4F9UA

Structure of glycosylated glutaminyl cyclase from drosophila melanogaster
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
305
structure length
298
Chain Sequence
QWRDDEVHFNRTLDSILVPRVVGSRGHQQVREYLVQSLNGLGFQTEVDEFKQRVPVFGELTFANVVGTINPQAQNFLALACHYDSKYFPNDPGFVGATDSAVPCAILLNTAKTLGAYLQKEFRNRSDVGLMLIFFDGEEAFKEWTDADSVYGSKHLAAKLASKRSPRNIDRIEVLVLLDLIGARNPKFSSFYENTDGLHSSLVQIEKSLRTAGQLEGNNNMFLSRVSGGLVDDDHRPFLDENVPVLHLVATPFPDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYLKRHTSPVNLRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG32412
publication title Crystal Structures of Glutaminyl Cyclases (QCs) from Drosophila melanogaster Reveal Active Site Conservation between Insect and Mammalian QCs.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase, hydrolase
total genus 110
structure length 298
sequence length 305
chains with identical sequence B
ec nomenclature ec 2.3.2.5: Glutaminyl-peptide cyclotransferase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4f9uA00
1HDQA 1ARLA 4G1PA 1CX8A 4OC3A 1BPMA 1LFWA 2QJ8A 5I4MA 2EWBA 3LWUA 3PB7X 4TWEA 2PJ3A 2V77A 4MHNA 4WJBA 2AFZA 4BD9A 3NFZA 4P4DA 2OR4A 4A37A 2EK9A 4IHMA 3JRUA 4A94A 4NFRA 2RB7A 1YW4A 3PB6X 1OBRA 1TKJA 1ELLP 3CDXA 5HVFA 4MMOA 5LYFA 2PJ9A 7CPAA 4UF4A 2PIYA 4EMEA 5DS0A 2ZENA 3RBUA 4W9YA 2PRQA 1ZLHA 2V8GA 3B2YA 4R6TA 5IB9A 2PJ5A 2ZEGA 2J9AA 2ZEHA 1YMEA 5LRJA 3IEHA 2CTBA 4A38A 2XEIA 3WABA 3B3TA 3FMCA 3I1UA 2EK8A 1BLLE 1LAPA 1QMUA 2ZOFA 3B3CA 4IAVA 3VATA 4NGSA 3D68A 4OC1A 2GLFA 3LMSA 4DUKA 4NJQA 4EFDA 1NSAA 1YLOA 3VH9A 3V38A 4A39A 4NGPA 3WC7A 3SJXA 2HC9A 2C6GA 2Q51A 4X2TA 1AYEA 2OOTA 3ISXA 4NGNA 3PBBA 1ARMA 1ZLIA 3VARA 4UEZA 1CP7A 2PVVA 4NJRA 4FBEA 4MCPA 4MCQA 4UIBA 4OKOA 4F8ZA 1LAMA 4OIDA 3SJFA 4FWUA 1BPNA 3RZAA 8CPAA 2WZNA 4WWVA 3N5FA 2ZOGA 2Q43A 1VHOA 3SJGA 4K3NA 3NH4A 4PQAA 5D29A 1Z8LA 3D7HA 1TKHA 1LANA 3DGVA 1CBXA 3B7IA 3MRUA 1YSJA 3K9TA 4P44A 1IGBA 1Q7LA 3V7ZA 2O4HA 4JYWA 2Q4ZA 2O53A 1TKFA 3B3VA 2PJCA 4PXEA 1UWYA 3S9NA 1QQ9A 1CPSA 1R43A 4MHPA 4OC4A 4MCRA 2IJZA 2GLJA 4ZY2A 1F57A 4P45A 5HVHA 3NH5A 3KQZA 3B3SA 1ZG9A 3FF3A 3PB8X 3QNVA 5JH9A 1TF9A 4H2KA 4X8IA 2C1CA 4AXVA 4LQGA 4ZX9A 1IY7A 1TXRA 3SJEA 2AFOA 3GLJA 4P10A 3WC5A 4MXUA 2GU2A 3FH4A 1PCAA 2ZEEA 4MHZA 4NGMA 2POKA 2QVPA 4OC5A 4R76A 2CTCA 4PPZA 1ELMP 3S9MA 2AFUA 4MCSA 3IWWA 3H8FA 3PFEA 6CPAA 5J1QA 3D7FA 1YW6A 4F9UA 2AFSA 2ZEDA 1Y0YA 5LYLA 2XEGA 3KASA 1XJOA 4YU9A 4ZX8A 3GB0A 1R3NA 3T8WA 4ZY1A 2PE3A 3KHXA 3RAMA 2JBJA 2AFWA 4ZI6A 5K8NA 5HVGA 1ZG7A 2V8HA 4ZYQA 2QYVA 1AMPA 4PXCA 4UEFA 5ELYA 5LYDA 3PB9X 2AFMA 3WC6A 2PJ0A 1LOKA 2PJ2A 2BO9A 1GYTA 3L2NA 3KR5A 3NA6A 3B3WA 1FNOA 1Y7EA 4OC2A 2PJ7A 2ZEOA 3H8GA 1RTQA 2RFHA 5CBMA 3KZWA 4MRIA 5K8PA 2PIZA 3FEDA 3CPAA 3MN8A 3PEIA 2FVGA 1XRYA 2PJ4A 4Z65A 1ZG8A 4FUUA 2F7VA 1DTDA 4P6YA 2CF4A 2PVWA 3KI9A 3FEEA 3DLJA 3K2KA 2PJ1A 3BI1A 2BCOA 3BHXA 1FT7A 2CIJA 3D7GA 4OP4A 1XBUA 3BI0A 4DJLA 3WT4A 3KQXA 2V8DA 3IIBA 2PJAA 3PBEA 4NGQA 2ZELA 3PFOA 4PXDA 2GREA 4P4EA 3FECA 2NYQA 4PXBA 4UEEA 3D66A 3FJUA 2JBKA 1JQGA 3HUVA 4P4JA 1LCPA 2C6PA 2PCUA 2F8HA 5K8OA 3D7DA 1TF8A 3IFEA 1HEEA 2JEWA 4IK2A 1CP6A 3TX8A 3S9LA 3HLPA 3D4UA 4OMEA 2BOAA 2ZEPA 4DYOA 3IO1A 3KL9A 3IC1A 4RUHA 3KR4A 1VIXA 4P4IA 2IQ6A 2ANPA 5CPAA 3BXMA 5JGFA 1F2OA 2ABZA 2PJ8A 4P4FA 5K8MA 2HB6A 3SI2A 2WYRA 3PRTA 3NH8A 1XMBA 4TNUA 5D8NA 2AFXA 2NSMA 4GM5A 4B6ZA 3KGQA 4YWYA 4KSIA 2IMOA 2ZEFA 1DE4C 5F09A 4ONWA 4O23A 3H8EA 5LRGA 2G9DA 2PJ6A 4NGRA 3D67A 2V8VA 4JZ0A 5LRKA 3SI0A 3FVLA 3ISZA 5LYIA 1Z5RA 1Y0RA 3PB4X 1EE3P 2XEJA 3CT9A 3CPXA 1M4LA 1Z2LA 3IJ3A 2I3CA 4CPAA 4Q7AA 1PYTB 1CPXA 2ZEMA 3KHZA 4R8FA 1H8LA 1VHEA 3TC8A 2PJBA 5HXDA 4NGTA 1VGYA 1HDUA 4P4BA 2VL1A 4MHYA 4R7MA 4FAIA 2C6CA 4X3RA 1F2PA 5THWA 3B35A 4ZY0A 1KWMA 3SI1A 3FX6A 1BAVA 2DEAA 4OC0A 1XFOA 4OIWA 4EWTA 2XEFA 5JM6A 1CG2A 4F9VA 4UIAA 3GUXA
chains in the Genus database with same CATH superfamily
