4F9ZA

Crystal structure of human erp27
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
219
structure length
219
Chain Sequence
QEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIPAVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINSLHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmic reticulum resident protein 27
publication title The Crystal Structure of the Protein-Disulfide Isomerase Family Member ERp27 Provides Insights into Its Substrate Binding Capabilities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 67
structure length 219
sequence length 219
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13848 Thioredoxin_6 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4f9zA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4f9zA01
2JZSA 1MD4A 3CRUA 3EINA 2PPTA 4KSOA 3RHBA 1QFNA 1A23A 2E2MA 2HZFA 2YNXA 2AHEA 3L9SA 4P3YB 4HU7A 3QFBC 1Q98A 2MBTA 5HQPA 4HZ4A 2IMIA 1XWGA 1K0AA 2N5AA 4OCFA 1XCCA 1X9MB 1EZKA 3GNJA 4WXTA 5IMAA 4XS6A 3WT2A 2CZ3A 2OBIA 4Q5NA 1XZOA 1XOAA 3GKNA 5ECPB 2JADA 2B7KA 4NWYA 1GUKA 3M9KA 3HA9A 4ECIA 2R5GA 3HYPA 1GNWA 4G2EA 4TXOB 3HCZA 1XWBA 3GA4A 4K2DA 2CX4A 3MSZA 1SU9A 2FWFA 4MF5A 2M46A 4I6XA 5ECKB 4YAPA 4DEJA 3I69A 2EC4A 4OD7A 2O8VB 5LNKe 1KBNA 2GQKA 1ILOA 3TJJA 4E8EA 1XVQA 1VF1A 5J9CA 4KW6A 1OC9B 5D9XA 1EP7A 2HZEB 1RQMA 3GUSA 4AGSA 3H93A 1X0RA 2PN8A 1G7OA 1GSYA 3MNGA 2I81A 5EVOA 3KM6A 5DCGA 1T3BA 2JSZA 5CAXA 1ERTA 2YANA 2QGVA 4DVCA 1DSBA 5D73A 3ME8A 2GZZA 3G7IA 1RK4A 4PUFC 1DE1A 1ON4A 2IIYA 2I3YA 4GSSA 5AIVA 5DJMA 4HS1A 3M9JA 2WFCA 2KP2A 3O6TA 3HHVA 2VO4A 1A2MA 5IO2A 1M2BA 2K8SA 4K7OA 4ZB6A 3S9FA 2XHFA 1U6TA 2WZ9A 2MYGA 5JWOB 1G0TA 6GSSA 4FYBA 1DE2A 5ECOB 1SKRB 1PKZA 2KP1A 4JU5A 4TR3A 2LJKA 1OKDA 4BWSA 2CZ2A 3CTFA 1UN2A 3TCOA 1XFLA 2H72A 2YZHA 4HJ2A 1GTBA 1PQNA 4IW9A 4HUAA 4XTSA 4KAEA 2YWOA 5ECQB 3M8NA 4TVEA 1DBYA 2HNLA 3K8NA 3MAKA 1GTAA 3E0UA 4MJEA 4TW5A 2KHPA 5J3RA 1ZCPA 1DUGA 4ACSA 4K7IA 2H74A 4EO3A 3FZ9A 4HEA2 3OR5A 4MDCA 1AW9A 5J4UA 2CX3A 4JBBA 5J9BA 4KUNA 4IP6A 4MMMA 2GZPA 4ID0A 1KNGA 3TJKA 3IXRA 3BD2A 3EE2A 5IMDA 3U6VA 2VD0A 5B7CA 1TU8A 5EY6A 3U5RE 4DSQA 1TRSA 1GWCA 4PX1A 2FD3A 4YQVA 3HXSA 2F3MA 3LYPA 3CMIA 2VOCA 3DXBA 2LS5A 1R7HA 1GL8A 4JE1A 1HQOA 1PN9A 2OE0A 2LTKA 2VCZA 1XW5A 3EMPA 1YEPA 4JR4A 4GWRA 1GSDA 2H1DA 1M9BA 3Q19A 3IBHA 9GSSA 4FO5A 3UAPA 3O76A 3GYKA 4X1UA 1Z7RA 2V2GA 2PGTA 4EF0A 2YOIA 2YCDA 4OWYA 4K0NA 3FY7A 2DIYA 2HLSA 2N5FA 5B8AA 5LCZA 1K0OA 2CA8A 1XIYA 1QK8A 1PA3A 1USBA 3DYRA 4EDZA 1E6BA 2H66A 1THOA 2GTUA 4IQAA 5CREA 1CQGA 5DAKA 2GGTA 2HE3A 22GSA 2YN1A 4RUVA 3ZMLA 3F9UA 1E2YA 2C3QA 4CHSA 5IPHA 5HFGA 3H4KA 4TXVA 1V57A 4V2NA 4MZBA 3DMLA 1PX6A 3A2XA 2F51A 2FWHA 4WF4A 4Q5FA 2LNSA 1I5GA 3KH7A 1GSUA 3D6IA 4MZCA 3HD5A 5F05A 2H1BA 1SK1A 1AQXA 12GSA 4MPGA 4WKWA 4H86A 1S3DA 1EEJA 2CV4A 3J7Yk 1AXDA 2PVQA 4F03A 4FH8A 4V1Ap 7GSSA 4NV2A 3ZZXA 1GLQA 4XIHA 5GSTA 3VFIA 4GXZA 5ECHB 1WPIA 4EXJA 1YZXA 4N11A 2LEGA 2LSTA 3QCPA 3EURA 1X9WB 2H01A 2QKEA 1ZYEA 4KDYA 1G7EA 1K0MA 1M9AA 4WBRD 1GULA 2HFDA 2OACA 4ZL8A 1WOUA 4HOJA 4MJCA 5IO0A 3L4NA 1EP8A 3DVXA 2OJLA 3GV1A 4XCSA 1Z6MA 3MDKA 3DVWA 3LG6A 5DAKB 1Y25A 3KTBA 16GSA 1K0NA 4G10A 5ECMB 5DQYA 1BEDA 1ZGNA 4ZILA 5ELAA 1A2JA 1A8LA 1AAZA 4K8MA 2M80A 4K7NA 2FA8A 1BYEA 5ENUA 2DC5A 4CW9A 2B6MA 1F3AA 3GRXA 1WIKA 3TJGA 3FEUA 3UEMA 3ERGA 3P8WA 3GN3A 1ERVA 4HQZA 3ISOA 2H30A 3L9UA 4NHWA 3UMAA 5KN1A 1F37A 2IL3A 3HDCA 3TJBA 2GZYA 1K0BA 3TRQA 1RW1A 1SYRA 1O73A 5F07A 4BL7A 3GKMA 2GDRA 5ABRA 4TRXA 4MCUA 3IDVA 1YDKA 2WULA 4AJ6A 2VAFA 5DALA 5IMFA 3D0ZA 1BQ7A 3ZRDA 1A24A 3E3EA 4KDXA 2JZRA 4V2LA 5KEJA 4MPFA 3UJ1A 2O85A 2WB9A 1PKWA 2OBKA 3GSSA 3KP9A 1HYUA 1B4PA 1VF4A 4KDUA 3GX0A 2AYTA 5HR0A 3CTGA 3TKSA 2VCXA 1T8EB 1J9BA 4TXOA 3APQA 4LMVA 5G1KA 5G30A 4NMUA 5ECSA 1WP0A 3H79A 2CQ9A 4HZ2A 3VPTA 4ILFA 1SJZA 3A3TA 5CP1A 4XRAA 4MJBA 3G9BA 2L5OA 3DD3A 2VL9A 2O7KA 2HT9A 5F0GA 4PNGA 5IOXA 3RDWA 3IHQA 3GX8A 3AY8A 2VM2A 1OC9A 4Z7XA 4J57E 4I8BA 5CRWA 2R4VA 4DSRA 3W6GA 2LKUA 5D93A 3GL3A 2WGRA 5G5EA 3PR8A 2XBQA 4PNFA 4LA1A 3GIXA 3D22A 2LRNA 5KN2A 1TI3A 3BOAA 1PSQA 2LJRA 3GKXA 3ZYWA 3ERWA 1HNBA 1BX9A 3VWWA 3ZVJD 4POLA 18GSA 1PGTA 2DMLA 1TK8B 17GSA 2C1YA 3P7XA 2DJ0A 2JU5A 4XRDA 5DALB 4QL9A 1YF1A 5G31A 3ZIJA 5KN3A 3W8SA 3PGTA 4PQ1A 2B5EA 5C04A 2BJXA 1N8JA 3IAS2 3HKRA 2A2SA 2NBSA 3KEBA 3FZAA 1MDJA 4OO4A 3E9JB 2L4QA 5FHIA 2HSHA 4KB3A 4HJMA 3UIWA 3US3A 2XPDA 1NM3A 3FR3A 1M99A 3KTLA 4L0UA 2JZTA 4DSSB 3KMOA 1PRXA 4N10A 4I2UA 3KIJA 1XVWA 3W8JA 4G9HA 5A5KA 5JWQB 1O7UA 1A8YA 5J5NA 2LQOA 1SKWB 2C0DA 5AGYA 3H8QA 3IPZA 5H5RA 4YH2A 1O8WA 2LRTA 4OCEA 4ZIJA 10GSA 3KJYA 5A4WA 2RM6A 3RHCA 2HSYA 1V98A 1SL2B 4NXIA 1V58A 3L0HA 3M3MA 3FZ4A 3SBCA 4O7HA 4EL1A 2VD1A 4IELA 2MMAA 5JWRB 3F0IA 4EUYA 4PURA 4L5LA 2GSSA 3WGDA 1AUCA 2GT5A 4ECBA 2NPBA 2D2ZA 3NZNA 4PXOA 4ZB9A 1Z6NA 1X5CA 3HVXA 3P90A 4FYCA 3H1NA 5D8IA 1Z7PA 2VUPA 4O5RA 1SKSB 4TR1A 1EWXA 1PX7A 4YQMA 2H0GA 2P0GA 2FLSA 3CBUA 4GRFA 5CRGA 1T1VA 1SENA 3Q74A 1S3CA 3GTUA 4POKA 2KLXA 2L59A 2H1GA 2H75A 1AQVA 3GHAA 4G19A 4NHZA 4GSNA 4XS1A 4OMVA 2AB6A 5GAPD 3DKSA 3F8UA 4ZB8A 4PQIA 4N0ZA 5EL8A 5E59A 3QR6A 3FKFA 2OADA 2QC7A 5DCHA 1LU4A 1Z5YE 1ZMAA 3TB2A 1ZOFA 1IYHA 4K0GA 3UVTA 3APSA 4IJ3A 1PL2A 2L57A 3IE3A 1TOFA 3LORA 1F9MA 2HI7A 1A2LA 2PMTA 1ZL9A 5ECRB 1JFUA 1G6WA 3EVIA 3FK8A 3KXOA 8GSSA 3ZMKA 1H4OA 2X8GA 2AAWA 5H5SA 3IK9A 4EE0A 1ACVA 3DWVA 1XWAA 3SWLA 1XW9A 2LUSA 1TRUA 1G6YA 4KNDA 2CVDA 3HY2A 4L8EA 2LRCA 1YEXA 5D9TA 2DJ1A 3TKSC 1F3BA 4TR1B 3GH6A 4BWQA 2AUVA 2C80A 1TDIA 4WETA 11GSA 4ULXA 3JCML 3F4TA 2C0FA 2OE3A 1B48A 3FRCA 1GP1A 4HDEA 1MTCA 4JZQA 4ML6A 3GTUB 1SK2A 5CRDA 5IMZA 4ISDA 3M1GA 1X5EA 1O6JA 4F9ZA 3D21A 3G7YA 4MK3A 1Z3EA 4MJAA 2DJ2A 5AN1A 1Y6EA 2VL3A 2DLXA 3D4TA 2P5QA 1EV9A 5GSSA 3C8EA 3QAVA 2GLRA 3EU4A 1M2DA 5FWGA 3ZL5A 2HRFA 4NV5A 2CT6A 4K1FA 1V9WA 3FYGA 4F0BA 2K9FA 1TK0B 2X8CA 1OVNA 5IMCA 2C4JA 3GMFA 3KZQA 2PVOC 4EC0A 1U87A 4KSMA 1VGLA 4IHUA 2AV4A 3GL5A 3EYTA 1KEBA 2H19A 2GQMA 5LD0A 3VWUA 1B9YC 1TK5B 1TI1A 2H0IA 3BBYA 4ZL9A 1GLPA 4V2MA 2DIZA 2JSYA 6GSXA 1N2AA 4RI6A 2YZUA 3HZ4A 1FAAA 3LSZA 4IBPA 3J7Yb 1AC1A 3LYKA 2H76A 1GH2A 1T7PB 1EOHA 1GSFA 1TXXA 3P2AA 3F3QA 5A4UA 1V2AA 3VI5A 3TOUA 1SL0B 3I43A 4GTUA 3KD0A 4MH2A 2CAIA 3RAZA 4IVFA 1AQWA 3N5OA 4ZL7A 3CSIA 3C1SA 3I9V2 5DJLA 2XBIA 5INYA 1WMJA 2V41A 2H71A 2B5XA 2DMMA 5JCWA 1VF2A 5F8BA 2NTOA 2RLIA 3C71A 4RQXA 1GSSA 2KOKA 2PWJA 4PQHA 5ID2A 2IMFA 3UL3A 2FY6A 3GH9A 2VM1A 1V40A 4IQ1A 3TRXA 1IYIA 2R6KA 4AJ8A 4WEYA 1BG5A 3KMNA 1QQ2A 1JHBA 4X0XA 5DVBA 3LQ7A 3L9VA 3TKSE 2LNTA 4J2FA 1JZOA 4KGIA 2JL4A 1JZDA 4IJIA 3ZFBA 2REMA 4GQFA 2B3SA 3O3TA 2O87A 4TR0A 3C73A 1OE7A 1J0FA 1FVKA 3F63A 5F06A 5JCUA 1TRWA 2WRTA 5DBQA 1J08A 1EGOA 4CDOA 3I6AA 4IGJA 3VI7A 1SYXA 1FVJA 2EIQA 4GSTA 1SD8A 1UA5A 2L6CA 5HR3A 3WGEA 3D5JA 1FB6A 4HU9A 2VCVA 3QDNA 3HVVA 1VF3A 4MA9A 1O81A 1NHYA 1M2AA 1B8XA 2F8FA 5GZZB 