;  4MCQ A;  4PPZ A;  4MI4 A;  1SQH A;  1MK4 A;  2FCK A;  3EFA A;  1XOV A;  5AG4 A;  4P4E A;  3T90 A;  4JZ0 A;  2JEV A;  4UCP A;  1LRZ A;  4PXD A;  5C88 A;  1K4J A;  3I3G A;  5HVH A;  4F9U A;  4KLW A;  4UCN A;  4U5Y A;  4ZX8 A;  4FBE A;  2F8H A;  2D4O A;  4MHP A;  3JVN A;  4OID A;  3RO0 A;  8CPA A;  2G3T A;  5HMN A;  1S60 A;  1V0C A;  3QNV A;  2O28 A;  4E8O A;  1P0H A;  2OZH A;  5D29 A;  4GS4 A;  2V8V A;  1YGH A;  5FVJ A;  4OME A;  2P0W A;  1ELL P;  1H8L A;  3PB6 X;  3RZA A;  3D4U A;  3D67 A;  3DNS A;  2C6G A;  5DWM A;  4JJX A;  4UF4 A;  3RNZ A;  4FWU A;  5EC4 A;  3QAY A;  3GUX A;  1YQE A;  2Q04 A;  4CAV A;  3RYO A;  5HVG A;  4KVM E;  2I3C A;  2JBK A;  5AG5 A;  4XPD C;  4X5K A;  4W9Y A;  5LRJ A;  4LQG A;  3VH9 A;  4OLL A;  3F5B A;  3KR5 A;  2ZEE A;  4ZX9 A;  1IYL A;  1QMU A;  3MGD A;  2Q51 A;  4DUK A;  2ZEO A;  4MFQ A;  3KL9 A;  4PQA A;  2FL4 A;  2REF A;  2QIR A;  4P4D A;  3GB0 A;  1YW6 A;  1Y7R A;  2D4P A;  5D8N A;  1IID A;  1FY7 A;  3B3C A;  2DXQ A;  1NE9 A;  4PSW A;  5LYD A;  5IB9 A;  2EUI A;  2CNT A;  2PJ6 A;  5G1Z A;  3WC7 A;  3LD2 A;  5KTA A;  4CYN A;  3SJX A;  4H2K A;  1VIX A;  3ZJ0 A;  2EBJ A;  1B6B A;  1S7N A;  3R9G A;  2POK A;  2XEF A;  4A31 A;  4RN7 A;  2FVG A;  2NMT A;  4UEE A;  1Z4R A;  2WPW A;  4Y49 C;  4F6A A;  4OC5 A;  5JQ4 A;  1KUV A;  4NSQ A;  3D7D A;  5AG7 A;  1TKH A;  2GLJ A;  3BXM A;  3D7G A;  4E0A A;  2EVN A;  2CNM A;  4M85 A;  4ZY2 A;  3DR6 A;  4CGP A;  2Z3O A;  1Y0R A;  1OBR A;  1QQ9 A;  1QST A;  4R9M A;  4MFK A;  2PJ3 A;  3LAC A;  1LAN A;  4U9Y A;  5LRG A;  1Z8X A;  1CJW A;  3N7Z A;  1CP6 A;  1KWM A;  3CPX A;  2G3A A;  2GAN A;  1XE4 A;  4YWY A;  2PE3 A;  5JPH A;  3IEH A;  4C2Y A;  1F2P A;  2ZW5 A;  4R7M A;  2VZY A;  4R6T A;  2AFW A;  3BI0 A;  3LWU A;  4YGO A;  2FE7 A;  1AMP A;  2PR8 A;  4IUS A;  3FJU A;  5F46 A;  1ZG9 A;  2GRE A;  4F9V A;  1ELM P;  2AE6 A;  2BEI A;  1Q2D A;  2GU2 A;  3D7F A;  1Z8W A;  4R3L A;  5LYF A;  2FIW A;  1B87 A;  1TF8 A;  2B3U A;  4UEZ A;  4NFR A;  2VZZ A;  4M6I A;  1YR0 A;  2DF5 A;  4O23 A;  3PZJ A;  2QEC A;  3B35 A;  4TWE A;  2BUE A;  