1HDQA 1ARLA 2O28A 2B3UA 4G1PA 3TCVA 2B3VA 1CX8A 2KCWA 2Z3NA 1BPMA 4OC3A 1LFWA 1P4NA 2AE6A 2QJ8A 5I4MA 3LD2A 2EWBA 3LWUA 3PB7X 3FIXA 4TWEA 2PJ3A 2V77A 4MHNA 4WJBA 2AFZA 4BD9A 2YNCC 2WSAA 3NFZA 4C2XA 1IOFA 4CAXA 4EVYA 4P4DA 2OR4A 4PSXA 1BOBA 4UWJA 4A37A 2EK9A 5C88A 4Y49C 4IHMA 2DXQA 3JRUA 4UCPA 2Q04A 3S6FA 4A94A 3BLNA 4LUAA 4NFRA 2RB7A 1YW4A 3PB6X 1ON0A 1OBRA 4MFKA 4B11A 1TKJA 4R87A 1Q2YA 4B5PB 4C68A 4F0XA 2FS5A 5EBVA 4KSAA 1ELLP 3CDXA 5HVFA 4MMOA 4JWPA 1XIXA 1KUXA 2HUZA 5LYFA 2BEIA 2PJ9A 1I12A 7CPAA 3R9EA 4AVAA 2FIAA 4UF4A 2PIYA 4EMEA 4UCMA 4MFJA 4FD5A 5DS0A 2ZENA 3RBUA 5FVJA 5KTCA 2P6EA 4CGOA 5I0CA 4W9YA 1YLEA 2RC4A 2YNDA 4F0YA 2PRQA 1QSOA 1ZLHA 2V8GA 3B2YA 3GIUA 4KOTA 2PJ5A 4R6TA 1QSTA 5IB9A 2ZEGA 2J9AA 2ZEHA 3FXTA 3UY5A 1YMEA 5LRJA 3IEHA 3GY9A 2DPTA 2CTBA 2QECA 3T9YA 3T90A 4A38A 1U6MA 3RNZA 2XEIA 3PZJA 3B3TA 3FMCA 4UCNA 4R9MA 3WABA 1QSNA 3I1UA 2EK8A 3RO0A 5F48A 1BLLE 4UA3A 5G21A 1LAPA 1V0CA 4QC6A 4Q38A 1QMUA 2ZOFA 3B3CA 4IAVA 3FYNA 4PV6A 2R8VA 3VATA 4GXHA 4NGSA 4Y49B 1IIDA 2PC1A 3D68A 4OC1A 2GLFA 3LMSA 1L0CA 4DUKA 2VI7A 4NJQA 4HPSA 4EFDA 2EUIA 2ARHA 1NSAA 1YLOA 4NCZA 3VH9A 3V38A 3QB8A 1KUVA 3H4QA 1SQHA 3D2PA 4A39A 4NGPA 3WC7A 5ISVA 3SJXA 1IB1E 2BL1A 2HC9A 2C6GA 2Q51A 3S6KA 1YX0A 1AYEA 4X2TA 2OOTA 2YGWA 3ISXA 1NE9A 4NGNA 1RXTA 3FNCA 3TTHA 3PBBA 1ARMA 2G0BA 1ZLIA 3VARA 3NE7A 3JTKA 4UEZA 1CP7A 1Y7RA 5DWNA 4UWIA 2PVVA 4NJRA 4FBEA 4MCPA 1Z4EA 2X7BA 4M6GA 4MCQA 4UIBA 1Y9KA 4OKOA 4B5PA 3FBUA 2VBQA 4F8ZA 1B6BA 2Q7BA 4MHDA 3H5ZA 1LAMA 4OIDA 4BINA 3SJFA 2BUEA 2Q4YA 1I21A 1BPNA 4FWUA 2Q7SA 4KOYA 2VZZA 5HH1A 3F0AA 4YRHA 3RZAA 2ZW6A 2WZNA 4WWVA 8CPAA 3ZJ0A 1VHSA 5IX3A 3N5FA 3FRMA 4GS4A 4UFWA 2Z3LA 2ZOGA 4CGNA 1Z9UA 2QMLA 2Q43A 4FD7A 1VHOA 3SJGA 1Z8XA 4B13A 1NSLA 4BBHA 2P0WA 3R96A 4K3NA 3V8IA 4AVBA 1XF8A 3NH4A 2Z3MA 4MFZA 4PQAA 2REEA 1Z8LA 3D7HA 1MJ9A 5D29A 1IYKA 4CGPA 1TKHA 1LANA 3DGVA 3R95A 1CBXA 3B7IA 3MRUA 1S7KA 4B10A 3N7ZA 1YSJA 4KUAA 3K9TA 4P44A 4CYOA 2EO8A 1IGBA 1Q7LA 1A2ZA 2YNCA 3V7ZA 1I1DA 2O4HA 3C26A 3TO7A 4JYWA 2Q4ZA 4UFVA 2EBJA 4KVXA 3RYOA 4AVCA 4KOXA 2O53A 3CXSA 5H84A 1TKFA 3B3VA 2PJCA 4J3GA 4PXEA 2R1IA 1UWYA 2JDCA 2PQ8A 3S9NA 4CRZB 3GYAA 4R3KA 1QQ9A 1CPSA 1FY7A 1JWQA 1R43A 4MHPA 4XPLA 3K9UA 5A28A 3CXQA 1YVOA 4C2ZA 4OC4A 5EC4A 4MCRA 2IJZA 2VXKA 2GLJA 4ZY2A 1F57A 4P45A 5HVHA 3NH5A 4HNYB 3KQZA 5F47A 3B3SA 1ZG9A 5CNPA 1NMTA 4CYNA 3FF3A 1ZO0A 4NF1A 1M4DA 3PB8X 3QNVA 1XEBA 4MI4A 4KVOE 2Q44A 1WWZA 2NMTA 5JH9A 2CY2A 3I9SA 4MY0A 1TF9A 4H2KA 2Q0YA 4X8IA 2C1CA 4AXVA 1M4IA 1M44A 4LQGA 1IY7A 4ZX9A 4CGMA 3VWEA 1TXRA 4ORFA 3SJEA 2BSWA 4CYPA 2WUUA 2AFOA 3GLJA 3LACA 4P10A 3SHPA 3WC5A 4KLWA 3S6GA 1XOVA 4E8OA 4U9ZA 4MXUA 2GU2A 3R9FA 3FH4A 1YGHA 1PCAA 1B87A 4HNWB 4A33A 3F8KA 2ZEEA 4L8AA 4MHZA 4NGMA 4KORA 5IB0A 2POKA 2QVPA 4NXYA 4OC5A 4R76A 2CTCA 4PPZA 2Z3KA 4H89A 5E96A 3G8WA 2I00A 1ELMP 2C27A 2VEZA 1Q2DA 3S9MA 2AFUA 3QAHA 1MJBA 2CNMA 2R98A 2VZYA 3IWWA 3B8GA 3H8FA 3PFEA 4H6ZA 6CPAA 3TFYA 5J1QA 3D7FA 1YW6A 4F9UA 2AFSA 2ZEDA 1Y0YA 4KOUA 4JJXA 5LYLA 1YK3A 2XEGA 2Z10A 3KASA 1XJOA 4K30A 4YU9A 4ZX8A 3W6SA 2QIRA 3GB0A 2OH1A 1R3NA 3DR8A 1S7LA 5H86A 3T8WA 4ZY1A 3W6XA 2A4NA 3R1KA 2PE3A 3TOBA 1S7NA 3KHXA 3RAMA 2REFA 2JBJA 3DSBA 3W91A 2AFWA 4LX9A 5J8FA 2ATRA 2OU2A 4ZI6A 4MFQA 5K8NA 5HVGA 4FD4A 5G22A 4C2YA 4NEXA 1ZG7A 2V8HA 4OADA 4KLVA 4ZYQA 4I49A 3SXOA 2ZXVA 2QYVA 3D8PA 5C82A 3JUWA 1AMPA 4PXCA 2FCKA 3CZXA 2FL4A 4UEFA 1AUGA 1X10A 4KOWA 5ELYA 5LYDA 3OWCA 4A32A 3PB9X 2AFMA 2H5MA 3WC6A 1YQEA 4CRYB 4MFPA 2PJ0A 4OAEA 1LOKA 2PJ2A 2BO9A 4BMHA 4AB7A 1GYTA 2OZHA 2FT0A 3KR5A 3L2NA 1YVKA 2OZUA 3NA6A 3B3WA 1YREA 3ZZIA 1FNOA 3DDDA 4A30A 4CGLA 1Y7EA 1Z4RA 2VQYA 2PJ7A 2ZEOA 3H8GA 4OC2A 1KUYA 4II9A 1RTQA 2RFHA 2ZW7A 1J4JA 3LODA 5CBMA 3KZWA 2P6GA 4MRIA 3EFAA 4ZBGA 5K8PA 2PIZA 3FEDA 3CPAA 3IWEA 2B5GB 2J8MA 4M85A 3MN8A 4MFLA 3PEIA 2FVGA 1XRYA 2PJ4A 3EO4A 4Z65A 1ZG8A 3NE8A 4FUUA 2F7VA 2Y0MA 1X12A 2D4PA 1XMTA 4L89A 4XPDC 