1QXHA 4DSSA 4FYUA 4XHMA 5HR1A 2F8AA 2X8HA 3GKKA 1ZYQB 2BTOT 3ED3A 5D9WA 1TJDA 1XWCA 1BAYA 2I1UA 4F2IA 3IK7A 2B1LA 2YV9A 2B7JA 1OC8A 3F6FA 5B6NA 1MDKA 2CAQA 5ID2B 3BCIA 4TN8A 3QOUA 4QQ7A 5IMVA 3LFLA 2H6YA 3QPMA 3BJ5A 2H6XA 3LGCA 2H0HA 4ZXGA 1U88A 2EIOA 4LMWA 4TKYA 3C7MA 3RBTA 2Z9SA 2VLVA 5HFIA 5IPGA 3LEFA 1FB0A 2WS2A 2IWTA 2K6VA 3R2QA 2V6OA 4PUAA 1CQHA 3VWVA 1NW2A 2LQQA 1FOVA 2CVKA 3WGXA 2VL2A 4KE3A 3ZIVA 5JCGA 4I97A 2ON7A 2E2GA 1XBSA 4N0VA 2IMEA 3ZREA 2C3TA 4X43A 6GSTA 3EMXA 1GTIA 2L4CA 3WYWA 2F9SA 6GSVA 4K9ZA 2E7PA 4YAVA 3KP8A 1ABAA 2PUKC 1GNEA 2RUFA 4I5QA 4KH7A 3Q6OA 2K18A 2I4AA 2R2JA 3DIEA 4WBJA 4NPBA 3RPPA 3C1RA 2BMXA 2V32A 3TKPA 4MZWA 2H6ZA 1XOBA 4ZBDA 4WR5A 2VCTA 4EDYA 1MD3A 3DGQA 2RIIA 1M0UA 2TIRA 1K0CA 2DJJA 3LXTA 3ZTLA 4EVMA 3NIVA 1SL1B 3QFAC 2C3NA 1JLVA 1TP9A 4MLYA 3N9JA 5AISA 3APOA 4LL4B 1K3YA 2FUG2 2OKAA 1S3AA 3QAWA 1TKDB 4XS4A 3FZ5A 4EKZA 1R5PA 2I9HA 3IV4A 4KCAA 1A0FA 1OE8A 4ZBAA 1SD9A 2WDUA 5KN0A 1YY7A 4MF7A 1Q4JA 4KX4A 1WJKA 4PGTA 5CNWA 3KCMA 2RM5A 1GRXA 3IAM2 1PMTA 2JACA 2C0GA 3A2WA 5A4VA 2ON5A 1SK0A 5ECNB 1OKTA 2M72A 4GCIA 4BA7A 4O92A 1R4WA 4POMA 1TU7A 1ML6A 3UOMA 5G2ZA 2OE1A 3HJMA 3LXZA 1FHEA 1T00A 1QMVA 1YKCA 1JLWA 4MP4A 2FCHA 5C00A 1MDIA 1R5AA 2A4VA 3VPQA 2MBSA 2CVBA 2IJYA 1XXUA 3G7JA 4KA0A 3TUEA 1GUMA 5FT3A 4I2TA 2YPMA 1ERWA 1W4VA 1WWJA 2KUCA 4YQUA 13GSA 1R26A 3IOSA 3CSHA 2DJ3A 5HR2A 2HXKA 2V1MA 3F3RA 1QUWA 2AJQB 1URMA 5CRHA 1Z9HA 2TRXA 4XS4B 14GSA 4V1Ag 4RQRA 2A2RA 2GVPA 4OFTA 2MZCA 2XPEA 3VLNA 2ES7A 3TKRA 1BJXA 2ZCTA 2VIMA 2H73A 5GAND 2N5BA 2DJKA 3D4MA 3HJOA 2XC2A 3TJFA 1YF0A 3TRPA 2QSIA 5HFKA 2GS3A 1VRSD 1TW9A 1XWKA 1LJRA 2GQLA 3ME7A 1LBKA 1C72A 1UC7A 1H75A 4K6XA 4ECCA 1ERUA 1EEMA 2MMOA 2PBJA 3A5WA 1THXA 5AIXA 3DRNA 2FWEA 3ZITA 4IN0A 3LWAA 2WJUA 2IFQA 4J56E 2H8LA 4IP1A 2GT6A 3NOFA 1OC3A 1OAZA 5D96A 3IRAA 4E8HA 1K3LA 2LV3A 4GQCA 4KCEA 3EU3A 1M7TA 1HNAA 4O32A 3CSJA 4IS0A 1QGVA 5B6MA 2DSAA 2HYXA 4FIWA 4LL1B 3UBKA 5J41A 2DBCA 2C8UA 2G2QA 2NVLA 4L5OA 4ZBBA 2FHEA 2H70A 3QMXA 3FHKA 2C0EA 1U3AA 2GSRA 2VLUA 2IN3A 4OO5A 2HRNA 3F4SA 2L5LA 4BVYA 3HVSA 1WRYA 3TGZA 1SJ6A 1YKAA 4MH3A 3M0FA 3MWHA 2ALBA 1XW6A 2R37A 4Q5QA 2WCIA 4BPYA 1YJ6A 3GFKA 3ZVJA 5DDLA 1K3OA 4MABA 2GSQA 5DQSA 4HI7A 4AF2A 2FWGA 3KGKA 2B5YA 5G5FA 3KH9A 3WD6A 3F6DA 1GSEA 3FW2A 4D73A 2VL2C 1B9XC 2YWMA 3HZ8A 2YWIA 3UBLA 3FR9A 2FNOA 3VK9A 5L71A 5B8BA 19GSA 4RI7A 6GSUA 2IFQB 2PERA 1F2EA 5E4WA 2TRCP 3VURA 4JR6A 2O89A 2J23A 3DEXA 1MEKA 5IM9A 6GSWA 20GSA 1FO5A 3ZFLA 4WF5A 1JZWA 5COHA 5ECIB 4WR4A 1PL1A 2X99A 1A0RP 3EWLA 4ML1A 5H5QA 3CXGA 5ELGA 3A2VA 4ECJA 3UARA 3VWXA 2YJ7A 3WT1A 2VCQA 1HNCA 3GURA 2ZUPA 1U3IA 5ECLB 1EV4A 3UVHA 2LJAA 4AJ7A 2K8VA 4MF6A 2EIRA 5CYYA 1NSWA 2RUEA 2E0QA 4OFMA 2YV7A 4TOPA 2IMDA 3TDGA 5D9VA 2L6DA 4LLRA 2GSTA 1I9DA 2NDOA 5IQYA 1O8XA 4GLTA 4F0CA 1X9SB 3BCKA 5IIZA 1NHOA 1TTZA 4L0WA 2B1KA 1AIUA 1YQ1A 1W89A 1EGRA 1JZRA 4D73B 2MMNA 2R3XA 5CO3A 3IC4A 3Q18A 3PINA 3HJPA 2ZNMA 4IKHA 1X5DA 2VCWA 1ST9A 2J9HA 4POBA 1WE0A 3LJRA 3F4RA 3PH9A 3QD9A 1F6MC 2X64A 3V1WA 3ERFA 2YWNA 2H1AA 3CYNA 6GSYA 4N30A 1UVZA 4NAXA 1HD2A 4F82A 3RPNA 1ZZYA 4BVXA 1GSQA 4GF0A 1FW1A 3EC3A 2YP6A 3TKQA 5EPFA 2IMKA 1FG4A 1TRVA 1KTEA 3CRTA 1PD21 1B4QA 2FA4A 2PU9C 1SJIA 2FGXA 2P5RA 1GTUA 3GSTA 2IPAA 4TR4A 1OYJA 3L78A 5G1LA 1K0DA 2G0FA 4JRRA 1XPVA 4JEDA 1T4ZA 1T4YA 3ZLPA 4QL7A 3FR6A 1O85A 1GUHA 4HQSA 2P31A 3QAGA 2YJHA 5IOWA 2V6KA 2VLTA 3TOTA 3IA1A 2HZEA 2OA7A 3IR4A 4Q5RA 1EOGA 2MMZA 4OFNA
chains in the Genus database with same CATH superfamily
2JZSA 1MD4A 3CRUA 3EINA 3IHGA 2PPTA 4KSOA 3RHBA 1QFNA 1A23A 2E2MA 2HZFA 2YNXA 2AHEA 3L9SA 4P3YB 4HU7A 3QFBC 1Q98A 2MBTA 5HQPA 4HZ4A 2IMIA 1XWGA 1K0AA 2N5AA 4OCFA 1XCCA 1X9MB 1EZKA 3GNJA 4WXTA 5IMAA 4XS6A 3WT2A 2CZ3A 2OBIA 4Q5NA 2R0GA 1XZOA 1XOAA 3GKNA 5ECPB 2JADA 2B7KA 4NWYA 1GUKA 3M9KA 3HA9A 4ECIA 2R5GA 3HYPA 1GNWA 4G2EA 4TXOB 3HCZA 1XWBA 3GA4A 4K2DA 2CX4A 3MSZA 1SU9A 2FWFA 4MF5A 2M46A 4I6XA 5ECKB 4YAPA 4DEJA 3I69A 2EC4A 4OD7A 2O8VB 5LNKe 1KBNA 2GQKA 1ILOA 3TJJA 4E8EA 1XVQA 1VF1A 5J9CA 4KW6A 1OC9B 5D9XA 1EP7A 2HZEB 1RQMA 3GUSA 4AGSA 3H93A 1X0RA 2PN8A 1G7OA 1GSYA 3MNGA 2I81A 5EVOA 3KM6A 5DCGA 1T3BA 2JSZA 5CAXA 1ERTA 2YANA 2QGVA 4DVCA 1DSBA 5D73A 3ME8A 2GZZA 3G7IA 1RK4A 4PUFC 1DE1A 1ON4A 2IIYA 2I3YA 4GSSA 5AIVA 5DJMA 4HS1A 3M9JA 2WFCA 2KP2A 3O6TA 3HHVA 2VO4A 1A2MA 5IO2A 1M2BA 2K8SA 4K7OA 4ZB6A 3S9FA 2XHFA 1U6TA 2WZ9A 2MYGA 5JWOB 1G0TA 6GSSA 4FYBA 1DE2A 5ECOB 1SKRB 4G0LA 1PKZA 2KP1A 4JU5A 4TR3A 2LJKA 1OKDA 4BWSA 2CZ2A 3CTFA 1UN2A 3TCOA 1XFLA 2H72A 2YZHA 4HJ2A 1GTBA 1PQNA 4IW9A 4HUAA 4XTSA 4KAEA 2YWOA 5ECQB 3M8NA 4TVEA 1DBYA 2HNLA 3K8NA 3MAKA 1GTAA 3E0UA 4MJEA 4TW5A 2KHPA 4USSA 5J3RA 1ZCPA 1DUGA 4ACSA 4K7IA 2H74A 4EO3A 3FZ9A 4HEA2 3OR5A 4MDCA 1AW9A 5J4UA 2CX3A 4JBBA 5J9BA 4KUNA 4IP6A 4MMMA 2GZPA 4ID0A 1KNGA 3TJKA 3IXRA 3BD2A 3EE2A 5IMDA 3U6VA 2VD0A 5B7CA 1TU8A 5EY6A 3U5RE 4DSQA 1TRSA 1GWCA 4PX1A 2FD3A 4YQVA 3HXSA 2F3MA 3LYPA 3CMIA 2VOCA 3DXBA 3CQFA 2LS5A 1R7HA 1GL8A 4JE1A 1HQOA 1PN9A 2OE0A 4X4JA 2LTKA 2VCZA 1XW5A 3EMPA 1YEPA 4JR4A 4GWRA 1GSDA 2H1DA 1M9BA 3Q19A 3IBHA 9GSSA 4FO5A 3UAPA 1PN0A 3O76A 4HSCX 3GYKA 4X1UA 1Z7RA 2V2GA 2PGTA 4EIQA 4G0IA 4EF0A 2YOIA 2YCDA 4OWYA 4K0NA 3FY7A 2DIYA 2HLSA 2N5FA 5B8AA 5LCZA 2DKHA 1K0OA 2CA8A 1XIYA 1QK8A 1PA3A 1USBA 3DYRA 4EDZA 1E6BA 2H66A 1THOA 2GTUA 4IQAA 5CREA 1CQGA 5DAKA 2GGTA 2HE3A 22GSA 2YN1A 4RUVA 3ZMLA 3F9UA 1E2YA 2C3QA 4CHSA 5IPHA 5HFGA 3H4KA 4TXVA 1V57A 4V2NA 4MZBA 3DMLA 1PX6A 3A2XA 2F51A 2FWHA 4WF4A 4Q5FA 2LNSA 1I5GA 3KH7A 1GSUA 3D6IA 4MZCA 3HD5A 5F05A 2H1BA 1SK1A 1AQXA 12GSA 4MPGA 4WKWA 4H86A 1S3DA 1EEJA 2CV4A 3J7Yk 1AXDA 2PVQA 4F03A 4FH8A 4V1Ap 7GSSA 4NV2A 3ZZXA 1GLQA 4XIHA 5GSTA 3VFIA 4GXZA 5ECHB 1WPIA 4EXJA 1YZXA 4N11A 2LEGA 3PPUA 2LSTA 3QCPA 3EURA 1X9WB 2H01A 2QKEA 1ZYEA 4KDYA 1G7EA 1K0MA 1M9AA 4WBRD 1GULA 2HFDA 2OACA 4PTSA 1WOUA 4ZL8A 4HOJA 4MJCA 5IO0A 3L4NA 1EP8A 3DVXA 2QA1A 2OJLA 3GV1A 4XCSA 1Z6MA 3MDKA 3DVWA 3LW9A 3LG6A 5DAKB 1Y25A 3KTBA 16GSA 1K0NA 4G10A 1S3RA 5ECMB 5DQYA 1BEDA 1ZGNA 4ZILA 5ELAA 1A2JA 1A8LA 1AAZA 4K8MA 2M80A 4K7NA 2FA8A 2R0CA 1BYEA 5ENUA 2DC5A 4CW9A 2B6MA 1F3AA 3GRXA 1WIKA 3TJGA 3FEUA 3UEMA 3ERGA 3P8WA 3GN3A 1ERVA 4HQZA 3ISOA 2H30A 3L9UA 4NHWA 3UMAA 5KN1A 1F37A 2IL3A 3HDCA 3TJBA 2GZYA 1K0BA 3TRQA 1RW1A 1SYRA 1O73A 5F07A 4BL7A 3GKMA 2GDRA 3A5IA 3IC8A 5ABRA 4TRXA 4MCUA 3IDVA 1YDKA 2WULA 4AJ6A 2VAFA 5DALA 5IMFA 3D0ZA 1BQ7A 3ZRDA 1A24A 3E3EA 4KDXA 2JZRA 4CY6A 4V2LA 5KEJA 4MPFA 3UJ1A 2O85A 2WB9A 1PKWA 2OBKA 3GSSA 3KP9A 1HYUA 1B4PA 1VF4A 4KDUA 3GX0A 2AYTA 5HR0A 3CTGA 3TKSA 2VCXA 1T8EB 1J9BA 4TXOA 3APQA 4LMVA 5G1KA 5G30A 4NMUA 5ECSA 1WP0A 3H79A 2CQ9A 4HZ2A 3VPTA 3FMWA 4ILFA 1SJZA 3A3TA 5CP1A 4XRAA 4MJBA 3G9BA 2L5OA 3DD3A 2VL9A 2O7KA 2HT9A 5F0GA 4PNGA 5IOXA 4K5SA 3RDWA 3IHQA 3GX8A 3AY8A 2VM2A 1OC9A 3R3EA 4Z7XA 4J57E 4I8BA 5CRWA 2R4VA 4DSRA 3W6GA 2LKUA 5D93A 3GL3A 2WGRA 