1S5K A;  4H6Z A;  2Z3N A;  4U9Z A;  4A39 A;  2AJ6 A;  4IHM A;  4JXQ A;  4PV6 A;  4ZGY B;  4KOX A;  5GCN A;  3WAB A;  4A32 A;  1RO5 A;  4B5P B;  4M3S A;  1XBU A;  2X7B A;  3D8P A;  1F57 A;  4KOR A;  1S7L A;  2IJZ A;  3D68 A;  4MRI A;  2ZEM A;  4NJR A;  3SHP A;  4AG9 A;  5AG6 A;  2IQ6 A;  4R87 A;  5LYL A;  2AFU A;  3PBB A;  2B4B A;  4AG7 A;  2GIV A;  5J8F A;  3FVL A;  2HUZ A;  3BJ7 A;  2WYR A;  3D2P A;  1JQG A;  5K8O A;  4A94 A;  4BIN A;  1YW4 A;  3N5F A;  2PJ4 A;  4MHN A;  4MHY A;  4OP4 A;  5J1Q A;  4II9 A;  3V7Z A;  3D66 A;  4NGS A;  4YRH A;  4C2X A;  5IX3 A;  1ZG8 A;  6CPA A;  2PIZ A;  7CPA A;  4Q36 A;  3PRT A;  3VWD A;  4OC1 A;  4AXV A;  4FD7 A;  4H6U A;  5HH1 A;  1CX8 A;  4KLV A;  1DE4 C;  2ZED A;  4L8A A;  3PFE A;  2ZPA A;  3NE7 A;  4UWJ A;  3R95 A;  4JLY A;  4P4B A;  4C68 A;  1R43 A;  4AB7 A;  2K5T A;  2BO9 A;  1BO4 A;  5ELY A;  3H5Z A;  3PFO A;  4B13 A;  5F47 A;  5I0C A;  4B6Z A;  2HC9 A;  3IGR A;  5LRK A;  2Z3P A;  4ONU A;  4A33 A;  2CF4 A;  1Q7L A;  4CGM A;  2F5I A;  3SJE A;  2O4H A;  3W6S A;  4F0X A;  1TIQ A;  2EO8 A;  4UBR A;  4UCM A;  4MCR A;  1R3N A;  4CAW A;  4XNH C;  2XEG A;  2ZEP A;  5LYI A;  5H84 A;  4NGT A;  4P4I A;  3G3S A;  4JXR A;  1YRE A;  2VEZ A;  2Q4Z A;  2YND A;  3CXP A;  5G20 A;  1M4G A;  3V38 A;  4PSX A;  2G9D A;  3FNC A;  2HV2 A;  2OOT A;  3ZZI A;  1BPM A;  1CG2 A;  1P4N A;  1F2O A;  2Z11 A;  3CDX A;  4MFL A;  3S9M A;  2QYV A;  2IL4 A;  1M44 A;  2Q4V A;  2YNE A;  4QVT A;  3S6K A;  1ON0 A;  2CTB A;  4HNX B;  2C6C A;  3GLJ A;  2B5G B;  3T8W A;  4WJB A;  4CRY B;  3JUW A;  4OC3 A;  1BAV A;  5JGF A;  4LUA A;  4UFW A;  4ZI6 A;  1S3Z A;  3B3V A;  4XPL A;  4R57 A;  5BWA B;  1IY7 A;  2DPT A;  1U6M A;  2Q4Y A;  3C26 A;  2HQY A;  2PJC A;  4KVO E;  5A28 A;  4NF1 A;  2RFH A;  3EXN A;  3W6X A;  2EK9 A;  2IMO A;  5K8P A;  2RC4 A;  1QSO A;  1ARM A;  3FED A;  1HDQ A;  2JDD A;  1M4I A;  4HNY B;  5HVF A;  1OZP A;  2PCU A;  5G21 A;  2PRQ A;  3CT9 A;  1FT7 A;  3L2N A;  1VHS A;  3QB8 A;  3A9L A;  3F0A A;  4HPS A;  4NGR A;  1XRY A;  2PC1 A;  2PQ8 A;  4JWP A;  1MJ9 A;  4OAD A;  2ZEF