1DTDA 4P6YA 5G1ZA 1QSMA 2CF4A 1S60A 2PVWA 4IUSA 3KI9A 3FEEA 3DLJA 4B12A 5JPHA 3QAYA 3K2KA 2PJ1A 2Z0ZA 2J8RA 3BI1A 3FB3A 2BCOA 3BHXA 1FT7A 2AJ6A 4MY3A 2CIJA 3D7GA 4OP4A 2WPXA 1XBUA 2ODFA 3BI0A 4DJLA 3GKRA 3WT4A 2B4BA 3KQXA 5G20A 2PRBA 5IV0A 2V8DA 1BO4A 1LRZA 5GCNA 1YR0A 2PR1A 3IIBA 2FE7A 2PJAA 3PBEA 4NGQA 2GANA 2Z3OA 4RS2A 2ZELA 3PFOA 4A31A 4PXDA 2GREA 4HNXB 4MBUA 4M3SA 2I79A 4P4EA 3FECA 2NYQA 4PXBA 4UEEA 3WR7A 3D66A 3FJUA 1GHEA 2JBKA 2ZPAA 4KS9A 1JQGA 3HUVA 2CNTA 4P4JA 1LCPA 2C6PA 3S6HA 3DR6A 2PCUA 2F8HA 2HV2A 4AG7A 3EY5A 3D7DA 4KSFA 5K8OA 1TF8A 4HKFA 4JLYA 4CYQA 5A27A 3IFEA 4XPKA 5DWMA 1HEEA 1M1DA 2JEWA 4IK2A 1UFHA 2R7HA 1CP6A 3TX8A 3S9LA 3HLPA 3D4UA 1XE4A 4OMEA 4CS0B 1MK4A 2PR8A 2DPSA 2BOAA 4XPDB 2ZEPA 4A2ZA 4DYOA 3TOAA 3IO1A 3KL9A 5AG7A 4M6IA 5F46A 3IC1A 1P0HA 4RUHA 3PP9A 2YNEA 3KR4A 4QB9A 4CAEA 1VIXA 4PK3A 4P4IA 2IQ6A 2ANPA 5CPAA 5KTDA 3BXMA 5JGFA 3A9LA 1IICA 1F2OA 2ABZA 4RN7A 3IWGA 2F5IA 2PJ8A 1IU8A 4PSWA 2WPWA 4ZGYB 3D2MA 3P2FA 2Q4VA 4P4FA 1KZFA 3KKWA 1K4JA 1Q2CA 4DNCA 4U5YA 4QVTA 4R57A 4QBJA 1RO5A 3I3GA 2HB6A 5K8MA 2B5GA 1S5KA 3VWDA 3SI2A 4KVME 2GE3A 2WYRA 3PRTA 4B14A 3DNSA 4F6AA 3E0KA 3NH8A 4JXRA 4KUBA 4OLLA 1XMBA 3JVNA 4TNUA 3R9GA 4XNHC 3BJ7A 5D8NA 4IF5A 2AFXA 4YFJA 3TO9A 1Z8WA 2NSMA 4GM5A 2B4DA 2B58A 4B6ZA 3KGQA 2P6FA 2OB0A 4YWYA 4KSIA 3TE4A 2IMOA 1S3ZA 2ZEFA 1IYLA 1CM0A 2HQYA 2JLMA 1CJWA 1DE4C 1OZPA 5F09A 3CXPA 5JQ4A 1S7FA 4ONWA 1M4GA 4AG9A 5AGEA 4E2AA 3F5BA 5HMNA 4O23A 3H8EA 5LRGA 4CAFA 2G9DA 4ONUA 2FIWA 4KOSA 1R57A 1VKCA 2PJ6A 1PU9A 2G3TA 2ZW5A 4NGRA 3D67A 2V8VA 2JEVA 4JZ0A 4YGOA 1PUAA 3EXNA 3FVLA 3ISZA 3SI0A 5LRKA 5LYIA 2CXAA 3BJ8A 2CNSA 5AG5A 1Z5RA 1Y0RA 3PB4X 2D4OA 3IU2A 1EE3P 2XEJA 3CT9A 4UFXA 3CPXA 1M4LA 5F49A 4E0AA 1Z2LA 2IL4A 3IJ3A 4H6UA 3MGDA 4PK2A 2EVNA 2I3CA 4CPAA 4XNHB 4QUSA 1IOIA 4Q7AA 4M6HA 4R3LA 4RI1A 2J8NA 5AG6A 4FD6A 4MCSA 4UBRA 2GFQA 1PYTB 4LQ6A 2FXFA 2OZGA 2Z3PA 1QSRA 1CPXA 4CAWA 1Z8TA 2ZEMA 3KHZA 3P2HA 4R8FA 1H8LA 4KZTA 1N71A 1VHEA 5BWAB 2ZW4A 5EMIA 3TC8A 2PJBA 3SXNA 5HXDA 2JDDA 4NGTA 1VGYA 4C7HA 1HDUA 4MJ8A 3IGRA 4P4BA 1MJAA 2VL1A 1TIQA 4JD6A 4MHYA 5KTAA 5AG4A 4KOVA 2B4DB 2Z11A 4B5OA 4C7IA 4R7MA 4FAIA 2C6CA 3EC4A 4X3RA 3PGPA 4CAVA 2PDOA 3G3SA 1F2PA 2PSWA 1WK4A 4JXQA 5THWA 4X5KA 3B35A 4A95A 4ZY0A 2DF5A 1KWMA 3SI1A 3FX6A 1BAVA 2G3AA 3TT2A 2DEAA 2K5TA 1XFOA 4NSQA 4OC0A 4OIWA 3D3SA 4EWTA 3TO6A 2XEFA 2GIVA 3IU1A 4U9YA 5JM6A 1CG2A 4F9VA 4UIAA 1Y9WA 4Q36A 2FSRA 5J8CA 3GUXA
chains in the Genus database with same CATH topology
1HDQA 1ARLA 4G1PA 1CX8A 4OC3A 1BPMA 1LFWA 2QJ8A 5I4MA 2EWBA 3LWUA 3PB7X 4TWEA 2PJ3A 2V77A 4MHNA 4WJBA 2AFZA 4BD9A 3NFZA 4P4DA 2OR4A 4A37A 2EK9A 4IHMA 3JRUA 4A94A 4NFRA 2RB7A 1YW4A 3PB6X 1OBRA 1TKJA 1ELLP 3CDXA 5HVFA 4MMOA 5LYFA 2PJ9A 7CPAA 4UF4A 2PIYA 4EMEA 5DS0A 2ZENA 3RBUA 4W9YA 2PRQA 1ZLHA 2V8GA 3B2YA 4R6TA 5IB9A 2PJ5A 2ZEGA 2J9AA 2ZEHA 1YMEA 5LRJA 3IEHA 2CTBA 4A38A 2XEIA 3WABA 3B3TA 3FMCA 3I1UA 2EK8A 1BLLE 1LAPA 1QMUA 2ZOFA 3B3CA 4IAVA 3VATA 4NGSA 3D68A 4OC1A 2GLFA 3LMSA 4DUKA 4NJQA 4EFDA 1NSAA 1YLOA 3VH9A 3V38A 4A39A 4NGPA 3WC7A 3SJXA 2HC9A 2C6GA 2Q51A 4X2TA 1AYEA 2OOTA 3ISXA 4NGNA 3PBBA 1ARMA 1ZLIA 3VARA 4UEZA 1CP7A 2PVVA 4NJRA 4FBEA 4MCPA 4MCQA 4UIBA 4OKOA 4F8ZA 1LAMA 4OIDA 3SJFA 4FWUA 1BPNA 3RZAA 8CPAA 2WZNA 4WWVA 3N5FA 2ZOGA 2Q43A 1VHOA 3SJGA 4K3NA 3NH4A 4PQAA 5D29A 1Z8LA 3D7HA 1TKHA 1LANA 3DGVA 1CBXA 3B7IA 3MRUA 1YSJA 3K9TA 4P44A 1IGBA 1Q7LA 3V7ZA 2O4HA 4JYWA 2Q4ZA 2O53A 1TKFA 3B3VA 2PJCA 4PXEA 1UWYA 3S9NA 1QQ9A 1CPSA 1R43A 4MHPA 4OC4A 4MCRA 2IJZA 2GLJA 4ZY2A 1F57A 4P45A 5HVHA 3NH5A 3KQZA 3B3SA 1ZG9A 3FF3A 3PB8X 3QNVA 5JH9A 1TF9A 4H2KA 4X8IA 2C1CA 4AXVA 4LQGA 4ZX9A 1IY7A 1TXRA 3SJEA 2AFOA 3GLJA 4P10A 3WC5A 4MXUA 2GU2A 3FH4A 1PCAA 2ZEEA 4MHZA 4NGMA 2POKA 2QVPA 4OC5A 4R76A 2CTCA 4PPZA 1ELMP 3S9MA 2AFUA 4MCSA 3IWWA 3H8FA 3PFEA 6CPAA 5J1QA 3D7FA 1YW6A 4F9UA 2AFSA 2ZEDA 1Y0YA 5LYLA 2XEGA 3KASA 1XJOA 4YU9A 4ZX8A 