5G5EA 3PR8A 2XBQA 4PNFA 4LA1A 3GIXA 3D22A 2LRNA 4BL7B 5KN2A 1TI3A 3BOAA 1PSQA 2LJRA 3GKXA 3ZYWA 3ERWA 1HNBA 1BX9A 3VWWA 3ZVJD 4POLA 18GSA 1PGTA 2DMLA 1TK8B 17GSA 2C1YA 3P7XA 2DJ0A 2JU5A 4XRDA 5DALB 4QL9A 1YF1A 5G31A 3ZIJA 5KN3A 4G0KA 3W8SA 3PGTA 4PQ1A 2B5EA 5C04A 2BJXA 1N8JA 3IAS2 3HKRA 2A2SA 2NBSA 4FQUA 3KEBA 3FZAA 1MDJA 4OO4A 3E9JB 2L4QA 5FHIA 2HSHA 4KB3A 4HJMA 3UIWA 3US3A 2XPDA 1NM3A 3FR3A 1M99A 3KTLA 4L0UA 2JZTA 4DSSB 3KMOA 1PRXA 4N10A 4I2UA 3KIJA 1XVWA 3W8JA 4G9HA 5A5KA 5JWQB 1O7UA 1A8YA 5J5NA 2LQOA 1SKWB 2C0DA 5AGYA 3H8QA 3IPZA 5H5RA 4YH2A 1O8WA 2LRTA 4OCEA 4ZIJA 10GSA 3KJYA 5A4WA 2RM6A 3RHCA 2HSYA 1V98A 1SL2B 4NXIA 1V58A 3L0HA 3M3MA 3FZ4A 3SBCA 4O7HA 4EL1A 2VD1A 4IELA 2MMAA 5JWRB 3F0IA 4EUYA 4PURA 4L5LA 2GSSA 4K2XA 3WGDA 1AUCA 2GT5A 4ECBA 2NPBA 2D2ZA 3NZNA 4PXOA 4ZB9A 1Z6NA 4CY8A 1X5CA 3HVXA 3P90A 4FYCA 3H1NA 5D8IA 1Z7PA 2VUPA 4O5RA 1SKSB 4TR1A 1EWXA 1PX7A 4YQMA 2H0GA 2P0GA 2FLSA 3CBUA 4GRFA 4O5QA 5CRGA 1T1VA 1SENA 3Q74A 1S3CA 3GTUA 4POKA 2KLXA 2L59A 2H1GA 2H75A 1AQVA 3GHAA 4G19A 4NHZA 4GSNA 4XS1A 4OMVA 2AB6A 5GAPD 3DKSA 3F8UA 4ZB8A 4PQIA 4N0ZA 5EL8A 5E59A 3QR6A 3FKFA 2OADA 2QC7A 5DCHA 1LU4A 1Z5YE 1ZMAA 3TB2A 1ZOFA 1IYHA 4K0GA 3UVTA 3APSA 4IJ3A 1PL2A 2L57A 3IE3A 1TOFA 3LORA 1F9MA 2HI7A 1A2LA 2PMTA 1ZL9A 5ECRB 1JFUA 1G6WA 3EVIA 3FK8A 3KXOA 8GSSA 3ZMKA 1H4OA 2X8GA 2AAWA 5H5SA 3IK9A 4EE0A 4MNNA 1ACVA 3DWVA 1XWAA 3SWLA 1XW9A 2LUSA 1TRUA 1G6YA 4KNDA 2CVDA 3HY2A 4L8EA 2LRCA 2HRAA 1YEXA 5D9TA 2DJ1A 3TKSC 1F3BA 4TR1B 3GH6A 4BWQA 2AUVA 2C80A 1TDIA 4WETA 11GSA 4ULXA 3JCML 3F4TA 2C0FA 2OE3A 1B48A 3FRCA 1GP1A 4HDEA 1MTCA 4JZQA 4ML6A 3GTUB 1SK2A 5CRDA 5IMZA 4ISDA 5BMUA 3M1GA 1X5EA 1O6JA 4F9ZA 3D21A 3G7YA 5KOXA 4MK3A 1Z3EA 4MJAA 2DJ2A 5AN1A 1Y6EA 3HVNA 2VL3A 2DLXA 3D4TA 2P5QA 2A2PA 1EV9A 5GSSA 3C8EA 3QAVA 2GLRA 3EU4A 1M2DA 5FWGA 3ZL5A 2HRFA 4NV5A 2CT6A 4K1FA 1V9WA 3FYGA 4F0BA 2K9FA 1TK0B 2X8CA 1OVNA 5IMCA 2C4JA 3GMFA 3KZQA 2PVOC 4EC0A 1U87A 4KSMA 4O5UA 1VGLA 4IHUA 2AV4A 3GL5A 3EYTA 1KEBA 2H19A 2GQMA 5LD0A 3VWUA 1B9YC 1TK5B 1TI1A 2H0IA 3BBYA 4ZL9A 1GLPA 4V2MA 2DIZA 2JSYA 6GSXA 1N2AA 4RI6A 2YZUA 3HZ4A 4EIPA 1FAAA 3LSZA 4IBPA 3J7Yb 1AC1A 3LYKA 2H76A 1GH2A 1T7PB 1EOHA 1GSFA 1TXXA 3P2AA 3F3QA 5A4UA 1V2AA 3VI5A 3TOUA 1SL0B 3I43A 4GTUA 3KD0A 4MH2A 2CAIA 3RAZA 4IVFA 1AQWA 3N5OA 4ZL7A 2A4HA 2X4AA 3CSIA 3C1SA 3I9V2 5DJLA 2XBIA 5INYA 4BVYB 1WMJA 2V41A 2H71A 2B5XA 2DMMA 5JCWA 1VF2A 5F8BA 2NTOA 2RLIA 3C71A 4RQXA 1GSSA 2KOKA 2PWJA 4PQHA 5ID2A 2IMFA 3UL3A 2FY6A 3GH9A 2VM1A 1V40A 4IQ1A 4Z2TA 3TRXA 1IYIA 2R6KA 4AJ8A 4WEYA 1BG5A 3KMNA 1QQ2A 1JHBA 4X0XA 5DVBA 3LQ7A 3L9VA 3TKSE 2LNTA 4J2FA 1JZOA 1M3JA 4KGIA 2JL4A 1JZDA 4IJIA 3ZFBA 2REMA 4GQFA 2B3SA 3O3TA 2O87A 4TR0A 3C73A 1OE7A 1J0FA 1FVKA 3F63A 5F06A 5JCUA 1TRWA 2WRTA 5DBQA 1J08A 1EGOA 4CDOA 3I6AA 4IGJA 3VI7A 1SYXA 1FVJA 2EIQA 4GSTA 1SD8A 1UA5A 2L6CA 5HR3A 3WGEA 3D5JA 1FB6A 4HU9A 3EPTA 2VCVA 3QDNA 3HVVA 1VF3A 4MA9A 1O81A 1NHYA 1M2AA 1B8XA 2F8FA 5GZZB 1QXHA 4DSSA 4FYUA 4XHMA 5HR1A 2F8AA 2X8HA 3GKKA 1ZYQB 2BTOT 3ED3A 5D9WA 1TJDA 1XWCA 1BAYA 2I1UA 4F2IA 3IK7A 2B1LA 2YV9A 2B7JA 1OC8A 2X49A 3F6FA 5B6NA 1MDKA 2CAQA 5ID2B 3BCIA 4TN8A 3QOUA 4QQ7A 5IMVA 5BRTA 3LFLA 2H6YA 3QPMA 3BJ5A 2H6XA 3LGCA 2H0HA 4ZXGA 1U88A 1XG8A 2EIOA 4LMWA 4TKYA 3C7MA 3RBTA 2Z9SA 2VLVA 5HFIA 5IPGA 3LEFA 3MYDA 1FB0A 2WS2A 2IWTA 2K6VA 3R2QA 4KF9A 2V6OA 4PUAA 1CQHA 3VWVA 1NW2A 2LQQA 1FOVA 2CVKA 3WGXA 2VL2A 4KE3A 3ZIVA 5JCGA 4I97A 2ON7A 2E2GA 1XBSA 4N0VA 2IMEA 3ZREA 2C3TA 4X43A 6GSTA 3EMXA 1GTIA 2L4CA 3WYWA 2F9SA 6GSVA 4K9ZA 2E7PA 4YAVA 3KP8A 1ABAA 2PUKC 1GNEA 2RUFA 4I5QA 4BVXB 4KH7A 3Q6OA 2K18A 2I4AA 2R2JA 3DIEA 4WBJA 4NPBA 3RPPA 3C1RA 2BMXA 2V32A 3TKPA 4MZWA 2H6ZA 1XOBA 4ZBDA 4WR5A 2VCTA 4EDYA 1MD3A 3DGQA 1PFOA 1ZYNA 2RIIA 1M0UA 2TIRA 1K0CA 2DJJA 3LXTA 3ZTLA 4EVMA 3NIVA 1SL1B 3QFAC 2C3NA 1JLVA 1TP9A 4MLYA 3N9JA 5AISA 3APOA 4LL4B 1K3YA 2FUG2 2OKAA 1S3AA 3QAWA 1TKDB 4XS4A 3FZ5A 4EKZA 1R5PA 2I9HA 3IV4A 4KCAA 1A0FA 4YKFA 1OE8A 1ZYPA 4ZBAA 1SD9A 2WDUA 5KN0A 1YY7A 4ICYA 4MF7A 1Q4JA 4KX4A 1WJKA 4PGTA 5CNWA 3KCMA 2RM5A 1GRXA 1M3IA 3IAM2 1PMTA 2JACA 2C0GA 3A2WA 5A4VA 2ON5A 1SK0A 5ECNB 1OKTA 2M72A 4GCIA 4BA7A 4O92A 1R4WA 4POMA 1TU7A 1ML6A 3UOMA 5G2ZA 2OE1A 3HJMA 3LXZA 1FHEA 1T00A 1QMVA 1YKCA 1JLWA 4MP4A 2FCHA 5C00A 1MDIA 1R5AA 2A4VA 3VPQA 2MBSA 2CVBA 2IJYA 1XXUA 3G7JA 4KA0A 3TUEA 1GUMA 5FT3A 4I2TA 2YPMA 1ERWA 1W4VA 1WWJA 2KUCA 4YQUA 13GSA 1R26A 3IOSA 3CSHA 2DJ3A 5HR2A 2HXKA 2R0PA 2V1MA 3F3RA 1QUWA 2AJQB 1URMA 5CRHA 1Z9HA 2TRXA 4XS4B 14GSA 4V1Ag 4RQRA 2A2RA 2GVPA 4OFTA 2MZCA 2XPEA 3VLNA 2ES7A 3TKRA 1BJXA 2ZCTA 2VIMA 2H73A 5GAND 2N5BA 2DJKA 3D4MA 3HJOA 2XC2A 3TJFA 1YF0A 3TRPA 2QSIA 5HFKA 2GS3A 1VRSD 1TW9A 1XWKA 1LJRA 2GQLA 3ME7A 1LBKA 1C72A 1UC7A 1H75A 4K6XA 4ECCA 1ERUA 1EEMA 2MMOA 2PBJA 3A5WA 1THXA 5AIXA 3DRNA 2FWEA 3ZITA 4IN0A 3LWAA 2WJUA 2IFQA 4J56E 2H8LA 4IP1A 2GT6A 3NOFA 1OC3A 1OAZA 5D96A 3IRAA 4E8HA 1K3LA 2LV3A 4GQCA 4KCEA 3EU3A 1M7TA 1HNAA 4O32A 3CSJA 4IS0A 1QGVA 5B6MA 2DSAA 2HYXA 4FIWA 4LL1B 3UBKA 5J41A 2DBCA 2C8UA 2G2QA 2NVLA 4L5OA 4ZBBA 2FHEA 2H70A 3QMXA 3FHKA 2C0EA 1U3AA 2GSRA 2VLUA 2IN3A 4OO5A 2HRNA 3F4SA 2L5LA 4BVYA 3HVSA 1WRYA 3TGZA 1SJ6A 1YKAA 4MH3A 3M0FA 3MWHA 2ALBA 1XW6A 2R37A 4Q5QA 2WCIA 4BPYA 1YJ6A 3GFKA 3ZVJA 5DDLA 1K3OA 4MABA 2GSQA 5DQSA 4HI7A 4AF2A 2FWGA 3KGKA 2B5YA 2HRKA 5G5FA 3KH9A 3WD6A 3F6DA 1GSEA 3FW2A 1FOHA 4D73A 2VL2C 1B9XC 2YWMA 3HZ8A 2YWIA 3UBLA 3FR9A 2FNOA 3VK9A 5L71A 5B8BA 19GSA 4RI7A 6GSUA 2IFQB 2PERA 4YKGA 1F2EA 5E4WA 2TRCP 3VURA 4JR6A 2O89A 2J23A 3DEXA 1MEKA 5IM9A 6GSWA 20GSA 1FO5A 3ZFLA 4WF5A 1JZWA 5COHA 5ECIB 4WR4A 1PL1A 2X99A 1A0RP 3EWLA 4ML1A 5H5QA 3CXGA 5ELGA 3A2VA 4ECJA 3UARA 3VWXA 2YJ7A 3WT1A 2VCQA 1HNCA 3GURA 2ZUPA 1U3IA 5ECLB 1EV4A 3UVHA 2LJAA 4AJ7A 2K8VA 4MF6A 2EIRA 5CYYA 1NSWA 2RUEA 2E0QA 4OFMA 2YV7A 4TOPA 2IMDA 3TDGA 5D9VA 2L6DA 4LLRA 5KOWA 2GSTA 1I9DA 2NDOA 5IQYA 1O8XA 4GLTA 4F0CA 1X9SB 3BCKA 5IIZA 1NHOA 1TTZA 4L0WA 2B1KA 1AIUA 1YQ1A 1W89A 1EGRA 1JZRA 4D73B 2MMNA 2R3XA 5CO3A 4Z2UA 3IC4A 3Q18A 3PINA 3HJPA 2ZNMA 4IKHA 1X5DA 2VCWA 1ST9A 2J9HA 4A5PA 4POBA 1WE0A 3LJRA 3F4RA 3QD9A 3MIXA 3PH9A 4BIKA 1F6MC 2X64A 3V1WA 3ERFA 2YWNA 2H1AA 3CYNA 6GSYA 4N30A 1UVZA 4NAXA 1HD2A 4F82A 3RPNA 1ZZYA 4BVXA 1GSQA 4GF0A 2UZ8A 1FW1A 2HSMA 3EC3A 2YP6A 3TKQA 5EPFA 2IMKA 1FG4A 1TRVA 1KTEA 4K5RA 3CRTA 1PD21 1B4QA 2FA4A 2PU9C 1SJIA 2FGXA 2P5RA 4Z2RA 2DKIA 1GTUA 3GSTA 2IPAA 4TR4A 1OYJA 3L78A 5G1LA 1K0DA 2G0FA 4JRRA 1XPVA 4JEDA 1T4ZA 1T4YA 3ZLPA 4QL7A 3FR6A 1O85A 1GUHA 4HQSA 2P31A 3QAGA 2QA2A 2YJHA 5IOWA 2V6KA 2VLTA 3TOTA 3IA1A 2HZEA 2OA7A 3IR4A 4Q5RA 1EOGA 2MMZA 4OFNA
chains in the Genus database with same CATH topology