A;  3P2H A;  4XPK A;  3B2Y A;  1MJB A;  1RTQ A;  4MXU A;  4ZY1 A;  3PGP A;  1NSL A;  4RI1 A;  2VQY A;  3TTH A;  2ZEG A;  3TT2 A;  1IOF A;  2PJ8 A;  4NJQ A;  3D2M A;  4UFX A;  3MN8 A;  4R76 A;  1JWQ A;  2AFM A;  3KAS A;  4OKO A;  4KS9 A;  1Y7E A;  3V8I A;  4C7I A;  3R1K A;  4XPD B;  3DR8 A;  2KCW A;  3EC4 A;  2ZEL A;  3NFZ A;  3IFE A;  2B4D B;  2PJ0 A;  3KQX A;  3B8G A;  4MFJ A;  3NA6 A;  1Z8T A;  2R7H A;  2VI7 A;  4NGM A;  1N71 A;  2I79 A;  4P44 A;  4ORF A;  5EMI A;  3BJ8 A;  4FD6 A;  5EBV A;  4MCP A;  4A2Z A;  3HUV A;  1PUA A;  2ZOF A;  2FS5 A;  3IU1 A;  4A37 A;  2OZU A;  4CYP A;  5A27 A;  3OWC A;  5K8N A;  4PK3 A;  1QSR A;  2WSA A;  2AFS A;  3CXS A;  1TKF A;  1HDU A;  2R8V A;  3TFY A;  1R57 A;  3S6F A;  2VBQ A;  3CXQ A;  1Y9W A;  2JDC A;  2ZEH A;  2CTC A;  3WT4 A;  1IGB A;  2PJ5 A;  4Y49 B;  3WC6 A;  4UWI A;  4CGN A;  3B3T A;  2YNC A;  1Z9U A;  3VWE A;  2F7V A;  3MRU A;  4IK2 A;  1PYT B;  4NCZ A;  3I9S A;  4B5P A;  2EK8 A;  3H8G A;  2ZW6 A;  4M6G A;  3F8K A;  4H89 A;  3QAH A;  3GIU A;  3VAT A;  4QBJ A;  2WZN A;  4EME A;  1Q2Y A;  2YNC C;  5C82 A;  3BI1 A;  4P6Y A;  4OIW A;  3TCV A;  5HXD A;  1QSM A;  3E0K A;  3S6G A;  1Z4E A;  4P4F A;  2C1C A;  2BL1 A;  3KI9 A;  2QML A;  4QUS A;  1XIX A;  4KOU A;  1XFO A;  3GKR A;  4MJ8 A;  1PCA A;  3G8W A;  2CIJ A;  1ZLI A;  2FXF A;  1YLO A;  3SXO A;  4Q38 A;  5AGE A;  5G22 A;  4CAE A;  2BCO A;  1VHO A;  4MBU A;  1RXT A;  1EE3 P;  1Z8L A;  1IB1 E;  4ZBG A;  4WWV A;  4B11 A;  1Y0Y A;  2PIY A;  3IJ3 A;  2YGW A;  3TO6 A;  4MY0 A;  2ANP A;  2OR4 A;  3BHX A;  3SJF A;  3IO1 A;  1FNO A;  1CM0 A;  3DLJ A;  4CS0 B;  4A95 A;  2V8G A;  3PBE A;  4YFJ A;  2P6F A;  4X2T A;  4CYQ A;  5IV0 A;  3S6H A;  1CBX A;  3S9N A;  4EVY A;  1XEB A;  1WWZ A;  4PXC A;  3K2K A;  1BOB A;  3R9E A;  3DSB A;  4IF5 A;  3WC5 A;  2PJ1 A;  3FEE A;  3JTK A;  4CYO A;  3LOD A;  4IAV A;  3KKW A;  5F09 A;  5K8M A;  1Z2L A;  3T9Y A;  2J8N A;  4YU9 A;  1IIC A;  2PSW A;  4RUH A;  1CPX A;  4CGL A;  3S9L A;  2AFX A;  4KOY A;  1YK3 A;  2A4N A;  3NH4 A;  4UIA A;  5JH9 A;  2PJ2 A;  4PXB A;  3FIX A;  