3GB0A 1R3NA 3T8WA 4ZY1A 2PE3A 3KHXA 3RAMA 2JBJA 2AFWA 4ZI6A 5K8NA 5HVGA 1ZG7A 2V8HA 4ZYQA 2QYVA 1AMPA 4PXCA 4UEFA 5ELYA 5LYDA 3PB9X 2AFMA 3WC6A 2PJ0A 1LOKA 2PJ2A 2BO9A 1GYTA 3L2NA 3KR5A 3NA6A 3B3WA 1FNOA 1Y7EA 4OC2A 2PJ7A 2ZEOA 3H8GA 1RTQA 2RFHA 5CBMA 3KZWA 4MRIA 5K8PA 2PIZA 3FEDA 3CPAA 3MN8A 3PEIA 2FVGA 1XRYA 2PJ4A 4Z65A 1ZG8A 4FUUA 2F7VA 1DTDA 4P6YA 2CF4A 2PVWA 3KI9A 3FEEA 3DLJA 3K2KA 2PJ1A 3BI1A 2BCOA 3BHXA 1FT7A 2CIJA 3D7GA 4OP4A 1XBUA 3BI0A 4DJLA 3WT4A 3KQXA 2V8DA 3IIBA 2PJAA 3PBEA 4NGQA 2ZELA 3PFOA 4PXDA 2GREA 4P4EA 3FECA 2NYQA 4PXBA 4UEEA 3D66A 3FJUA 2JBKA 1JQGA 3HUVA 4P4JA 1LCPA 2C6PA 2PCUA 2F8HA 5K8OA 3D7DA 1TF8A 3IFEA 1HEEA 2JEWA 4IK2A 1CP6A 3TX8A 3S9LA 3HLPA 3D4UA 4OMEA 2BOAA 2ZEPA 4DYOA 3IO1A 3KL9A 3IC1A 4RUHA 3KR4A 1VIXA 4P4IA 2IQ6A 2ANPA 5CPAA 3BXMA 5JGFA 1F2OA 2ABZA 2PJ8A 4P4FA 5K8MA 2HB6A 3SI2A 2WYRA 3PRTA 3NH8A 1XMBA 4TNUA 5D8NA 2AFXA 2NSMA 4GM5A 4B6ZA 3KGQA 4YWYA 4KSIA 2IMOA 2ZEFA 1DE4C 5F09A 4ONWA 4O23A 3H8EA 5LRGA 2G9DA 2PJ6A 4NGRA 3D67A 2V8VA 4JZ0A 5LRKA 3SI0A 3FVLA 3ISZA 5LYIA 1Z5RA 1Y0RA 3PB4X 1EE3P 2XEJA 3CT9A 3CPXA 1M4LA 1Z2LA 3IJ3A 2I3CA 4CPAA 4Q7AA 1PYTB 1CPXA 2ZEMA 3KHZA 4R8FA 1H8LA 1VHEA 3TC8A 2PJBA 5HXDA 4NGTA 1VGYA 1HDUA 4P4BA 2VL1A 4MHYA 4R7MA 4FAIA 2C6CA 4X3RA 1F2PA 5THWA 3B35A 4ZY0A 1KWMA 3SI1A 3FX6A 1BAVA 2DEAA 4OC0A 1XFOA 4OIWA 4EWTA 2XEFA 5JM6A 1CG2A 4F9VA 4UIAA 3GUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HDQ A;  1ARL A;  4G1P A;  1CX8 A;  4OC3 A;  1BPM A;  1LFW A;  2QJ8 A;  5I4M A;  2EWB A;  3LWU A;  3PB7 X;  4TWE A;  2PJ3 A;  2V77 A;  4MHN A;  4WJB A;  2AFZ A;  4BD9 A;  3NFZ A;  4P4D A;  2OR4 A;  4A37 A;  2EK9 A;  4IHM A;  3JRU A;  4A94 A;  4NFR A;  2RB7 A;  1YW4 A;  3PB6 X;  1OBR A;  1TKJ A;  1ELL P;  3CDX A;  5HVF A;  4MMO A;  5LYF A;  2PJ9 A;  7CPA A;  4UF4 A;  2PIY A;  4EME A;  5DS0 A;  2ZEN A;  3RBU A;  4W9Y A;  2PRQ A;  1ZLH A;  2V8G A;  3B2Y A;  4R6T A;  5IB9 A;  2PJ5 A;  2ZEG A;  2J9A A;  2ZEH A;  1YME A;  5LRJ A;  3IEH A;  2CTB A;  4A38 A;  2XEI A;  3WAB A;  3B3T A;  3FMC A;  3I1U A;  2EK8 A;  1BLL E;  1LAP A;  1QMU A;  2ZOF A;  3B3C A;  4IAV A;  3VAT A;  4NGS A;  3D68 A;  4OC1 A;  2GLF A;  3LMS A;  4DUK A;  4NJQ A;  4EFD A;  1NSA A;  1YLO A;  3VH9 A;  3V38 A;  4A39 A;  4NGP A;  3WC7 A;  3SJX A;  2HC9 A;  2C6G A;  2Q51 A;  4X2T A;  1AYE A;  2OOT A;  3ISX A;  4NGN A;  3PBB A;  1ARM A;  1ZLI A;  3VAR A;  4UEZ A;  1CP7 A;  2PVV A;  4NJR A;  4FBE A;  4MCP A;  4MCQ A;  4UIB A;  4OKO A;  4F8Z A;  1LAM A;  4OID A;  3SJF A;  4FWU A;  1BPN A;  3RZA A;  8CPA A;  2WZN A;  4WWV A;  3N5F A;  2ZOG A;  2Q43 A;  1VHO A;  3SJG A;  4K3N A;  3NH4 A;  4PQA A;  5D29 A;  1Z8L A;  3D7H A;  1TKH A;  1LAN A;  3DGV A;  1CBX A;  3B7I A;  3MRU A;  1YSJ A;  3K9T A;  4P44 A;  1IGB A;  1Q7L A;  3V7Z A;  2O4H A;  4JYW A;  2Q4Z A;  2O53 A;  1TKF A;  3B3V A;  2PJC A;  4PXE A;  1UWY A;  3S9N A;  1QQ9 A;  1CPS A;  1R43 A;  4MHP A;  4OC4 A;  4MCR A;  2IJZ A;  2GLJ A;  4ZY2 A;  1F57 A;  4P45 A;  5HVH A;  3NH5 A;  3KQZ A;  3B3S A;  1ZG9 A;  3FF3 A;  3PB8 X;  3QNV A;  5JH9 A;  1TF9 A;  4H2K A;  4X8I A;  2C1C A;  4AXV A;  4LQG A;  4ZX9 A;  1IY7 A;  1TXR A;  3SJE A;  2AFO A;  3GLJ A;  4P10 A;  3WC5 A;  4MXU A;  2GU2 A;  3FH4 A;  1PCA A;  2ZEE A;  4MHZ A;  4NGM A;  2POK A;  2QVP A;  4OC5 A;  4R76 A;  2CTC A;  4PPZ A;  1ELM P;  3S9M A;  2AFU A;  4MCS A;  3IWW A;  3H8F A;  3PFE A;  6CPA A;  5J1Q A;  3D7F A;  1YW6 A;  4F9U A;  2AFS A;  2ZED A;  1Y0Y A;  5LYL A;  2XEG A;  3KAS A;  1XJO A;  4YU9 A;  4ZX8 A;  3GB0 A;  1R3N A;  3T8W A;  4ZY1 A;  2PE3 A;  3KHX A;  3RAM A;  2JBJ A;  2AFW A;  4ZI6 A;  5K8N A;  5HVG A;  1ZG7 A;  2V8H A;  4ZYQ A;  2QYV A;  1AMP A;  4PXC A;  4UEF A;  5ELY A;  5LYD A;  3PB9 X;  2AFM A;  3WC6 A;  2PJ0 A;  1LOK A;  2PJ2 A;  2BO9 A;  1GYT A;  3L2N A;  3KR5 A;  3NA6 A;  3B3W A;  1FNO A;  1Y7E A;  4OC2 A;  2PJ7 A;  2ZEO A;  3H8G