2JZSA 1MD4A 3CRUA 3EINA 3IHGA 2PPTA 4KSOA 3RHBA 1QFNA 1A23A 2E2MA 2HZFA 2YNXA 2AHEA 3L9SA 4P3YB 4HU7A 3QFBC 1Q98A 2MBTA 5HQPA 4HZ4A 2IMIA 1XWGA 1K0AA 2N5AA 4OCFA 1XCCA 1X9MB 1EZKA 3GNJA 4WXTA 5IMAA 4XS6A 3WT2A 2CZ3A 2OBIA 4Q5NA 2R0GA 1XZOA 1XOAA 3GKNA 5ECPB 2JADA 2B7KA 4NWYA 1GUKA 3M9KA 3HA9A 4ECIA 2R5GA 3HYPA 1GNWA 4G2EA 4TXOB 3HCZA 1XWBA 3GA4A 4K2DA 2CX4A 3MSZA 1SU9A 2FWFA 4MF5A 2M46A 4I6XA 5ECKB 4YAPA 4DEJA 3I69A 2EC4A 4OD7A 2O8VB 5LNKe 1KBNA 2GQKA 1ILOA 3TJJA 4E8EA 1XVQA 1VF1A 5J9CA 4KW6A 1OC9B 5D9XA 1EP7A 2HZEB 1RQMA 3GUSA 4AGSA 3H93A 1X0RA 2PN8A 1G7OA 1GSYA 3MNGA 2I81A 5EVOA 3KM6A 5DCGA 1T3BA 2JSZA 5CAXA 1ERTA 2YANA 2QGVA 4DVCA 1DSBA 5D73A 3ME8A 2GZZA 3G7IA 1RK4A 4PUFC 1DE1A 1ON4A 2IIYA 2I3YA 4GSSA 5AIVA 5DJMA 4HS1A 3M9JA 2WFCA 2KP2A 3O6TA 3HHVA 2VO4A 1A2MA 5IO2A 1M2BA 2K8SA 4K7OA 4ZB6A 3S9FA 2XHFA 1U6TA 2WZ9A 2MYGA 5JWOB 1G0TA 6GSSA 4FYBA 1DE2A 5ECOB 1SKRB 4G0LA 1PKZA 2KP1A 4JU5A 4TR3A 2LJKA 1OKDA 4BWSA 2CZ2A 3CTFA 1UN2A 3TCOA 1XFLA 2H72A 2YZHA 4HJ2A 1GTBA 1PQNA 4IW9A 4HUAA 4XTSA 4KAEA 2YWOA 5ECQB 3M8NA 4TVEA 1DBYA 2HNLA 3K8NA 3MAKA 1GTAA 3E0UA 4MJEA 4TW5A 2KHPA 4USSA 5J3RA 1ZCPA 1DUGA 4ACSA 4K7IA 2H74A 4EO3A 3FZ9A 4HEA2 3OR5A 4MDCA 1AW9A 5J4UA 2CX3A 4JBBA 5J9BA 4KUNA 4IP6A 4MMMA 2GZPA 4ID0A 1KNGA 3TJKA 3IXRA 3BD2A 3EE2A 5IMDA 3U6VA 2VD0A 5B7CA 1TU8A 5EY6A 3U5RE 4DSQA 1TRSA 1GWCA 4PX1A 2FD3A 4YQVA 3HXSA 2F3MA 3LYPA 3CMIA 2VOCA 3DXBA 2LS5A 1R7HA 1GL8A 4JE1A 1HQOA 1PN9A 2OE0A 4X4JA 2LTKA 2VCZA 1XW5A 3EMPA 1YEPA 4JR4A 4GWRA 1GSDA 2H1DA 1M9BA 3Q19A 3IBHA 9GSSA 4FO5A 3UAPA 1PN0A 3O76A 3GYKA 4X1UA 1Z7RA 2V2GA 2PGTA 4EIQA 4G0IA 4EF0A 2YOIA 2YCDA 4OWYA 4K0NA 3FY7A 2DIYA 2HLSA 2N5FA 5B8AA 5LCZA 2DKHA 1K0OA 2CA8A 1XIYA 1QK8A 1PA3A 1USBA 3DYRA 4EDZA 1E6BA 2H66A 1THOA 2GTUA 4IQAA 5CREA 1CQGA 5DAKA 2GGTA 2HE3A 22GSA 2YN1A 4RUVA 3ZMLA 3F9UA 1E2YA 2C3QA 4CHSA 5IPHA 5HFGA 3H4KA 4TXVA 1V57A 4V2NA 4MZBA 3DMLA 1PX6A 3A2XA 2F51A 2FWHA 4WF4A 4Q5FA 2LNSA 1I5GA 3KH7A 1GSUA 3D6IA 4MZCA 3HD5A 5F05A 2H1BA 1SK1A 1AQXA 12GSA 4MPGA 4WKWA 4H86A 1S3DA 1EEJA 2CV4A 3J7Yk 1AXDA 2PVQA 4F03A 4FH8A 4V1Ap 7GSSA 4NV2A 3ZZXA 1GLQA 4XIHA 5GSTA 3VFIA 4GXZA 5ECHB 1WPIA 4EXJA 1YZXA 4N11A 2LEGA 3PPUA 2LSTA 3QCPA 3EURA 1X9WB 2H01A 2QKEA 1ZYEA 4KDYA 1G7EA 1K0MA 1M9AA 4WBRD 1GULA 2HFDA 2OACA 4PTSA 1WOUA 4ZL8A 4HOJA 4MJCA 5IO0A 3L4NA 1EP8A 3DVXA 2QA1A 2OJLA 3GV1A 4XCSA 1Z6MA 3MDKA 3DVWA 3LW9A 3LG6A 5DAKB 1Y25A 3KTBA 16GSA 1K0NA 4G10A 5ECMB 5DQYA 1BEDA 1ZGNA 4ZILA 5ELAA 1A2JA 1A8LA 1AAZA 4K8MA 2M80A 4K7NA 2FA8A 2R0CA 1BYEA 5ENUA 2DC5A 4CW9A 2B6MA 1F3AA 3GRXA 1WIKA 3TJGA 3FEUA 3UEMA 3ERGA 3P8WA 3GN3A 1ERVA 4HQZA 3ISOA 2H30A 3L9UA 4NHWA 3UMAA 5KN1A 1F37A 2IL3A 3HDCA 3TJBA 2GZYA 1K0BA 3TRQA 1RW1A 1SYRA 1O73A 5F07A 4BL7A 3GKMA 2GDRA 3A5IA 3IC8A 5ABRA 4TRXA 4MCUA 3IDVA 1YDKA 2WULA 4AJ6A 2VAFA 5DALA 5IMFA 3D0ZA 1BQ7A 3ZRDA 1A24A 3E3EA 4KDXA 2JZRA 4CY6A 4V2LA 5KEJA 4MPFA 3UJ1A 2O85A 2WB9A 1PKWA 2OBKA 3GSSA 3KP9A 1HYUA 1B4PA 1VF4A 4KDUA 3GX0A 2AYTA 5HR0A 3CTGA 3TKSA 2VCXA 1T8EB 1J9BA 4TXOA 3APQA 4LMVA 5G1KA 5G30A 4NMUA 5ECSA 1WP0A 3H79A 2CQ9A 4HZ2A 3VPTA 3FMWA 4ILFA 1SJZA 3A3TA 5CP1A 4XRAA 4MJBA 3G9BA 2L5OA 3DD3A 2VL9A 2O7KA 2HT9A 5F0GA 4PNGA 5IOXA 4K5SA 3RDWA 3IHQA 3GX8A 3AY8A 2VM2A 1OC9A 3R3EA 4Z7XA 4J57E 4I8BA 5CRWA 2R4VA 4DSRA 3W6GA 2LKUA 5D93A 3GL3A 2WGRA 5G5EA 3PR8A 2XBQA 4PNFA 4LA1A 3GIXA 3D22A 2LRNA 4BL7B 5KN2A 1TI3A 3BOAA 1PSQA 2LJRA 3GKXA 3ZYWA 3ERWA 1HNBA 1BX9A 3VWWA 3ZVJD 4POLA 18GSA 1PGTA 2DMLA 1TK8B 17GSA 2C1YA 3P7XA 2DJ0A 2JU5A 4XRDA 5DALB 4QL9A 1YF1A 5G31A 3ZIJA 5KN3A 4G0KA 3W8SA 3PGTA 4PQ1A 2B5EA 5C04A 2BJXA 1N8JA 3IAS2 3HKRA 2A2SA 2NBSA 4FQUA 3KEBA 3FZAA 1MDJA 4OO4A 3E9JB 2L4QA 5FHIA 2HSHA 4KB3A 4HJMA 3UIWA 3US3A 2XPDA 1NM3A 3FR3A 1M99A 3KTLA 4L0UA 2JZTA 4DSSB 3KMOA 1PRXA 4N10A 4I2UA 3KIJA 1XVWA 3W8JA 4G9HA 5A5KA 5JWQB 1O7UA 1A8YA 5J5NA 2LQOA 1SKWB 2C0DA 5AGYA 3H8QA 3IPZA 5H5RA 4YH2A 1O8WA 2LRTA 4OCEA 4ZIJA 10GSA 3KJYA 5A4WA 2RM6A 3RHCA 2HSYA 1V98A 1SL2B 4NXIA 1V58A 3L0HA 3M3MA 3FZ4A 3SBCA 4O7HA 4EL1A 2VD1A 4IELA 2MMAA 5JWRB 3F0IA 4EUYA 4PURA 4L5LA 2GSSA 4K2XA 3WGDA 1AUCA 2GT5A 4ECBA 2NPBA 2D2ZA 3NZNA 4PXOA 4ZB9A 1Z6NA 4CY8A 1X5CA 3HVXA 3P90A 4FYCA 3H1NA 5D8IA 1Z7PA 2VUPA 4O5RA 1SKSB 4TR1A 1EWXA 1PX7A 4YQMA 2H0GA 2P0GA 2FLSA 3CBUA 4GRFA 4O5QA 5CRGA 1T1VA 1SENA 3Q74A 1S3CA 3GTUA 4POKA 2KLXA 2L59A 2H1GA 2H75A 1AQVA 3GHAA 4G19A 4NHZA 4GSNA 4XS1A 4OMVA 2AB6A 5GAPD 3DKSA 3F8UA 4ZB8A 4PQIA 4N0ZA 5EL8A 5E59A 3QR6A 3FKFA 2OADA 2QC7A 5DCHA 1LU4A 1Z5YE 1ZMAA 3TB2A 1ZOFA 1IYHA 4K0GA 3UVTA 3APSA 4IJ3A 1PL2A 2L57A 3IE3A 1TOFA 3LORA 1F9MA 2HI7A 1A2LA 2PMTA 1ZL9A 5ECRB 1JFUA 1G6WA 3EVIA 3FK8A 3KXOA 8GSSA 3ZMKA 1H4OA 2X8GA 2AAWA 5H5SA 3IK9A 4EE0A 4MNNA 1ACVA 3DWVA 1XWAA 3SWLA 1XW9A 2LUSA 1TRUA 1G6YA 4KNDA 2CVDA 3HY2A 4L8EA 2LRCA 2HRAA 1YEXA 5D9TA 2DJ1A 3TKSC 1F3BA 4TR1B 3GH6A 4BWQA 2AUVA 2C80A 1TDIA 4WETA 11GSA 4ULXA 3JCML 3F4TA 2C0FA 2OE3A 1B48A 3FRCA 1GP1A 4HDEA 1MTCA 4JZQA 4ML6A 3GTUB 1SK2A 5CRDA 5IMZA 4ISDA 5BMUA 3M1GA 1X5EA 1O6JA 4F9ZA 3D21A 3G7YA 5KOXA 4MK3A 1Z3EA 4MJAA 2DJ2A 5AN1A 1Y6EA 2VL3A 2DLXA 3D4TA 2P5QA 2A2PA 1EV9A 5GSSA 3C8EA 3QAVA 2GLRA 3EU4A 1M2DA 5FWGA 3ZL5A 2HRFA 4NV5A 2CT6A 4K1FA 1V9WA 3FYGA 4F0BA 2K9FA 1TK0B 2X8CA 1OVNA 5IMCA 2C4JA 3GMFA 3KZQA 2PVOC 4EC0A 1U87A 4KSMA 4O5UA 1VGLA 4IHUA 2AV4A 3GL5A 3EYTA 1KEBA 2H19A 2GQMA 5LD0A 3VWUA 1B9YC 1TK5B 1TI1A 2H0IA 3BBYA 4ZL9A 1GLPA 4V2MA 2DIZA 2JSYA 6GSXA 1N2AA 4RI6A 2YZUA 3HZ4A 4EIPA 1FAAA 3LSZA 4IBPA 3J7Yb 1AC1A 3LYKA 2H76A 1GH2A 1T7PB 1EOHA 1GSFA 1TXXA 3P2AA 3F3QA 5A4UA 1V2AA 3VI5A 3TOUA 1SL0B 3I43A 4GTUA 3KD0A 4MH2A 2CAIA 3RAZA 4IVFA 1AQWA 3N5OA 4ZL7A 2A4HA 2X4AA 3CSIA 3C1SA 3I9V2 5DJLA 2XBIA 5INYA 4BVYB 1WMJA 2V41A 2H71A 2B5XA 2DMMA 5JCWA 1VF2A 5F8BA 2NTOA 2RLIA 3C71A 4RQXA 1GSSA 2KOKA 2PWJA 4PQHA 5ID2A 2IMFA 3UL3A 2FY6A 3GH9A 2VM1A 1V40A 4IQ1A 4Z2TA 3TRXA 1IYIA 2R6KA 4AJ8A 4WEYA 1BG5A 3KMNA 1QQ2A 1JHBA 4X0XA 5DVBA 3LQ7A 3L9VA 3TKSE 2LNTA 4J2FA 1JZOA 4KGIA 2JL4A 1JZDA 4IJIA 3ZFBA 2REMA 4GQFA 2B3SA 3O3TA 2O87A 4TR0A 3C73A 1OE7A 1J0FA 1FVKA 3F63A 5F06A 5JCUA 1TRWA 2WRTA 5DBQA 1J08A 1EGOA 4CDOA 3I6AA 4IGJA 3VI7A 1SYXA 1FVJA 2EIQA 4GSTA 1SD8A 1UA5A 2L6CA 5HR3A 3WGEA 3D5JA 1FB6A 4HU9A 3EPTA 2VCVA 3QDNA 3HVVA 1VF3A 4MA9A 1O81A 1NHYA 1M2AA 1B8XA 2F8FA 5GZZB 1QXHA 4DSSA 4FYUA 4XHMA 5HR1A 2F8AA 2X8HA 3GKKA 1ZYQB 2BTOT 3ED3A 5D9WA 1TJDA 1XWCA 1BAYA 2I1UA 4F2IA 3IK7A 2B1LA 2YV9A 2B7JA 1OC8A 2X49A 3F6FA 5B6NA 1MDKA 2CAQA 5ID2B 3BCIA 4TN8A 3QOUA 4QQ7A 5IMVA 5BRTA 3LFLA 2H6YA 3QPMA 3BJ5A 2H6XA 3LGCA 2H0HA 4ZXGA 1U88A 2EIOA 4LMWA 4TKYA 3C7MA 3RBTA 2Z9SA 2VLVA 5HFIA 5IPGA 3LEFA 3MYDA 1FB0A 2WS2A 2IWTA 2K6VA 3R2QA 4KF9A 2V6OA 4PUAA 1CQHA 3VWVA 1NW2A 2LQQA 1FOVA 2CVKA 3WGXA 2VL2A 4KE3A 3ZIVA 5JCGA 4I97A 2ON7A 2E2GA 1XBSA 4N0VA 2IMEA 3ZREA 2C3TA 4X43A 6GSTA 3EMXA 1GTIA 2L4CA 3WYWA 2F9SA 6GSVA 4K9ZA 2E7PA 4YAVA 3KP8A 1ABAA 2PUKC 1GNEA 2RUFA 4I5QA 4BVXB 4KH7A 3Q6OA 2K18A 2I4AA 2R2JA 3DIEA 4WBJA 4NPBA 3RPPA 3C1RA 2BMXA 2V32A 3TKPA 4MZWA 2H6ZA 1XOBA 4ZBDA 4WR5A 2VCTA 4EDYA 1MD3A 3DGQA 1ZYNA 2RIIA 1M0UA 2TIRA 1K0CA 