2FT0 A;  1XMB A;  3SI0 A;  3DGV A;  2PJA A;  5CPA A;  4QB9 A;  2WPX A;  2Z10 A;  4QC6 A;  3H8E A;  4HKF A;  4KUB A;  2B5G A;  3PP9 A;  4KOT A;  2V77 A;  3SXN A;  4CGO A;  4E2A A;  3HLP A;  4KSI A;  1CPS A;  1YX0 A;  4AVB A;  1UFH A;  4F8Z A;  2NYQ A;  2QVP A;  3NH8 A;  2AFO A;  1I21 A;  1S7K A;  3BLN A;  1LAP A;  3IU2 A;  2VL1 A;  3PEI A;  4X3R A;  4R3K A;  3WR7 A;  5CNP A;  4BMH A;  3KHX A;  3PB8 X;  2Z3L A;  2GE3 A;  4KSA A;  4MHD A;  3DDD A;  4FUU A;  4XNH B;  2CNS A;  2J8M A;  4RS2 A;  1KUY A;  4BD9 A;  2OB0 A;  4NGP A;  3TOB A;  4J3G A;  1KZF A;  2H5M A;  1ZG7 A;  3D7H A;  3JRU A;  4C7H A;  4ZY0 A;  2REE A;  4CPA A;  1IOI A;  1LFW A;  1VHE A;  2Q43 A;  3KZW A;  5F49 A;  1WK4 A;  4LQ6 A;  4MCS A;  1BPN A;  3IWE A;  1TF9 A;  2V8D A;  2RB7 A;  3RAM A;  4FD4 A;  3FF3 A;  3H4Q A;  1BLL E;  4UFV A;  2C27 A;  4P4J A;  3I1U A;  2B4D A;  1X10 A;  2OH1 A;  3KQZ A;  1PU9 A;  2XEJ A;  4OAE A;  4GXH A;  2JEW A;  2GFQ A;  2PVV A;  5E96 A;  2GLF A;  2XEI A;  3RBU A;  4NGN A;  3FRM A;  4OC4 A;  1I12 A;  2ARH A;  2B3V A;  3IWG A;  1XMT A;  3R9F A;  1X12 A;  3KGQ A;  4MFP A;  1XJO A;  4JYW A;  4CAF A;  1IYK A;  1NSA A;  3FEC A;  1GHE A;  1AYE A;  1LOK A;  2HB6 A;  5IB0 A;  3FX6 A;  4KVX A;  4NXY A;  4B5O A;  4HNW B;  3TE4 A;  3SJG A;  2Q7S A;  1DTD A;  3PB4 X;  1I1D A;  4AVC A;  2PR1 A;  2JLM A;  3KR4 A;  2CXA A;  4G1P A;  1QSN A;  1NMT A;  1YSJ A;  2ABZ A;  4A38 A;  3ISZ A;  3SI1 A;  3IIB A;  3IWW A;  4UIB A;  4DYO A;  1A2Z A;  2Q44 A;  1J4J A;  2BSW A;  3EY5 A;  2FSR A;  4MHZ A;  3B3W A;  2Q0Y A;  4CAX A;  4R8F A;  4C2Z A;  2BOA A;  5KTD A;  3PB9 X;  4B10 A;  4KOS A;  4PK2 A;  4GM5 A;  5THW A;  1YVK A;  1ZLH A;  2Y0M A;  3K9T A;  4UA3 A;  2ATR A;  3FXT A;  4UEF A;  4MFZ A;  4CRZ B;  3CZX A;  1L0C A;  4MMO A;  4BBH A;  4K30 A;  3K9U A;  2FIA A;  2CY2 A;  4JD6 A;  2R98 A;  2ZW4 A;  3TC8 A;  3B3S A;  4KOV A;  1AUG A;  4X8I A;  2J8R A;  4M6H A;  3VAR A;  3P2F A;  4I49 A;  4P10 A;  4Z65 A;  4MY3 A;  2Z3M A;  1M1D A;  2J9A A;  4KSF A;  1ARL A; 
#chains in the Genus database with same CATH homology