A;  1RTQ A;  2RFH A;  5CBM A;  3KZW A;  4MRI A;  5K8P A;  2PIZ A;  3FED A;  3CPA A;  3MN8 A;  3PEI A;  2FVG A;  1XRY A;  2PJ4 A;  4Z65 A;  1ZG8 A;  4FUU A;  2F7V A;  1DTD A;  4P6Y A;  2CF4 A;  2PVW A;  3KI9 A;  3FEE A;  3DLJ A;  3K2K A;  2PJ1 A;  3BI1 A;  2BCO A;  3BHX A;  1FT7 A;  2CIJ A;  3D7G A;  4OP4 A;  1XBU A;  3BI0 A;  4DJL A;  3WT4 A;  3KQX A;  2V8D A;  3IIB A;  2PJA A;  3PBE A;  4NGQ A;  2ZEL A;  3PFO A;  4PXD A;  2GRE A;  4P4E A;  3FEC A;  2NYQ A;  4PXB A;  4UEE A;  3D66 A;  3FJU A;  2JBK A;  1JQG A;  3HUV A;  4P4J A;  1LCP A;  2C6P A;  2PCU A;  2F8H A;  5K8O A;  3D7D A;  1TF8 A;  3IFE A;  1HEE A;  2JEW A;  4IK2 A;  1CP6 A;  3TX8 A;  3S9L A;  3HLP A;  3D4U A;  4OME A;  2BOA A;  2ZEP A;  4DYO A;  3IO1 A;  3KL9 A;  3IC1 A;  4RUH A;  3KR4 A;  1VIX A;  4P4I A;  2IQ6 A;  2ANP A;  5CPA A;  3BXM A;  5JGF A;  1F2O A;  2ABZ A;  2PJ8 A;  4P4F A;  5K8M A;  2HB6 A;  3SI2 A;  2WYR A;  3PRT A;  3NH8 A;  1XMB A;  4TNU A;  5D8N A;  2AFX A;  2NSM A;  4GM5 A;  4B6Z A;  3KGQ A;  4YWY A;  4KSI A;  2IMO A;  2ZEF A;  1DE4 C;  5F09 A;  4ONW A;  4O23 A;  3H8E A;  5LRG A;  2G9D A;  2PJ6 A;  4NGR A;  3D67 A;  2V8V A;  4JZ0 A;  5LRK A;  3SI0 A;  3FVL A;  3ISZ A;  5LYI A;  1Z5R A;  1Y0R A;  3PB4 X;  1EE3 P;  2XEJ A;  3CT9 A;  3CPX A;  1M4L A;  1Z2L A;  3IJ3 A;  2I3C A;  4CPA A;  4Q7A A;  1PYT B;  1CPX A;  2ZEM A;  3KHZ A;  4R8F A;  1H8L A;  1VHE A;  3TC8 A;  2PJB A;  5HXD A;  4NGT A;  1VGY A;  1HDU A;  4P4B A;  2VL1 A;  4MHY A;  4R7M A;  4FAI A;  2C6C A;  4X3R A;  1F2P A;  5THW A;  3B35 A;  4ZY0 A;  1KWM A;  3SI1 A;  3FX6 A;  1BAV A;  2DEA A;  4OC0 A;  1XFO A;  4OIW A;  4EWT A;  2XEF A;  5JM6 A;  1CG2 A;  4F9V A;  4UIA A;  3GUX A; 
#chains in the Genus database with same CATH topology
 1HDQ A;  1ARL A;  2O28 A;  2B3U A;  4G1P A;  3TCV A;  2B3V A;  1CX8 A;  2KCW A;  2Z3N A;  1BPM A;  4OC3 A;  1LFW A;  1P4N A;  2AE6 A;  2QJ8 A;  5I4M A;  3LD2 A;  2EWB A;  3LWU A;  3PB7 X;  3FIX A;  4TWE A;  2PJ3 A;  2V77 A;  4MHN A;  4WJB A;  2AFZ A;  4BD9 A;  2YNC C;  2WSA A;  3NFZ A;  4C2X A;  1IOF A;  4CAX A;  4EVY A;  4P4D A;  2OR4 A;  4PSX A;  1BOB A;  4UWJ A;  4A37 A;  2EK9 A;  5C88 A;  4Y49 C;  4IHM A;  2DXQ A;  3JRU A;  4UCP A;  2Q04 A;  3S6F A;  4A94 A;  3BLN A;  4LUA A;  4NFR A;  2RB7 A;  1YW4 A;  3PB6 X;  1ON0 A;  1OBR A;  4MFK A;  4B11 A;  1TKJ A;  4R87 A;  1Q2Y A;  4B5P B;  4C68 A;  4F0X A;  2FS5 A;  5EBV A;  4KSA A;  1ELL P;  3CDX A;  5HVF A;  4MMO A;  4JWP A;  1XIX A;  1KUX A;  2HUZ A;  5LYF A;  2BEI A;  2PJ9 A;  1I12 A;  7CPA A;  3R9E A;  4AVA A;  2FIA A;  4UF4 A;  2PIY A;  4EME A;  4UCM A;  4MFJ A;  4FD5 A;  5DS0 A;  2ZEN A;  3RBU A;  5FVJ A;  5KTC A;  2P6E A;  4CGO A;  5I0C A;  4W9Y A;  1YLE A;  2RC4 A;  2YND A;  4F0Y A;  2PRQ A;  1QSO A;  1ZLH A;  2V8G A;  3B2Y A;  3GIU A;  4KOT A;  2PJ5 A;  4R6T A;  1QST A;  5IB9 A;  2ZEG A;  2J9A A;  2ZEH A;  3FXT A;  3UY5 A;  1YME A;  5LRJ A;  3IEH A;  3GY9 A;  2DPT A;  2CTB A;  2QEC A;  3T9Y A;  3T90 A;  4A38 A;  1U6M A;  3RNZ A;  2XEI A;  3PZJ A;  3B3T A;  3FMC A;  4UCN A;  4R9M A;  3WAB A;  1QSN A;  3I1U A;  2EK8 A;  3RO0 A;  5F48 A;  1BLL E;  4UA3 A;  5G21 A;  1LAP A;  1V0C A;  4QC6 A;  4Q38 A;  1QMU A;  2ZOF A;  3B3C A;  4IAV A;  3FYN A;  4PV6 A;  2R8V A;  3VAT A;  4GXH A;  4NGS A;  4Y49 B;  1IID A;  2PC1 A;  3D68 A;  4OC1 A;  2GLF A;  3LMS A;  1L0C A;  4DUK A;  2VI7 A;  4NJQ A;  4HPS A;  4EFD A;  2EUI A;  2ARH A;  1NSA A;  1YLO A;  4NCZ A;  3VH9 A;  3V38 A;  3QB8 A;  1KUV A;  3H4Q A;  1SQH A;  3D2P A;  4A39 A;  4NGP A;  3WC7 A;  5ISV A;  3SJX A;  1IB1 E;  2BL1 A;  2HC9 A;  2C6G A;  2Q51 A;  3S6K A;  1YX0 A;  1AYE A;  4X2T A;  2OOT A;  2YGW A;  3ISX A;  1NE9 A;  4NGN A;  1RXT A;  3FNC A;  3TTH A;  3PBB A;  1ARM A;  2G0B A;  1ZLI A;  3VAR A;  3NE7 A;  3JTK A;  4UEZ A;  1CP7 A;  1Y7R A;  5DWN A;  4UWI A;  2PVV A;  4NJR A;  4FBE A;  4MCP