2DJJA 3LXTA 3ZTLA 4EVMA 3NIVA 1SL1B 3QFAC 2C3NA 1JLVA 1TP9A 4MLYA 3N9JA 5AISA 3APOA 4LL4B 1K3YA 2FUG2 2OKAA 1S3AA 3QAWA 1TKDB 4XS4A 3FZ5A 4EKZA 1R5PA 2I9HA 3IV4A 4KCAA 1A0FA 4YKFA 1OE8A 1ZYPA 4ZBAA 1SD9A 2WDUA 5KN0A 1YY7A 4ICYA 4MF7A 1Q4JA 4KX4A 1WJKA 4PGTA 5CNWA 3KCMA 2RM5A 1GRXA 3IAM2 1PMTA 2JACA 2C0GA 3A2WA 5A4VA 2ON5A 1SK0A 5ECNB 1OKTA 2M72A 4GCIA 4BA7A 4O92A 1R4WA 4POMA 1TU7A 1ML6A 3UOMA 5G2ZA 2OE1A 3HJMA 3LXZA 1FHEA 1T00A 1QMVA 1YKCA 1JLWA 4MP4A 2FCHA 5C00A 1MDIA 1R5AA 2A4VA 3VPQA 2MBSA 2CVBA 2IJYA 1XXUA 3G7JA 4KA0A 3TUEA 1GUMA 5FT3A 4I2TA 2YPMA 1ERWA 1W4VA 1WWJA 2KUCA 4YQUA 13GSA 1R26A 3IOSA 3CSHA 2DJ3A 5HR2A 2HXKA 2R0PA 2V1MA 3F3RA 1QUWA 2AJQB 1URMA 5CRHA 1Z9HA 2TRXA 4XS4B 14GSA 4V1Ag 4RQRA 2A2RA 2GVPA 4OFTA 2MZCA 2XPEA 3VLNA 2ES7A 3TKRA 1BJXA 2ZCTA 2VIMA 2H73A 5GAND 2N5BA 2DJKA 3D4MA 3HJOA 2XC2A 3TJFA 1YF0A 3TRPA 2QSIA 5HFKA 2GS3A 1VRSD 1TW9A 1XWKA 1LJRA 2GQLA 3ME7A 1LBKA 1C72A 1UC7A 1H75A 4K6XA 4ECCA 1ERUA 1EEMA 2MMOA 2PBJA 3A5WA 1THXA 5AIXA 3DRNA 2FWEA 3ZITA 4IN0A 3LWAA 2WJUA 2IFQA 4J56E 2H8LA 4IP1A 2GT6A 3NOFA 1OC3A 1OAZA 5D96A 3IRAA 4E8HA 1K3LA 2LV3A 4GQCA 4KCEA 3EU3A 1M7TA 1HNAA 4O32A 3CSJA 4IS0A 1QGVA 5B6MA 2DSAA 2HYXA 4FIWA 4LL1B 3UBKA 5J41A 2DBCA 2C8UA 2G2QA 2NVLA 4L5OA 4ZBBA 2FHEA 2H70A 3QMXA 3FHKA 2C0EA 1U3AA 2GSRA 2VLUA 2IN3A 4OO5A 2HRNA 3F4SA 2L5LA 4BVYA 3HVSA 1WRYA 3TGZA 1SJ6A 1YKAA 4MH3A 3M0FA 3MWHA 2ALBA 1XW6A 2R37A 4Q5QA 2WCIA 4BPYA 1YJ6A 3GFKA 3ZVJA 5DDLA 1K3OA 4MABA 2GSQA 5DQSA 4HI7A 4AF2A 2FWGA 3KGKA 2B5YA 2HRKA 5G5FA 3KH9A 3WD6A 3F6DA 1GSEA 3FW2A 1FOHA 4D73A 2VL2C 1B9XC 2YWMA 3HZ8A 2YWIA 3UBLA 3FR9A 2FNOA 3VK9A 5L71A 5B8BA 19GSA 4RI7A 6GSUA 2IFQB 2PERA 4YKGA 1F2EA 5E4WA 2TRCP 3VURA 4JR6A 2O89A 2J23A 3DEXA 1MEKA 5IM9A 6GSWA 20GSA 1FO5A 3ZFLA 4WF5A 1JZWA 5COHA 5ECIB 4WR4A 1PL1A 2X99A 1A0RP 3EWLA 4ML1A 5H5QA 3CXGA 5ELGA 3A2VA 4ECJA 3UARA 3VWXA 2YJ7A 3WT1A 2VCQA 1HNCA 3GURA 2ZUPA 1U3IA 5ECLB 1EV4A 3UVHA 2LJAA 4AJ7A 2K8VA 4MF6A 2EIRA 5CYYA 1NSWA 2RUEA 2E0QA 4OFMA 2YV7A 4TOPA 2IMDA 3TDGA 5D9VA 2L6DA 4LLRA 5KOWA 2GSTA 1I9DA 2NDOA 5IQYA 1O8XA 4GLTA 4F0CA 1X9SB 3BCKA 5IIZA 1NHOA 1TTZA 4L0WA 2B1KA 1AIUA 1YQ1A 1W89A 1EGRA 1JZRA 4D73B 2MMNA 2R3XA 5CO3A 4Z2UA 3IC4A 3Q18A 3PINA 3HJPA 2ZNMA 4IKHA 1X5DA 2VCWA 1ST9A 2J9HA 4A5PA 4POBA 1WE0A 3LJRA 3F4RA 3QD9A 3MIXA 3PH9A 1F6MC 2X64A 3V1WA 3ERFA 2YWNA 2H1AA 3CYNA 6GSYA 4N30A 1UVZA 4NAXA 1HD2A 4F82A 3RPNA 1ZZYA 4BVXA 1GSQA 4GF0A 2UZ8A 1FW1A 2HSMA 3EC3A 2YP6A 3TKQA 5EPFA 2IMKA 1FG4A 1TRVA 1KTEA 4K5RA 3CRTA 1PD21 1B4QA 2FA4A 2PU9C 1SJIA 2FGXA 2P5RA 4Z2RA 2DKIA 1GTUA 3GSTA 2IPAA 4TR4A 1OYJA 3L78A 5G1LA 1K0DA 2G0FA 4JRRA 1XPVA 4JEDA 1T4ZA 1T4YA 3ZLPA 4QL7A 3FR6A 1O85A 1GUHA 4HQSA 2P31A 3QAGA 2QA2A 2YJHA 5IOWA 2V6KA 2VLTA 3TOTA 3IA1A 2HZEA 2OA7A 3IR4A 4Q5RA 1EOGA 2MMZA 4OFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JZS A;  1MD4 A;  3CRU A;  3EIN A;  2PPT A;  4KSO A;  3RHB A;  1QFN A;  1A23 A;  2E2M A;  2HZF A;  2YNX A;  2AHE A;  3L9S A;  4P3Y B;  4HU7 A;  3QFB C;  1Q98 A;  2MBT A;  5HQP A;  4HZ4 A;  2IMI A;  1XWG A;  1K0A A;  2N5A A;  4OCF A;  1XCC A;  1X9M B;  1EZK A;  3GNJ A;  4WXT A;  5IMA A;  4XS6 A;  3WT2 A;  2CZ3 A;  2OBI A;  4Q5N A;  1XZO A;  1XOA A;  3GKN A;  5ECP B;  2JAD A;  2B7K A;  4NWY A;  1GUK A;  3M9K A;  3HA9 A;  4ECI A;  2R5G A;  3HYP A;  1GNW A;  4G2E A;  4TXO B;  3HCZ A;  1XWB A;  3GA4 A;  4K2D A;  2CX4 A;  3MSZ A;  1SU9 A;  2FWF A;  4MF5 A;  2M46 A;  4I6X A;  5ECK B;  4YAP A;  4DEJ A;  3I69 A;  2EC4 A;  4OD7 A;  2O8V B;  5LNK e;  1KBN A;  2GQK A;  1ILO A;  3TJJ A;  4E8E A;  1XVQ A;  1VF1 A;  5J9C A;  4KW6 A;  1OC9 B;  5D9X A;  1EP7 A;  2HZE B;  1RQM A;  3GUS A;  4AGS A;  3H93 A;  1X0R A;  2PN8 A;  1G7O A;  1GSY A;  3MNG A;  2I81 A;  5EVO A;  3KM6 A;  5DCG A;  1T3B A;  2JSZ A;  5CAX A;  1ERT A;  2YAN A;  2QGV A;  4DVC A;  1DSB A;  5D73 A;  3ME8 A;  2GZZ A;  3G7I A;  1RK4 A;  4PUF C;  1DE1 A;  1ON4 A;  2IIY A;  2I3Y A;  4GSS A;  5AIV A;  5DJM A;  4HS1 A;  3M9J A;  2WFC A;  2KP2 A;  3O6T A;  3HHV A;  2VO4 A;  1A2M A;  5IO2 A;  1M2B A;  2K8S A;  4K7O A;  4ZB6 A;  3S9F A;  2XHF A;  1U6T A;  2WZ9 A;  2MYG A;  5JWO B;  1G0T A;  6GSS A;  4FYB A;  1DE2 A;  5ECO B;  1SKR B;  1PKZ A;  2KP1 A;  4JU5 A;  4TR3 A;  2LJK A;  1OKD A;  4BWS A;  2CZ2 A;  3CTF A;  1UN2 A;  3TCO A;  1XFL A;  2H72 A;  2YZH A;  4HJ2 A;  1GTB A;  1PQN A;  4IW9 A;  4HUA A;  4XTS A;  4KAE A;  2YWO A;  5ECQ B;  3M8N A;  4TVE A;  1DBY A;  2HNL A;  3K8N A;  3MAK A;  1GTA A;  3E0U A;  4MJE A;  4TW5 A;  2KHP A;  5J3R A;  1ZCP A;  1DUG A;  4ACS A;  4K7I A;  2H74 A;  4EO3 A;  3FZ9 A;  4HEA 2;  3OR5 A;  4MDC A;  1AW9 A;  5J4U A;  2CX3 A;  4JBB A;  5J9B A;  4KUN A;  4IP6 A;  4MMM A;  2GZP A;  4ID0 A;  1KNG A;  3TJK A;  3IXR A;  3BD2 A;  3EE2 A;  5IMD A;  3U6V A;  2VD0 A;  5B7C A;  1TU8 A;  5EY6 A;  3U5R E;  4DSQ A;  1TRS A;  1GWC A;  4PX1 A;  2FD3 A;  4YQV A;  3HXS A;  2F3M A;  3LYP A;  3CMI A;  2VOC A;  3DXB A;  2LS5 A;  1R7H A;  1GL8 A;  4JE1 A;  1HQO A;  1PN9 A;  2OE0 A;  2LTK A;  2VCZ A;  1XW5 A;  3EMP A;  1YEP A;  4JR4 A;  4GWR A;  1GSD A;  2H1D A;  1M9B A;  3Q19 A;  3IBH A;  9GSS A;  4FO5 A;  3UAP A;  3O76 A;  3GYK A;  4X1U A;  1Z7R A;  2V2G A;  2PGT A;  4EF0 A;  2YOI A;  2YCD A;  4OWY A;  4K0N A;  3FY7 A;  2DIY A;  2HLS A;  2N5F A;  5B8A A;  5LCZ A;  1K0O A;  2CA8 A;  1XIY A;  1QK8 A;  1PA3 A;  1USB A;  3DYR A;  4EDZ A;  1E6B A;  2H66 A;  1THO A;  2GTU A;  4IQA A;  5CRE A;  1CQG A;  5DAK A;  2GGT A;  2HE3 A;  22GS A;  2YN1 A;  4RUV A;  3ZML A;  3F9U A;  1E2Y A;  2C3Q A;  4CHS A;  5IPH A;  5HFG A;  3H4K A;  4TXV A;  1V57 A;  4V2N A;  4MZB A;  3DML A;  1PX6 A;  3A2X A;  2F51 A;  2FWH A;  4WF4 A;  4Q5F A;  2LNS A;  1I5G A;  3KH7 A;  1GSU A;  3D6I A;  4MZC A;  3HD5 A;  5F05 A;  2H1B A;  1SK1 A;  1AQX A;  12GS A;  4MPG A;  4WKW A;  4H86 A;  1S3D A;  1EEJ A;  2CV4 A;  3J7Y k;  1AXD A;  2PVQ A;  4F03 A;  4FH8 A;  4V1A p;  7GSS A;  4NV2 A;  3ZZX A;  1GLQ A;  4XIH A;  5GST A;  3VFI A;  4GXZ A;  5ECH B;  1WPI A;  4EXJ A;  1YZX A;  4N11 A;  2LEG A;  2LST A;  3QCP A;  3EUR A;  1X9W B;  2H01 A;  2QKE A;  1ZYE A;  4KDY A;  1G7E A;  1K0M A;  1M9A A;  4WBR D;  1GUL A;  2HFD A;  2OAC A;  4ZL8 A;  1WOU A;  4HOJ A;  4MJC A;  5IO0 A;  3L4N A;  1EP8 A;  3DVX A;  2OJL A;  3GV1 A;  4XCS A;  1Z6M A;  3MDK A;  3DVW A;  3LG6 A;  5DAK B;  1Y25 A;  3KTB A;  16GS A;  1K0N A;  4G10 A;  5ECM B;  5DQY A;  1BED A;  1ZGN A;  4ZIL A;  5ELA A;  1A2J A;  1A8L A;  1AAZ A;  4K8M A;  2M80 A;  4K7N A;  2FA8 A;  1BYE A;  5ENU A;  2DC5 A;  4CW9 A;  2B6M A;  1F3A A;  3GRX A;  1WIK A;  3TJG A;  3FEU A;  3UEM A;  3ERG A;  3P8W A;  3GN3 A;  1ERV A;  4HQZ A;  3ISO A;  2H30 A;  3L9U A;  4NHW A;  3UMA A;  5KN1 A;  1F37 A;  2IL3 A;  3HDC A;  3TJB A;  2GZY A;  1K0B A;  3TRQ A;  1RW1 A;  1SYR A;  1O73 A;  5F07 A;  4BL7 A;  