 2PJ9 A;  1CP7 A;  4EWT A;  1Z5R A;  1TXR A;  4FAI A;  3TX8 A;  3B7I A;  3PB7 X;  2PJB A;  2AFZ A;  1HEE A;  3FMC A;  2PJ7 A;  3IC1 A;  1UWY A;  3FH4 A;  4P45 A;  4OC0 A;  2EWB A;  4DJL A;  3LMS A;  1GYT A;  2PVW A;  5I4M A;  2NSM A;  5CBM A;  4OC2 A;  4K3N A;  4Q7A A;  2ZEN A;  3NH5 A;  2ZOG A;  1TKJ A;  4ZYQ A;  2DEA A;  1M4L A;  2V8H A;  4PXE A;  4TNU A;  3SI2 A;  3H8F A;  2QJ8 A;  3KHZ A;  1LAM A;  1LCP A;  3CPA A;  2C6P A;  1YME A;  1VGY A;  5JM6 A;  4ONW A;  2O53 A;  3ISX A;  5DS0 A;  2JBJ A;  4NGQ A;  4EFD A;  4MCQ A;  4PPZ A;  4P4E A;  4JZ0 A;  4PXD A;  5HVH A;  4F9U A;  4FBE A;  4ZX8 A;  2F8H A;  4MHP A;  4OID A;  8CPA A;  3QNV A;  5D29 A;  2V8V A;  4OME A;  1ELL P;  1H8L A;  3PB6 X;  3RZA A;  3D4U A;  3D67 A;  2C6G A;  4UF4 A;  4FWU A;  3GUX A;  5HVG A;  2I3C A;  2JBK A;  4W9Y A;  5LRJ A;  4LQG A;  3VH9 A;  3KR5 A;  2ZEE A;  4ZX9 A;  1QMU A;  4DUK A;  2Q51 A;  2ZEO A;  3KL9 A;  4PQA A;  4P4D A;  3GB0 A;  1YW6 A;  5D8N A;  3B3C A;  5IB9 A;  5LYD A;  2PJ6 A;  3WC7 A;  3SJX A;  4H2K A;  1VIX A;  2POK A;  2XEF A;  2FVG A;  4UEE A;  4OC5 A;  3D7D A;  1TKH A;  2GLJ A;  3BXM A;  3D7G A;  4ZY2 A;  1Y0R A;  1OBR A;  1QQ9 A;  2PJ3 A;  1LAN A;  5LRG A;  1CP6 A;  1KWM A;  3CPX A;  4YWY A;  2PE3 A;  3IEH A;  1F2P A;  4R7M A;  4R6T A;  2AFW A;  3BI0 A;  3LWU A;  1AMP A;  3FJU A;  1ZG9 A;  2GRE A;  4F9V A;  1ELM P;  2GU2 A;  3D7F A;  5LYF A;  1TF8 A;  4UEZ A;  4NFR A;  4O23 A;  3B35 A;  4TWE A;  4A39 A;  4IHM A;  3WAB A;  1XBU A;  1F57 A;  2IJZ A;  3D68 A;  4MRI A;  2ZEM A;  4NJR A;  2IQ6 A;  5LYL A;  2AFU A;  3PBB A;  3FVL A;  2WYR A;  1JQG A;  5K8O A;  4A94 A;  1YW4 A;  3N5F A;  2PJ4 A;  4MHN A;  4MHY A;  4OP4 A;  5J1Q A;  3V7Z A;  3D66 A;  4NGS A;  1ZG8 A;  6CPA A;  2PIZ A;  7CPA A;  3PRT A;  4OC1 A;  4AXV A;  1CX8 A;  1DE4 C;  2ZED A;  3PFE A;  4P4B A;  1R43 A;  2BO9 A;  3PFO A;  4B6Z A;  2HC9 A;  5LRK A;  2CF4 A;  1Q7L A;  3SJE A;  2O4H A;  4MCR A;  1R3N A;  2XEG A;  2ZEP A;  5LYI A;  4NGT A;  4P4I A;  2Q4Z A;  3V38 A;  2G9D A;  2OOT A;  1BPM A;  1CG2 A;  3S9M A;  1F2O A;  3CDX A;  2QYV A;  