A;  1Z4E A;  2X7B A;  4M6G A;  4MCQ A;  4UIB A;  1Y9K A;  4OKO A;  4B5P A;  3FBU A;  2VBQ A;  4F8Z A;  1B6B A;  2Q7B A;  4MHD A;  3H5Z A;  1LAM A;  4OID A;  4BIN A;  3SJF A;  2BUE A;  2Q4Y A;  1I21 A;  1BPN A;  4FWU A;  2Q7S A;  4KOY A;  2VZZ A;  5HH1 A;  3F0A A;  4YRH A;  3RZA A;  2ZW6 A;  2WZN A;  4WWV A;  8CPA A;  3ZJ0 A;  1VHS A;  5IX3 A;  3N5F A;  3FRM A;  4GS4 A;  4UFW A;  2Z3L A;  2ZOG A;  4CGN A;  1Z9U A;  2QML A;  2Q43 A;  4FD7 A;  1VHO A;  3SJG A;  1Z8X A;  4B13 A;  1NSL A;  4BBH A;  2P0W A;  3R96 A;  4K3N A;  3V8I A;  4AVB A;  1XF8 A;  3NH4 A;  2Z3M A;  4MFZ A;  4PQA A;  2REE A;  1Z8L A;  3D7H A;  1MJ9 A;  5D29 A;  1IYK A;  4CGP A;  1TKH A;  1LAN A;  3DGV A;  3R95 A;  1CBX A;  3B7I A;  3MRU A;  1S7K A;  4B10 A;  3N7Z A;  1YSJ A;  4KUA A;  3K9T A;  4P44 A;  4CYO A;  2EO8 A;  1IGB A;  1Q7L A;  1A2Z A;  2YNC A;  3V7Z A;  1I1D A;  2O4H A;  3C26 A;  3TO7 A;  4JYW A;  2Q4Z A;  4UFV A;  2EBJ A;  4KVX A;  3RYO A;  4AVC A;  4KOX A;  2O53 A;  3CXS A;  5H84 A;  1TKF A;  3B3V A;  2PJC A;  4J3G A;  4PXE A;  2R1I A;  1UWY A;  2JDC A;  2PQ8 A;  3S9N A;  4CRZ B;  3GYA A;  4R3K A;  1QQ9 A;  1CPS A;  1FY7 A;  1JWQ A;  1R43 A;  4MHP A;  4XPL A;  3K9U A;  5A28 A;  3CXQ A;  1YVO A;  4C2Z A;  4OC4 A;  5EC4 A;  4MCR A;  2IJZ A;  2VXK A;  2GLJ A;  4ZY2 A;  1F57 A;  4P45 A;  5HVH A;  3NH5 A;  4HNY B;  3KQZ A;  5F47 A;  3B3S A;  1ZG9 A;  5CNP A;  1NMT A;  4CYN A;  3FF3 A;  1ZO0 A;  4NF1 A;  1M4D A;  3PB8 X;  3QNV A;  1XEB A;  4MI4 A;  4KVO E;  2Q44 A;  1WWZ A;  2NMT A;  5JH9 A;  2CY2 A;  3I9S A;  4MY0 A;  1TF9 A;  4H2K A;  2Q0Y A;  4X8I A;  2C1C A;  4AXV A;  1M4I A;  1M44 A;  4LQG A;  1IY7 A;  4ZX9 A;  4CGM A;  3VWE A;  1TXR A;  4ORF A;  3SJE A;  2BSW A;  4CYP A;  2WUU A;  2AFO A;  3GLJ A;  3LAC A;  4P10 A;  3SHP A;  3WC5 A;  4KLW A;  3S6G A;  1XOV A;  4E8O A;  4U9Z A;  4MXU A;  2GU2 A;  3R9F A;  3FH4 A;  1YGH A;  1PCA A;  1B87 A;  4HNW B;  4A33 A;  3F8K A;  2ZEE A;  4L8A A;  4MHZ A;  4NGM A;  4KOR A;  5IB0 A;  2POK A;  2QVP A;  4NXY A;  4OC5 A;  4R76 A;  2CTC A;  4PPZ A;  2Z3K A;  4H89 A;  5E96 A;  3G8W A;  2I00 A;  1ELM P;  2C27 A;  2VEZ A;  1Q2D A;  3S9M A;  2AFU A;  3QAH A;  1MJB A;  2CNM A;  2R98 A;  2VZY A;  3IWW A;  3B8G A;  3H8F A;  3PFE A;  4H6Z A;  6CPA A;  3TFY A;  5J1Q A;  3D7F A;  1YW6 A;  4F9U A;  2AFS A;  2ZED A;  1Y0Y A;  4KOU A;  4JJX A;  5LYL A;  1YK3 A;  2XEG A;  2Z10 A;  3KAS A;  1XJO A;  4K30 A;  4YU9 A;  4ZX8 A;  3W6S A;  2QIR A;  3GB0 A;  2OH1 A;  1R3N A;  3DR8 A;  1S7L A;  5H86 A;  3T8W A;  4ZY1 A;  3W6X A;  2A4N A;  3R1K A;  2PE3 A;  3TOB A;  1S7N A;  3KHX A;  3RAM A;  2REF A;  2JBJ A;  3DSB A;  3W91 A;  2AFW A;  4LX9 A;  5J8F A;  2ATR A;  2OU2 A;  4ZI6 A;  4MFQ A;  5K8N A;  5HVG A;  4FD4 A;  5G22 A;  4C2Y A;  4NEX A;  1ZG7 A;  2V8H A;  4OAD A;  4KLV A;  4ZYQ A;  4I49 A;  3SXO A;  2ZXV A;  2QYV A;  3D8P A;  5C82 A;  3JUW A;  1AMP A;  4PXC A;  2FCK A;  3CZX A;  2FL4 A;  4UEF A;  1AUG A;  1X10 A;  4KOW A;  5ELY A;  5LYD A;  3OWC A;  4A32 A;  3PB9 X;  2AFM A;  2H5M A;  3WC6 A;  1YQE A;  4CRY B;  4MFP A;  2PJ0 A;  4OAE A;  1LOK A;  2PJ2 A;  2BO9 A;  4BMH A;  4AB7 A;  1GYT A;  2OZH A;  2FT0 A;  3KR5 A;  3L2N A;  1YVK A;  2OZU A;  3NA6 A;  3B3W A;  1YRE A;  3ZZI A;  1FNO A;  3DDD A;  4A30 A;  4CGL A;  1Y7E A;  1Z4R A;  2VQY A;  2PJ7 A;  2ZEO A;  3H8G A;  4OC2 A;  1KUY A;  4II9 A;  1RTQ A;  2RFH A;  2ZW7 A;  1J4J A;  3LOD A;  5CBM A;  3KZW A;  2P6G A;  4MRI A;  3EFA A;  4ZBG A;  5K8P A;  2PIZ A;  3FED A;  3CPA A;  3IWE A;  2B5G B;  2J8M A;  4M85 A;  3MN8 A;  4MFL A;  3PEI A;  2FVG A;  1XRY A;  2PJ4 A;  3EO4 A;  4Z65 A;  1ZG8 A;  3NE8 A;  4FUU A;  2F7V A;  2Y0M A;  1X12 A;  2D4P A;  1XMT A;  4L89 A;  4XPD C;  1DTD A;  4P6Y A;  5G1Z A;  1QSM A;  2CF4 A;  1S60 A;  2PVW A;  4IUS A;  3KI9 A;  3FEE A;  3DLJ A;  4B12 A;  5JPH A;  3QAY A;  3K2K A;  2PJ1 A;  2Z0Z A;  