3GKM A;  2GDR A;  5ABR A;  4TRX A;  4MCU A;  3IDV A;  1YDK A;  2WUL A;  4AJ6 A;  2VAF A;  5DAL A;  5IMF A;  3D0Z A;  1BQ7 A;  3ZRD A;  1A24 A;  3E3E A;  4KDX A;  2JZR A;  4V2L A;  5KEJ A;  4MPF A;  3UJ1 A;  2O85 A;  2WB9 A;  1PKW A;  2OBK A;  3GSS A;  3KP9 A;  1HYU A;  1B4P A;  1VF4 A;  4KDU A;  3GX0 A;  2AYT A;  5HR0 A;  3CTG A;  3TKS A;  2VCX A;  1T8E B;  1J9B A;  4TXO A;  3APQ A;  4LMV A;  5G1K A;  5G30 A;  4NMU A;  5ECS A;  1WP0 A;  3H79 A;  2CQ9 A;  4HZ2 A;  3VPT A;  4ILF A;  1SJZ A;  3A3T A;  5CP1 A;  4XRA A;  4MJB A;  3G9B A;  2L5O A;  3DD3 A;  2VL9 A;  2O7K A;  2HT9 A;  5F0G A;  4PNG A;  5IOX A;  3RDW A;  3IHQ A;  3GX8 A;  3AY8 A;  2VM2 A;  1OC9 A;  4Z7X A;  4J57 E;  4I8B A;  5CRW A;  2R4V A;  4DSR A;  3W6G A;  2LKU A;  5D93 A;  3GL3 A;  2WGR A;  5G5E A;  3PR8 A;  2XBQ A;  4PNF A;  4LA1 A;  3GIX A;  3D22 A;  2LRN A;  5KN2 A;  1TI3 A;  3BOA A;  1PSQ A;  2LJR A;  3GKX A;  3ZYW A;  3ERW A;  1HNB A;  1BX9 A;  3VWW A;  3ZVJ D;  4POL A;  18GS A;  1PGT A;  2DML A;  1TK8 B;  17GS A;  2C1Y A;  3P7X A;  2DJ0 A;  2JU5 A;  4XRD A;  5DAL B;  4QL9 A;  1YF1 A;  5G31 A;  3ZIJ A;  5KN3 A;  3W8S A;  3PGT A;  4PQ1 A;  2B5E A;  5C04 A;  2BJX A;  1N8J A;  3IAS 2;  3HKR A;  2A2S A;  2NBS A;  3KEB A;  3FZA A;  1MDJ A;  4OO4 A;  3E9J B;  2L4Q A;  5FHI A;  2HSH A;  4KB3 A;  4HJM A;  3UIW A;  3US3 A;  2XPD A;  1NM3 A;  3FR3 A;  1M99 A;  3KTL A;  4L0U A;  2JZT A;  4DSS B;  3KMO A;  1PRX A;  4N10 A;  4I2U A;  3KIJ A;  1XVW A;  3W8J A;  4G9H A;  5A5K A;  5JWQ B;  1O7U A;  1A8Y A;  5J5N A;  2LQO A;  1SKW B;  2C0D A;  5AGY A;  3H8Q A;  3IPZ A;  5H5R A;  4YH2 A;  1O8W A;  2LRT A;  4OCE A;  4ZIJ A;  10GS A;  3KJY A;  5A4W A;  2RM6 A;  3RHC A;  2HSY A;  1V98 A;  1SL2 B;  4NXI A;  1V58 A;  3L0H A;  3M3M A;  3FZ4 A;  3SBC A;  4O7H A;  4EL1 A;  2VD1 A;  4IEL A;  2MMA A;  5JWR B;  3F0I A;  4EUY A;  4PUR A;  4L5L A;  2GSS A;  3WGD A;  1AUC A;  2GT5 A;  4ECB A;  2NPB A;  2D2Z A;  3NZN A;  4PXO A;  4ZB9 A;  1Z6N A;  1X5C A;  3HVX A;  3P90 A;  4FYC A;  3H1N A;  5D8I A;  1Z7P A;  2VUP A;  4O5R A;  1SKS B;  4TR1 A;  1EWX A;  1PX7 A;  4YQM A;  2H0G A;  2P0G A;  2FLS A;  3CBU A;  4GRF A;  5CRG A;  1T1V A;  1SEN A;  3Q74 A;  1S3C A;  3GTU A;  4POK A;  2KLX A;  2L59 A;  2H1G A;  2H75 A;  1AQV A;  3GHA A;  4G19 A;  4NHZ A;  4GSN A;  4XS1 A;  4OMV A;  2AB6 A;  5GAP D;  3DKS A;  3F8U A;  4ZB8 A;  4PQI A;  4N0Z A;  5EL8 A;  5E59 A;  3QR6 A;  3FKF A;  2OAD A;  2QC7 A;  5DCH A;  1LU4 A;  1Z5Y E;  1ZMA A;  3TB2 A;  1ZOF A;  1IYH A;  4K0G A;  3UVT A;  3APS A;  4IJ3 A;  1PL2 A;  2L57 A;  3IE3 A;  1TOF A;  3LOR A;  1F9M A;  2HI7 A;  1A2L A;  2PMT A;  1ZL9 A;  5ECR B;  1JFU A;  1G6W A;  3EVI A;  3FK8 A;  3KXO A;  8GSS A;  3ZMK A;  1H4O A;  2X8G A;  2AAW A;  5H5S A;  3IK9 A;  4EE0 A;  1ACV A;  3DWV A;  1XWA A;  3SWL A;  1XW9 A;  2LUS A;  1TRU A;  1G6Y A;  4KND A;  2CVD A;  3HY2 A;  4L8E A;  2LRC A;  1YEX A;  5D9T A;  2DJ1 A;  3TKS C;  1F3B A;  4TR1 B;  3GH6 A;  4BWQ A;  2AUV A;  2C80 A;  1TDI A;  4WET A;  11GS A;  4ULX A;  3JCM L;  3F4T A;  2C0F A;  2OE3 A;  1B48 A;  3FRC A;  1GP1 A;  4HDE A;  1MTC A;  4JZQ A;  4ML6 A;  3GTU B;  1SK2 A;  5CRD A;  5IMZ A;  4ISD A;  3M1G A;  1X5E A;  1O6J A;  4F9Z A;  3D21 A;  3G7Y A;  4MK3 A;  1Z3E A;  4MJA A;  2DJ2 A;  5AN1 A;  1Y6E A;  2VL3 A;  2DLX A;  3D4T A;  2P5Q A;  1EV9 A;  5GSS A;  3C8E A;  3QAV A;  2GLR A;  3EU4 A;  1M2D A;  5FWG A;  3ZL5 A;  2HRF A;  4NV5 A;  2CT6 A;  4K1F A;  1V9W A;  3FYG A;  4F0B A;  2K9F A;  1TK0 B;  2X8C A;  1OVN A;  5IMC A;  2C4J A;  3GMF A;  3KZQ A;  2PVO C;  4EC0 A;  1U87 A;  4KSM A;  1VGL A;  4IHU A;  2AV4 A;  3GL5 A;  3EYT A;  1KEB A;  2H19 A;  2GQM A;  5LD0 A;  3VWU A;  1B9Y C;  1TK5 B;  1TI1 A;  2H0I A;  3BBY A;  4ZL9 A;  1GLP A;  4V2M A;  2DIZ A;  2JSY A;  6GSX A;  1N2A A;  4RI6 A;  2YZU A;  3HZ4 A;  1FAA A;  3LSZ A;  4IBP A;  3J7Y b;  1AC1 A;  3LYK A;  2H76 A;  1GH2 A;  1T7P B;  1EOH A;  1GSF A;  1TXX A;  3P2A A;  3F3Q A;  5A4U A;  1V2A A;  3VI5 A;  3TOU A;  1SL0 B;  3I43 A;  4GTU A;  3KD0 A;  4MH2 A;  2CAI A;  3RAZ A;  4IVF A;  1AQW A;  3N5O A;  4ZL7 A;  3CSI A;  3C1S A;  3I9V 2;  5DJL A;  2XBI A;  5INY A;  1WMJ A;  2V41 A;  2H71 A;  2B5X A;  2DMM A;  5JCW A;  1VF2 A;  5F8B A;  2NTO A;  2RLI A;  3C71 A;  4RQX A;  1GSS A;  2KOK A;  2PWJ A;  4PQH A;  5ID2 A;  2IMF A;  3UL3 A;  2FY6 A;  3GH9 A;  2VM1 A;  1V40 A;  4IQ1 A;  3TRX A;  1IYI A;  2R6K A;  4AJ8 A;  4WEY A;  1BG5 A;  3KMN A;  1QQ2 A;  1JHB A;  4X0X A;  5DVB A;  3LQ7 A;  3L9V A;  3TKS E;  2LNT A;  4J2F A;  1JZO A;  4KGI A;  2JL4 A;  1JZD A;  4IJI A;  3ZFB A;  2REM A;  4GQF A;  2B3S A;  3O3T A;  2O87 A;  4TR0 A;  3C73 A;  1OE7 A;  1J0F A;  1FVK A;  3F63 A;  5F06 A;  5JCU A;  1TRW A;  2WRT A;  5DBQ A;  1J08 A;  1EGO A;  4CDO A;  3I6A A;  4IGJ A;  3VI7 A;  1SYX A;  1FVJ A;  2EIQ A;  4GST A;  1SD8 A;  1UA5 A;  2L6C A;  5HR3 A;  3WGE A;  3D5J A;  1FB6 A;  4HU9 A;  2VCV A;  3QDN A;  3HVV A;  1VF3 A;  4MA9 A;  1O81 A;  1NHY A;  1M2A A;  1B8X A;  2F8F A;  5GZZ B;  1QXH A;  4DSS A;  4FYU A;  4XHM A;  5HR1 A;  2F8A A;  2X8H A;  3GKK A;  1ZYQ B;  2BTO T;  3ED3 A;  5D9W A;  1TJD A;  1XWC A;  1BAY A;  2I1U A;  4F2I A;  3IK7 A;  2B1L A;  2YV9 A;  2B7J A;  1OC8 A;  3F6F A;  5B6N A;  1MDK A;  2CAQ A;  5ID2 B;  3BCI A;  4TN8 A;  3QOU A;  4QQ7 A;  5IMV A;  3LFL A;  2H6Y A;  3QPM A;  3BJ5 A;  2H6X A;  3LGC A;  2H0H A;  4ZXG A;  1U88 A;  2EIO A;  4LMW A;  4TKY A;  3C7M A;  3RBT A;  2Z9S A;  2VLV A;  5HFI A;  5IPG A;  3LEF A;  1FB0 A;  2WS2 A;  2IWT A;  2K6V A;  3R2Q A;  2V6O A;  4PUA A;  1CQH A;  3VWV A;  1NW2 A;  2LQQ A;  1FOV A;  2CVK A;  3WGX A;  2VL2 A;  4KE3 A;  3ZIV A;  5JCG A;  4I97 A;  2ON7 A;  2E2G A;  1XBS A;  4N0V A;  2IME A;  3ZRE A;  2C3T A;  4X43 A;  6GST A;  3EMX A;  1GTI A;  2L4C A;  3WYW A;  2F9S A;  6GSV A;  4K9Z A;  2E7P A;  4YAV A;  3KP8 A;  1ABA A;  2PUK C;  1GNE A;  2RUF A;  4I5Q A;  4KH7 A;  3Q6O A;  2K18 A;  2I4A A;  2R2J A;  3DIE A;  4WBJ A;  4NPB A;  3RPP A;  3C1R A;  2BMX A;  2V32 A;  3TKP A;  4MZW A;  2H6Z A;  1XOB A;  4ZBD A;  4WR5 A;  2VCT A;  4EDY A;  1MD3 A;  3DGQ A;  2RII A;  1M0U A;  2TIR A;  1K0C A;  2DJJ A;  3LXT A;  3ZTL A;  4EVM A;  3NIV A;  1SL1 B;  3QFA C;  2C3N A;  1JLV A;  1TP9 A;  4MLY A;  3N9J A;  5AIS A;  3APO A;  4LL4 B;  1K3Y A;  2FUG 2;  2OKA A;  1S3A A;  3QAW A;  1TKD B;  4XS4 A;  3FZ5 A;  4EKZ A;  1R5P A;  2I9H A;  3IV4 A;  4KCA A;  1A0F A;  1OE8 A;  4ZBA A;  1SD9 A;  2WDU A;  5KN0 A;  1YY7 A;  4MF7 A;  1Q4J A;  4KX4 A;  1WJK A;  4PGT A;  5CNW A;  3KCM A;  2RM5 A;  1GRX A;  3IAM 2;  1PMT A;  2JAC A;  2C0G A;  3A2W A;  5A4V A;  2ON5 A;  1SK0 A;  5ECN B;  1OKT A;  2M72 A;  4GCI A;  4BA7 A;  4O92 A;  1R4W A;  4POM A;  1TU7 A;  1ML6 A;  3UOM A;  5G2Z A;  2OE1 A;  3HJM A;  3LXZ A;  1FHE A;  1T00 A;  1QMV A;  