2CTB A;  2C6C A;  3GLJ A;  3T8W A;  4WJB A;  4OC3 A;  1BAV A;  5JGF A;  4ZI6 A;  3B3V A;  1IY7 A;  2PJC A;  2RFH A;  2EK9 A;  2IMO A;  5K8P A;  1ARM A;  3FED A;  1HDQ A;  5HVF A;  2PCU A;  2PRQ A;  3CT9 A;  1FT7 A;  3L2N A;  4NGR A;  1XRY A;  2ZEF A;  3B2Y A;  1RTQ A;  4MXU A;  4ZY1 A;  2ZEG A;  2PJ8 A;  4NJQ A;  3MN8 A;  4R76 A;  3KAS A;  2AFM A;  4OKO A;  1Y7E A;  2ZEL A;  3NFZ A;  3IFE A;  2PJ0 A;  3KQX A;  4NGM A;  3NA6 A;  5ELY A;  4P44 A;  4MCP A;  3HUV A;  2ZOF A;  4A37 A;  5K8N A;  2AFS A;  1TKF A;  1HDU A;  2ZEH A;  2CTC A;  3WT4 A;  1IGB A;  2PJ5 A;  3WC6 A;  3B3T A;  2F7V A;  3MRU A;  4IK2 A;  1PYT B;  2EK8 A;  3H8G A;  3VAT A;  2WZN A;  4EME A;  3BI1 A;  4P6Y A;  4OIW A;  5HXD A;  4P4F A;  2C1C A;  3KI9 A;  1XFO A;  1PCA A;  2CIJ A;  1ZLI A;  1YLO A;  2BCO A;  1VHO A;  1Z8L A;  1EE3 P;  4WWV A;  1Y0Y A;  2PIY A;  3IJ3 A;  2ANP A;  2OR4 A;  3BHX A;  3SJF A;  3IO1 A;  1FNO A;  3DLJ A;  2V8G A;  3PBE A;  4X2T A;  1CBX A;  3S9N A;  4PXC A;  3K2K A;  3WC5 A;  2PJ1 A;  3FEE A;  5F09 A;  4IAV A;  5K8M A;  1Z2L A;  4YU9 A;  4RUH A;  1CPX A;  3S9L A;  2AFX A;  3NH4 A;  5JH9 A;  4UIA A;  2PJ2 A;  1XMB A;  3SI0 A;  3DGV A;  2PJA A;  5CPA A;  3H8E A;  2V77 A;  3HLP A;  4KSI A;  1CPS A;  4F8Z A;  2NYQ A;  2QVP A;  3NH8 A;  2AFO A;  1LAP A;  2VL1 A;  3PEI A;  4X3R A;  3KHX A;  3PB8 X;  4FUU A;  4BD9 A;  4NGP A;  1ZG7 A;  3D7H A;  3JRU A;  4ZY0 A;  4CPA A;  1LFW A;  1VHE A;  2Q43 A;  3KZW A;  4MCS A;  1BPN A;  1TF9 A;  2V8D A;  2RB7 A;  3RAM A;  3FF3 A;  1BLL E;  4P4J A;  3I1U A;  3KQZ A;  2XEJ A;  2JEW A;  2PVV A;  3RBU A;  2GLF A;  2XEI A;  4NGN A;  4OC4 A;  3KGQ A;  1XJO A;  4JYW A;  1NSA A;  3FEC A;  1AYE A;  1LOK A;  2HB6 A;  3FX6 A;  3SJG A;  1DTD A;  3PB4 X;  3KR4 A;  4G1P A;  4A38 A;  1YSJ A;  2ABZ A;  3ISZ A;  3SI1 A;  3IIB A;  3IWW A;  4UIB A;  4DYO A;  4MHZ A;  3B3W A;  4R8F A;  2BOA A;  3PB9 X;  4GM5 A;  5THW A;  1ZLH A;  3K9T A;  4UEF A;  4MMO A;  3TC8 A;  3B3S A;  4X8I A;  3VAR A;  4P10 A;  4Z65 A;  2J9A A;  4PXB A;  1ARL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...