2J8R A;  3BI1 A;  3FB3 A;  2BCO A;  3BHX A;  1FT7 A;  2AJ6 A;  4MY3 A;  2CIJ A;  3D7G A;  4OP4 A;  2WPX A;  1XBU A;  2ODF A;  3BI0 A;  4DJL A;  3GKR A;  3WT4 A;  2B4B A;  3KQX A;  5G20 A;  2PRB A;  5IV0 A;  2V8D A;  1BO4 A;  1LRZ A;  5GCN A;  1YR0 A;  2PR1 A;  3IIB A;  2FE7 A;  2PJA A;  3PBE A;  4NGQ A;  2GAN A;  2Z3O A;  4RS2 A;  2ZEL A;  3PFO A;  4A31 A;  4PXD A;  2GRE A;  4HNX B;  4MBU A;  4M3S A;  2I79 A;  4P4E A;  3FEC A;  2NYQ A;  4PXB A;  4UEE A;  3WR7 A;  3D66 A;  3FJU A;  1GHE A;  2JBK A;  2ZPA A;  4KS9 A;  1JQG A;  3HUV A;  2CNT A;  4P4J A;  1LCP A;  2C6P A;  3S6H A;  3DR6 A;  2PCU A;  2F8H A;  2HV2 A;  4AG7 A;  3EY5 A;  3D7D A;  4KSF A;  5K8O A;  1TF8 A;  4HKF A;  4JLY A;  4CYQ A;  5A27 A;  3IFE A;  4XPK A;  5DWM A;  1HEE A;  1M1D A;  2JEW A;  4IK2 A;  1UFH A;  2R7H A;  1CP6 A;  3TX8 A;  3S9L A;  3HLP A;  3D4U A;  1XE4 A;  4OME A;  4CS0 B;  1MK4 A;  2PR8 A;  2DPS A;  2BOA A;  4XPD B;  2ZEP A;  4A2Z A;  4DYO A;  3TOA A;  3IO1 A;  3KL9 A;  5AG7 A;  4M6I A;  5F46 A;  3IC1 A;  1P0H A;  4RUH A;  3PP9 A;  2YNE A;  3KR4 A;  4QB9 A;  4CAE A;  1VIX A;  4PK3 A;  4P4I A;  2IQ6 A;  2ANP A;  5CPA A;  5KTD A;  3BXM A;  5JGF A;  3A9L A;  1IIC A;  1F2O A;  2ABZ A;  4RN7 A;  3IWG A;  2F5I A;  2PJ8 A;  1IU8 A;  4PSW A;  2WPW A;  4ZGY B;  3D2M A;  3P2F A;  2Q4V A;  4P4F A;  1KZF A;  3KKW A;  1K4J A;  1Q2C A;  4DNC A;  4U5Y A;  4QVT A;  4R57 A;  4QBJ A;  1RO5 A;  3I3G A;  2HB6 A;  5K8M A;  2B5G A;  1S5K A;  3VWD A;  3SI2 A;  4KVM E;  2GE3 A;  2WYR A;  3PRT A;  4B14 A;  3DNS A;  4F6A A;  3E0K A;  3NH8 A;  4JXR A;  4KUB A;  4OLL A;  1XMB A;  3JVN A;  4TNU A;  3R9G A;  4XNH C;  3BJ7 A;  5D8N A;  4IF5 A;  2AFX A;  4YFJ A;  3TO9 A;  1Z8W A;  2NSM A;  4GM5 A;  2B4D A;  2B58 A;  4B6Z A;  3KGQ A;  2P6F A;  2OB0 A;  4YWY A;  4KSI A;  3TE4 A;  2IMO A;  1S3Z A;  2ZEF A;  1IYL A;  1CM0 A;  2HQY A;  2JLM A;  1CJW A;  1DE4 C;  1OZP A;  5F09 A;  3CXP A;  5JQ4 A;  1S7F A;  4ONW A;  1M4G A;  4AG9 A;  5AGE A;  4E2A A;  3F5B A;  5HMN A;  4O23 A;  3H8E A;  5LRG A;  4CAF A;  2G9D A;  4ONU A;  2FIW A;  4KOS A;  1R57 A;  1VKC A;  2PJ6 A;  1PU9 A;  2G3T A;  2ZW5 A;  4NGR A;  3D67 A;  2V8V A;  2JEV A;  4JZ0 A;  4YGO A;  1PUA A;  3EXN A;  3FVL A;  3ISZ A;  3SI0 A;  5LRK A;  5LYI A;  2CXA A;  3BJ8 A;  2CNS A;  5AG5 A;  1Z5R A;  1Y0R A;  3PB4 X;  2D4O A;  3IU2 A;  1EE3 P;  2XEJ A;  3CT9 A;  4UFX A;  3CPX A;  1M4L A;  5F49 A;  4E0A A;  1Z2L A;  2IL4 A;  3IJ3 A;  4H6U A;  3MGD A;  4PK2 A;  2EVN A;  2I3C A;  4CPA A;  4XNH B;  4QUS A;  1IOI A;  4Q7A A;  4M6H A;  4R3L A;  4RI1 A;  2J8N A;  5AG6 A;  4FD6 A;  4MCS A;  4UBR A;  2GFQ A;  1PYT B;  4LQ6 A;  2FXF A;  2OZG A;  2Z3P A;  1QSR A;  1CPX A;  4CAW A;  1Z8T A;  2ZEM A;  3KHZ A;  3P2H A;  4R8F A;  1H8L A;  4KZT A;  1N71 A;  1VHE A;  5BWA B;  2ZW4 A;  5EMI A;  3TC8 A;  2PJB A;  3SXN A;  5HXD A;  2JDD A;  4NGT A;  1VGY A;  4C7H A;  1HDU A;  4MJ8 A;  3IGR A;  4P4B A;  1MJA A;  2VL1 A;  1TIQ A;  4JD6 A;  4MHY A;  5KTA A;  5AG4 A;  4KOV A;  2B4D B;  2Z11 A;  4B5O A;  4C7I A;  4R7M A;  4FAI A;  2C6C A;  3EC4 A;  4X3R A;  3PGP A;  4CAV A;  2PDO A;  3G3S A;  1F2P A;  2PSW A;  1WK4 A;  4JXQ A;  5THW A;  4X5K A;  3B35 A;  4A95 A;  4ZY0 A;  2DF5 A;  1KWM A;  3SI1 A;  3FX6 A;  1BAV A;  2G3A A;  3TT2 A;  2DEA A;  2K5T A;  1XFO A;  4NSQ A;  4OC0 A;  4OIW A;  3D3S A;  4EWT A;  3TO6 A;  2XEF A;  2GIV A;  3IU1 A;  4U9Y A;  5JM6 A;  1CG2 A;  4F9V A;  4UIA A;  1Y9W A;  4Q36 A;  2FSR A;  5J8C A;  3GUX A; 
#chains in the Genus database with same CATH homology