1YKC A;  1JLW A;  4MP4 A;  2FCH A;  5C00 A;  1MDI A;  1R5A A;  2A4V A;  3VPQ A;  2MBS A;  2CVB A;  2IJY A;  1XXU A;  3G7J A;  4KA0 A;  3TUE A;  1GUM A;  5FT3 A;  4I2T A;  2YPM A;  1ERW A;  1W4V A;  1WWJ A;  2KUC A;  4YQU A;  13GS A;  1R26 A;  3IOS A;  3CSH A;  2DJ3 A;  5HR2 A;  2HXK A;  2V1M A;  3F3R A;  1QUW A;  2AJQ B;  1URM A;  5CRH A;  1Z9H A;  2TRX A;  4XS4 B;  14GS A;  4V1A g;  4RQR A;  2A2R A;  2GVP A;  4OFT A;  2MZC A;  2XPE A;  3VLN A;  2ES7 A;  3TKR A;  1BJX A;  2ZCT A;  2VIM A;  2H73 A;  5GAN D;  2N5B A;  2DJK A;  3D4M A;  3HJO A;  2XC2 A;  3TJF A;  1YF0 A;  3TRP A;  2QSI A;  5HFK A;  2GS3 A;  1VRS D;  1TW9 A;  1XWK A;  1LJR A;  2GQL A;  3ME7 A;  1LBK A;  1C72 A;  1UC7 A;  1H75 A;  4K6X A;  4ECC A;  1ERU A;  1EEM A;  2MMO A;  2PBJ A;  3A5W A;  1THX A;  5AIX A;  3DRN A;  2FWE A;  3ZIT A;  4IN0 A;  3LWA A;  2WJU A;  2IFQ A;  4J56 E;  2H8L A;  4IP1 A;  2GT6 A;  3NOF A;  1OC3 A;  1OAZ A;  5D96 A;  3IRA A;  4E8H A;  1K3L A;  2LV3 A;  4GQC A;  4KCE A;  3EU3 A;  1M7T A;  1HNA A;  4O32 A;  3CSJ A;  4IS0 A;  1QGV A;  5B6M A;  2DSA A;  2HYX A;  4FIW A;  4LL1 B;  3UBK A;  5J41 A;  2DBC A;  2C8U A;  2G2Q A;  2NVL A;  4L5O A;  4ZBB A;  2FHE A;  2H70 A;  3QMX A;  3FHK A;  2C0E A;  1U3A A;  2GSR A;  2VLU A;  2IN3 A;  4OO5 A;  2HRN A;  3F4S A;  2L5L A;  4BVY A;  3HVS A;  1WRY A;  3TGZ A;  1SJ6 A;  1YKA A;  4MH3 A;  3M0F A;  3MWH A;  2ALB A;  1XW6 A;  2R37 A;  4Q5Q A;  2WCI A;  4BPY A;  1YJ6 A;  3GFK A;  3ZVJ A;  5DDL A;  1K3O A;  4MAB A;  2GSQ A;  5DQS A;  4HI7 A;  4AF2 A;  2FWG A;  3KGK A;  2B5Y A;  5G5F A;  3KH9 A;  3WD6 A;  3F6D A;  1GSE A;  3FW2 A;  4D73 A;  2VL2 C;  1B9X C;  2YWM A;  3HZ8 A;  2YWI A;  3UBL A;  3FR9 A;  2FNO A;  3VK9 A;  5L71 A;  5B8B A;  19GS A;  4RI7 A;  6GSU A;  2IFQ B;  2PER A;  1F2E A;  5E4W A;  2TRC P;  3VUR A;  4JR6 A;  2O89 A;  2J23 A;  3DEX A;  1MEK A;  5IM9 A;  6GSW A;  20GS A;  1FO5 A;  3ZFL A;  4WF5 A;  1JZW A;  5COH A;  5ECI B;  4WR4 A;  1PL1 A;  2X99 A;  1A0R P;  3EWL A;  4ML1 A;  5H5Q A;  3CXG A;  5ELG A;  3A2V A;  4ECJ A;  3UAR A;  3VWX A;  2YJ7 A;  3WT1 A;  2VCQ A;  1HNC A;  3GUR A;  2ZUP A;  1U3I A;  5ECL B;  1EV4 A;  3UVH A;  2LJA A;  4AJ7 A;  2K8V A;  4MF6 A;  2EIR A;  5CYY A;  1NSW A;  2RUE A;  2E0Q A;  4OFM A;  2YV7 A;  4TOP A;  2IMD A;  3TDG A;  5D9V A;  2L6D A;  4LLR A;  2GST A;  1I9D A;  2NDO A;  5IQY A;  1O8X A;  4GLT A;  4F0C A;  1X9S B;  3BCK A;  5IIZ A;  1NHO A;  1TTZ A;  4L0W A;  2B1K A;  1AIU A;  1YQ1 A;  1W89 A;  1EGR A;  1JZR A;  4D73 B;  2MMN A;  2R3X A;  5CO3 A;  3IC4 A;  3Q18 A;  3PIN A;  3HJP A;  2ZNM A;  4IKH A;  1X5D A;  2VCW A;  1ST9 A;  2J9H A;  4POB A;  1WE0 A;  3LJR A;  3F4R A;  3PH9 A;  3QD9 A;  1F6M C;  2X64 A;  3V1W A;  3ERF A;  2YWN A;  2H1A A;  3CYN A;  6GSY A;  4N30 A;  1UVZ A;  4NAX A;  1HD2 A;  4F82 A;  3RPN A;  1ZZY A;  4BVX A;  1GSQ A;  4GF0 A;  1FW1 A;  3EC3 A;  2YP6 A;  3TKQ A;  5EPF A;  2IMK A;  1FG4 A;  1TRV A;  1KTE A;  3CRT A;  1PD2 1;  1B4Q A;  2FA4 A;  2PU9 C;  1SJI A;  2FGX A;  2P5R A;  1GTU A;  3GST A;  2IPA A;  4TR4 A;  1OYJ A;  3L78 A;  5G1L A;  1K0D A;  2G0F A;  4JRR A;  1XPV A;  4JED A;  1T4Z A;  1T4Y A;  3ZLP A;  4QL7 A;  3FR6 A;  1O85 A;  1GUH A;  4HQS A;  2P31 A;  3QAG A;  2YJH A;  5IOW A;  2V6K A;  2VLT A;  3TOT A;  3IA1 A;  2HZE A;  2OA7 A;  3IR4 A;  4Q5R A;  1EOG A;  2MMZ A;  4OFN A; 
#chains in the Genus database with same CATH topology
 2JZS A;  1MD4 A;  3CRU A;  3EIN A;  3IHG A;  2PPT A;  4KSO A;  3RHB A;  1QFN A;  1A23 A;  2E2M A;  2HZF A;  2YNX A;  2AHE A;  3L9S A;  4P3Y B;  4HU7 A;  3QFB C;  1Q98 A;  2MBT A;  5HQP A;  4HZ4 A;  2IMI A;  1XWG A;  1K0A A;  2N5A A;  4OCF A;  1XCC A;  1X9M B;  1EZK A;  3GNJ A;  4WXT A;  5IMA A;  4XS6 A;  3WT2 A;  2CZ3 A;  2OBI A;  4Q5N A;  2R0G A;  1XZO A;  1XOA A;  3GKN A;  5ECP B;  2JAD A;  2B7K A;  4NWY A;  1GUK A;  3M9K A;  3HA9 A;  4ECI A;  2R5G A;  3HYP A;  1GNW A;  4G2E A;  4TXO B;  3HCZ A;  1XWB A;  3GA4 A;  4K2D A;  2CX4 A;  3MSZ A;  1SU9 A;  2FWF A;  4MF5 A;  2M46 A;  4I6X A;  5ECK B;  4YAP A;  4DEJ A;  3I69 A;  2EC4 A;  4OD7 A;  2O8V B;  5LNK e;  1KBN A;  2GQK A;  1ILO A;  3TJJ A;  4E8E A;  1XVQ A;  1VF1 A;  5J9C A;  4KW6 A;  1OC9 B;  5D9X A;  1EP7 A;  2HZE B;  1RQM A;  3GUS A;  4AGS A;  3H93 A;  1X0R A;  2PN8 A;  1G7O A;  1GSY A;  3MNG A;  2I81 A;  5EVO A;  3KM6 A;  5DCG A;  1T3B A;  2JSZ A;  5CAX A;  1ERT A;  2YAN A;  2QGV A;  4DVC A;  1DSB A;  5D73 A;  3ME8 A;  2GZZ A;  3G7I A;  1RK4 A;  4PUF C;  1DE1 A;  1ON4 A;  2IIY A;  2I3Y A;  4GSS A;  5AIV A;  5DJM A;  4HS1 A;  3M9J A;  2WFC A;  2KP2 A;  3O6T A;  3HHV A;  2VO4 A;  1A2M A;  5IO2 A;  1M2B A;  2K8S A;  4K7O A;  4ZB6 A;  3S9F A;  2XHF A;  1U6T A;  2WZ9 A;  2MYG A;  5JWO B;  1G0T A;  6GSS A;  4FYB A;  1DE2 A;  5ECO B;  1SKR B;  4G0L A;  1PKZ A;  2KP1 A;  4JU5 A;  4TR3 A;  2LJK A;  1OKD A;  4BWS A;  2CZ2 A;  3CTF A;  1UN2 A;  3TCO A;  1XFL A;  2H72 A;  2YZH A;  4HJ2 A;  1GTB A;  1PQN A;  4IW9 A;  4HUA A;  4XTS A;  4KAE A;  2YWO A;  5ECQ B;  3M8N A;  4TVE A;  1DBY A;  2HNL A;  3K8N A;  3MAK A;  1GTA A;  3E0U A;  4MJE A;  4TW5 A;  2KHP A;  4USS A;  5J3R A;  1ZCP A;  1DUG A;  4ACS A;  4K7I A;  2H74 A;  4EO3 A;  3FZ9 A;  4HEA 2;  3OR5 A;  4MDC A;  1AW9 A;  5J4U A;  2CX3 A;  4JBB A;  5J9B A;  4KUN A;  4IP6 A;  4MMM A;  2GZP A;  4ID0 A;  1KNG A;  3TJK A;  3IXR A;  3BD2 A;  3EE2 A;  5IMD A;  3U6V A;  2VD0 A;  5B7C A;  1TU8 A;  5EY6 A;  3U5R E;  4DSQ A;  1TRS A;  1GWC A;  4PX1 A;  2FD3 A;  4YQV A;  3HXS A;  2F3M A;  3LYP A;  3CMI A;  2VOC A;  3DXB A;  3CQF A;  2LS5 A;  1R7H A;  1GL8 A;  4JE1 A;  1HQO A;  1PN9 A;  2OE0 A;  4X4J A;  2LTK A;  2VCZ A;  1XW5 A;  3EMP A;  1YEP A;  4JR4 A;  4GWR A;  1GSD A;  2H1D A;  1M9B A;  3Q19 A;  3IBH A;  9GSS A;  4FO5 A;  3UAP A;  1PN0 A;  3O76 A;  4HSC X;  3GYK A;  4X1U A;  1Z7R A;  2V2G A;  2PGT A;  4EIQ A;  4G0I A;  4EF0 A;  2YOI A;  2YCD A;  4OWY A;  4K0N A;  3FY7 A;  2DIY A;  2HLS A;  2N5F A;  5B8A A;  5LCZ A;  2DKH A;  1K0O A;  2CA8 A;  1XIY A;  1QK8 A;  1PA3 A;  1USB A;  3DYR A;  4EDZ A;  1E6B A;  2H66 A;  1THO A;  2GTU A;  4IQA A;  5CRE A;  1CQG A;  5DAK A;  2GGT A;  2HE3 A;  22GS A;  2YN1 A;  4RUV A;  3ZML A;  3F9U A;  1E2Y A;  2C3Q A;  4CHS A;  5IPH A;  5HFG A;  3H4K A;  4TXV A;  1V57 A;  4V2N A;  4MZB A;  3DML A;  1PX6 A;  3A2X A;  2F51 A;  2FWH A;  4WF4 A;  4Q5F A;  2LNS A;  1I5G A;  3KH7 A;  1GSU A;  3D6I A;  4MZC A;  3HD5 A;  5F05 A;  2H1B A;  1SK1 A;  1AQX A;  12GS A;  4MPG A;  4WKW A;  4H86 A;  1S3D A;  1EEJ A;  2CV4 A;  3J7Y k;  1AXD A;  2PVQ A;  4F03 A;  4FH8 A;  4V1A p;  7GSS A;  4NV2 A;  3ZZX A;  1GLQ A;  4XIH A;  5GST A;  3VFI A;  4GXZ A;  5ECH B;  1WPI A;  4EXJ A;  1YZX A;  4N11 A;  2LEG A;  3PPU A;  2LST A;  3QCP A;  3EUR A;  1X9W B;  2H01 A;  2QKE A;  1ZYE A;  4KDY A;  1G7E A;  1K0M