 1HDQ A;  1ARL A;  4G1P A;  1CX8 A;  4OC3 A;  1BPM A;  1LFW A;  2QJ8 A;  5I4M A;  2EWB A;  3LWU A;  3PB7 X;  4TWE A;  2PJ3 A;  2V77 A;  4MHN A;  4WJB A;  2AFZ A;  4BD9 A;  3NFZ A;  4P4D A;  2OR4 A;  4A37 A;  2EK9 A;  4IHM A;  3JRU A;  4A94 A;  4NFR A;  2RB7 A;  1YW4 A;  3PB6 X;  1OBR A;  1TKJ A;  1ELL P;  3CDX A;  5HVF A;  4MMO A;  5LYF A;  2PJ9 A;  7CPA A;  4UF4 A;  2PIY A;  4EME A;  5DS0 A;  2ZEN A;  3RBU A;  4W9Y A;  2PRQ A;  1ZLH A;  2V8G A;  3B2Y A;  4R6T A;  5IB9 A;  2PJ5 A;  2ZEG A;  2J9A A;  2ZEH A;  1YME A;  5LRJ A;  3IEH A;  2CTB A;  4A38 A;  2XEI A;  3WAB A;  3B3T A;  3FMC A;  3I1U A;  2EK8 A;  1BLL E;  1LAP A;  1QMU A;  2ZOF A;  3B3C A;  4IAV A;  3VAT A;  4NGS A;  3D68 A;  4OC1 A;  2GLF A;  3LMS A;  4DUK A;  4NJQ A;  4EFD A;  1NSA A;  1YLO A;  3VH9 A;  3V38 A;  4A39 A;  4NGP A;  3WC7 A;  3SJX A;  2HC9 A;  2C6G A;  2Q51 A;  4X2T A;  1AYE A;  2OOT A;  3ISX A;  4NGN A;  3PBB A;  1ARM A;  1ZLI A;  3VAR A;  4UEZ A;  1CP7 A;  2PVV A;  4NJR A;  4FBE A;  4MCP A;  4MCQ A;  4UIB A;  4OKO A;  4F8Z A;  1LAM A;  4OID A;  3SJF A;  4FWU A;  1BPN A;  3RZA A;  8CPA A;  2WZN A;  4WWV A;  3N5F A;  2ZOG A;  2Q43 A;  1VHO A;  3SJG A;  4K3N A;  3NH4 A;  4PQA A;  5D29 A;  1Z8L A;  3D7H A;  1TKH A;  1LAN A;  3DGV A;  1CBX A;  3B7I A;  3MRU A;  1YSJ A;  3K9T A;  4P44 A;  1IGB A;  1Q7L A;  3V7Z A;  2O4H A;  4JYW A;  2Q4Z A;  2O53 A;  1TKF A;  3B3V A;  2PJC A;  4PXE A;  1UWY A;  3S9N A;  1QQ9 A;  1CPS A;  1R43 A;  4MHP A;  4OC4 A;  4MCR A;  2IJZ A;  2GLJ A;  4ZY2 A;  1F57 A;  4P45 A;  5HVH A;  3NH5 A;  3KQZ A;  3B3S A;  1ZG9 A;  3FF3 A;  3PB8 X;  3QNV A;  5JH9 A;  1TF9 A;  4H2K A;  4X8I A;  2C1C A;  4AXV A;  4LQG A;  4ZX9 A;  1IY7 A;  1TXR A;  3SJE A;  2AFO A;  3GLJ A;  4P10 A;  3WC5 A;  4MXU A;  2GU2 A;  3FH4 A;  1PCA A;  2ZEE A;  4MHZ A;  4NGM A;  2POK A;  2QVP A;  4OC5 A;  4R76 A;  2CTC A;  4PPZ A;  1ELM P;  3S9M A;  2AFU A;  4MCS A;  3IWW A;  3H8F A;  3PFE A;  6CPA A;  5J1Q A;  3D7F A;  1YW6 A;  4F9U A;  2AFS A;  2ZED A;  1Y0Y A;  5LYL A;  2XEG A;  3KAS A;  1XJO A;  4YU9 A;  4ZX8 A;  3GB0 A;  1R3N A;  3T8W A;  4ZY1 A;  2PE3 A;  3KHX A;  3RAM A;  2JBJ A;  2AFW A;  4ZI6 A;  5K8N A;  5HVG A;  1ZG7 A;  2V8H A;  4ZYQ A;  2QYV A;  1AMP A;  4PXC A;  4UEF A;  5ELY A;  5LYD A;  3PB9 X;  2AFM A;  3WC6 A;  2PJ0 A;  1LOK A;  2PJ2 A;  2BO9 A;  1GYT A;  3L2N A;  3KR5 A;  3NA6 A;  3B3W A;  1FNO A;  1Y7E A;  4OC2 A;  2PJ7 A;  2ZEO A;  3H8G A;  1RTQ A;  2RFH A;  5CBM A;  3KZW A;  4MRI A;  5K8P A;  2PIZ A;  3FED A;  3CPA A;  3MN8 A;  3PEI A;  2FVG A;  1XRY A;  2PJ4 A;  4Z65 A;  1ZG8 A;  4FUU A;  2F7V A;  1DTD A;  4P6Y A;  2CF4 A;  2PVW A;  3KI9 A;  3FEE A;  3DLJ A;  3K2K A;  2PJ1 A;  3BI1 A;  2BCO A;  3BHX A;  1FT7 A;  2CIJ A;  3D7G A;  4OP4 A;  1XBU A;  3BI0 A;  4DJL A;  3WT4 A;  3KQX A;  2V8D A;  3IIB A;  2PJA A;  3PBE A;  4NGQ A;  2ZEL A;  3PFO A;  4PXD A;  2GRE A;  4P4E A;  3FEC A;  2NYQ A;  4PXB A;  4UEE A;  3D66 A;  3FJU A;  2JBK A;  1JQG A;  3HUV A;  4P4J A;  1LCP A;  2C6P A;  2PCU A;  2F8H A;  5K8O A;  3D7D A;  1TF8 A;  3IFE A;  1HEE A;  2JEW A;  4IK2 A;  1CP6 A;  3TX8 A;  3S9L A;  3HLP A;  3D4U A;  4OME A;  2BOA A;  2ZEP A;  4DYO A;  3IO1 A;  3KL9 A;  3IC1 A;  4RUH A;  3KR4 A;  1VIX A;  4P4I A;  2IQ6 A;  2ANP A;  5CPA A;  3BXM A;  5JGF A;  1F2O A;  2ABZ A;  2PJ8 A;  4P4F A;  5K8M A;  2HB6 A;  3SI2 A;  2WYR A;  3PRT A;  3NH8 A;  1XMB A;  4TNU A;  5D8N A;  2AFX A;  2NSM A;  4GM5 A;  4B6Z A;  3KGQ A;  4YWY A;  4KSI A;  2IMO A;  2ZEF A;  1DE4 C;  5F09 A;  4ONW A;  4O23 A;  3H8E A;  5LRG A;  2G9D A;  2PJ6 A;  4NGR A;  3D67 A;  2V8V A;  4JZ0 A;  5LRK A;  3SI0 A;  3FVL A;  3ISZ A;  5LYI A;  1Z5R A;  1Y0R A;  3PB4 X;  1EE3 P;  2XEJ A;  3CT9 A;  3CPX A;  1M4L A;  1Z2L A;  3IJ3 A;  2I3C A;  4CPA A;  4Q7A A;  1PYT B;  1CPX A;  2ZEM A;  3KHZ A;  4R8F A;  1H8L A;  1VHE A;  3TC8 A;  2PJB A;  5HXD A;  4NGT A;  1VGY A;  1HDU A;  4P4B A;  2VL1 A;  4MHY A;  4R7M A;  4FAI A;  2C6C A;  4X3R A;  1F2P A;  5THW A;  3B35 A;  4ZY0 A;  1KWM A;  3SI1 A;  3FX6 A;  1BAV A;  2DEA A;  4OC0 A;  1XFO A;  4OIW A;  4EWT A;  2XEF A;  5JM6 A;  1CG2 A;  4F9V A;  4UIA A;  3GUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...