A;  1M9A A;  4WBR D;  1GUL A;  2HFD A;  2OAC A;  4PTS A;  1WOU A;  4ZL8 A;  4HOJ A;  4MJC A;  5IO0 A;  3L4N A;  1EP8 A;  3DVX A;  2QA1 A;  2OJL A;  3GV1 A;  4XCS A;  1Z6M A;  3MDK A;  3DVW A;  3LW9 A;  3LG6 A;  5DAK B;  1Y25 A;  3KTB A;  16GS A;  1K0N A;  4G10 A;  1S3R A;  5ECM B;  5DQY A;  1BED A;  1ZGN A;  4ZIL A;  5ELA A;  1A2J A;  1A8L A;  1AAZ A;  4K8M A;  2M80 A;  4K7N A;  2FA8 A;  2R0C A;  1BYE A;  5ENU A;  2DC5 A;  4CW9 A;  2B6M A;  1F3A A;  3GRX A;  1WIK A;  3TJG A;  3FEU A;  3UEM A;  3ERG A;  3P8W A;  3GN3 A;  1ERV A;  4HQZ A;  3ISO A;  2H30 A;  3L9U A;  4NHW A;  3UMA A;  5KN1 A;  1F37 A;  2IL3 A;  3HDC A;  3TJB A;  2GZY A;  1K0B A;  3TRQ A;  1RW1 A;  1SYR A;  1O73 A;  5F07 A;  4BL7 A;  3GKM A;  2GDR A;  3A5I A;  3IC8 A;  5ABR A;  4TRX A;  4MCU A;  3IDV A;  1YDK A;  2WUL A;  4AJ6 A;  2VAF A;  5DAL A;  5IMF A;  3D0Z A;  1BQ7 A;  3ZRD A;  1A24 A;  3E3E A;  4KDX A;  2JZR A;  4CY6 A;  4V2L A;  5KEJ A;  4MPF A;  3UJ1 A;  2O85 A;  2WB9 A;  1PKW A;  2OBK A;  3GSS A;  3KP9 A;  1HYU A;  1B4P A;  1VF4 A;  4KDU A;  3GX0 A;  2AYT A;  5HR0 A;  3CTG A;  3TKS A;  2VCX A;  1T8E B;  1J9B A;  4TXO A;  3APQ A;  4LMV A;  5G1K A;  5G30 A;  4NMU A;  5ECS A;  1WP0 A;  3H79 A;  2CQ9 A;  4HZ2 A;  3VPT A;  3FMW A;  4ILF A;  1SJZ A;  3A3T A;  5CP1 A;  4XRA A;  4MJB A;  3G9B A;  2L5O A;  3DD3 A;  2VL9 A;  2O7K A;  2HT9 A;  5F0G A;  4PNG A;  5IOX A;  4K5S A;  3RDW A;  3IHQ A;  3GX8 A;  3AY8 A;  2VM2 A;  1OC9 A;  3R3E A;  4Z7X A;  4J57 E;  4I8B A;  5CRW A;  2R4V A;  4DSR A;  3W6G A;  2LKU A;  5D93 A;  3GL3 A;  2WGR A;  5G5E A;  3PR8 A;  2XBQ A;  4PNF A;  4LA1 A;  3GIX A;  3D22 A;  2LRN A;  4BL7 B;  5KN2 A;  1TI3 A;  3BOA A;  1PSQ A;  2LJR A;  3GKX A;  3ZYW A;  3ERW A;  1HNB A;  1BX9 A;  3VWW A;  3ZVJ D;  4POL A;  18GS A;  1PGT A;  2DML A;  1TK8 B;  17GS A;  2C1Y A;  3P7X A;  2DJ0 A;  2JU5 A;  4XRD A;  5DAL B;  4QL9 A;  1YF1 A;  5G31 A;  3ZIJ A;  5KN3 A;  4G0K A;  3W8S A;  3PGT A;  4PQ1 A;  2B5E A;  5C04 A;  2BJX A;  1N8J A;  3IAS 2;  3HKR A;  2A2S A;  2NBS A;  4FQU A;  3KEB A;  3FZA A;  1MDJ A;  4OO4 A;  3E9J B;  2L4Q A;  5FHI A;  2HSH A;  4KB3 A;  4HJM A;  3UIW A;  3US3 A;  2XPD A;  1NM3 A;  3FR3 A;  1M99 A;  3KTL A;  4L0U A;  2JZT A;  4DSS B;  3KMO A;  1PRX A;  4N10 A;  4I2U A;  3KIJ A;  1XVW A;  3W8J A;  4G9H A;  5A5K A;  5JWQ B;  1O7U A;  1A8Y A;  5J5N A;  2LQO A;  1SKW B;  2C0D A;  5AGY A;  3H8Q A;  3IPZ A;  5H5R A;  4YH2 A;  1O8W A;  2LRT A;  4OCE A;  4ZIJ A;  10GS A;  3KJY A;  5A4W A;  2RM6 A;  3RHC A;  2HSY A;  1V98 A;  1SL2 B;  4NXI A;  1V58 A;  3L0H A;  3M3M A;  3FZ4 A;  3SBC A;  4O7H A;  4EL1 A;  2VD1 A;  4IEL A;  2MMA A;  5JWR B;  3F0I A;  4EUY A;  4PUR A;  4L5L A;  2GSS A;  4K2X A;  3WGD A;  1AUC A;  2GT5 A;  4ECB A;  2NPB A;  2D2Z A;  3NZN A;  4PXO A;  4ZB9 A;  1Z6N A;  4CY8 A;  1X5C A;  3HVX A;  3P90 A;  4FYC A;  3H1N A;  5D8I A;  1Z7P A;  2VUP A;  4O5R A;  1SKS B;  4TR1 A;  1EWX A;  1PX7 A;  4YQM A;  2H0G A;  2P0G A;  2FLS A;  3CBU A;  4GRF A;  4O5Q A;  5CRG A;  1T1V A;  1SEN A;  3Q74 A;  1S3C A;  3GTU A;  4POK A;  2KLX A;  2L59 A;  2H1G A;  2H75 A;  1AQV A;  3GHA A;  4G19 A;  4NHZ A;  4GSN A;  4XS1 A;  4OMV A;  2AB6 A;  5GAP D;  3DKS A;  3F8U A;  4ZB8 A;  4PQI A;  4N0Z A;  5EL8 A;  5E59 A;  3QR6 A;  3FKF A;  2OAD A;  2QC7 A;  5DCH A;  1LU4 A;  1Z5Y E;  1ZMA A;  3TB2 A;  1ZOF A;  1IYH A;  4K0G A;  3UVT A;  3APS A;  4IJ3 A;  1PL2 A;  2L57 A;  3IE3 A;  1TOF A;  3LOR A;  1F9M A;  2HI7 A;  1A2L A;  2PMT A;  1ZL9 A;  5ECR B;  1JFU A;  1G6W A;  3EVI A;  3FK8 A;  3KXO A;  8GSS A;  3ZMK A;  1H4O A;  2X8G A;  2AAW A;  5H5S A;  3IK9 A;  4EE0 A;  4MNN A;  1ACV A;  3DWV A;  1XWA A;  3SWL A;  1XW9 A;  2LUS A;  1TRU A;  1G6Y A;  4KND A;  2CVD A;  3HY2 A;  4L8E A;  2LRC A;  2HRA A;  1YEX A;  5D9T A;  2DJ1 A;  3TKS C;  1F3B A;  4TR1 B;  3GH6 A;  4BWQ A;  2AUV A;  2C80 A;  1TDI A;  4WET A;  11GS A;  4ULX A;  3JCM L;  3F4T A;  2C0F A;  2OE3 A;  1B48 A;  3FRC A;  1GP1 A;  4HDE A;  1MTC A;  4JZQ A;  4ML6 A;  3GTU B;  1SK2 A;  5CRD A;  5IMZ A;  4ISD A;  5BMU A;  3M1G A;  1X5E A;  1O6J A;  4F9Z A;  3D21 A;  3G7Y A;  5KOX A;  4MK3 A;  1Z3E A;  4MJA A;  2DJ2 A;  5AN1 A;  1Y6E A;  3HVN A;  2VL3 A;  2DLX A;  3D4T A;  2P5Q A;  2A2P A;  1EV9 A;  5GSS A;  3C8E A;  3QAV A;  2GLR A;  3EU4 A;  1M2D A;  5FWG A;  3ZL5 A;  2HRF A;  4NV5 A;  2CT6 A;  4K1F A;  1V9W A;  3FYG A;  4F0B A;  2K9F A;  1TK0 B;  2X8C A;  1OVN A;  5IMC A;  2C4J A;  3GMF A;  3KZQ A;  2PVO C;  4EC0 A;  1U87 A;  4KSM A;  4O5U A;  1VGL A;  4IHU A;  2AV4 A;  3GL5 A;  3EYT A;  1KEB A;  2H19 A;  2GQM A;  5LD0 A;  3VWU A;  1B9Y C;  1TK5 B;  1TI1 A;  2H0I A;  3BBY A;  4ZL9 A;  1GLP A;  4V2M A;  2DIZ A;  2JSY A;  6GSX A;  1N2A A;  4RI6 A;  2YZU A;  3HZ4 A;  4EIP A;  1FAA A;  3LSZ A;  4IBP A;  3J7Y b;  1AC1 A;  3LYK A;  2H76 A;  1GH2 A;  1T7P B;  1EOH A;  1GSF A;  1TXX A;  3P2A A;  3F3Q A;  5A4U A;  1V2A A;  3VI5 A;  3TOU A;  1SL0 B;  3I43 A;  4GTU A;  3KD0 A;  4MH2 A;  2CAI A;  3RAZ A;  4IVF A;  1AQW A;  3N5O A;  4ZL7 A;  2A4H A;  2X4A A;  3CSI A;  3C1S A;  3I9V 2;  5DJL A;  2XBI A;  5INY A;  4BVY B;  1WMJ A;  2V41 A;  2H71 A;  2B5X A;  2DMM A;  5JCW A;  1VF2 A;  5F8B A;  2NTO A;  2RLI A;  3C71 A;  4RQX A;  1GSS A;  2KOK A;  2PWJ A;  4PQH A;  5ID2 A;  2IMF A;  3UL3 A;  2FY6 A;  3GH9 A;  2VM1 A;  1V40 A;  4IQ1 A;  4Z2T A;  3TRX A;  1IYI A;  2R6K A;  4AJ8 A;  4WEY A;  1BG5 A;  3KMN A;  1QQ2 A;  1JHB A;  4X0X A;  5DVB A;  3LQ7 A;  3L9V A;  3TKS E;  2LNT A;  4J2F A;  1JZO A;  1M3J A;  4KGI A;  2JL4 A;  1JZD A;  4IJI A;  3ZFB A;  2REM A;  4GQF A;  2B3S A;  3O3T A;  2O87 A;  4TR0 A;  3C73 A;  1OE7 A;  1J0F A;  1FVK A;  3F63 A;  5F06 A;  5JCU A;  1TRW A;  2WRT A;  5DBQ A;  1J08 A;  1EGO A;  4CDO A;  3I6A A;  4IGJ A;  3VI7 A;  1SYX A;  1FVJ A;  2EIQ A;  4GST A;  1SD8 A;  1UA5 A;  2L6C A;  5HR3 A;  3WGE A;  3D5J A;  1FB6 A;  4HU9 A;  3EPT A;  2VCV A;  3QDN A;  3HVV A;  1VF3 A;  4MA9 A;  1O81 A;  1NHY A;  1M2A A;  1B8X A;  2F8F A;  5GZZ B;  1QXH A;  4DSS A;  4FYU A;  4XHM A;  5HR1 A;  2F8A A;  2X8H A;  3GKK A;  1ZYQ B;  2BTO T;  3ED3 A;  5D9W A;  1TJD A;  1XWC A;  1BAY A;  2I1U A;  4F2I A;  3IK7 A;  2B1L A;  2YV9 A;  2B7J A;  1OC8 A;  2X49 A;  3F6F A;  5B6N A;  1MDK A;  2CAQ A;  5ID2 B;  3BCI A;  4TN8 A;  3QOU A;  4QQ7 A;  5IMV A;  5BRT A;  3LFL A;  2H6Y A;  3QPM A;  3BJ5 A;  2H6X A;  3LGC A;  2H0H A;  4ZXG A;  1U88 A;  1XG8 A;  2EIO A;  4LMW A;  4TKY A;  3C7M A;  3RBT A;  2Z9S A;  2VLV A;  5HFI A;  5IPG A;  3LEF A;  3MYD A;  1FB0 A;  2WS2 A;  2IWT A;  2K6V A;  3R2Q A;  4KF9 A;  2V6O A;  4PUA A;  1CQH A;  3VWV A;  1NW2 A;  2LQQ A;  1FOV A;  2CVK A;  3WGX A;  2VL2 A;  4KE3 A;  3ZIV A;  5JCG A;  4I97 A;  2ON7 A;  2E2G A;  1XBS A;  4N0V A;  2IME A;  3ZRE A;  2C3T A;  4X43 A;  6GST A;  3EMX A;  1GTI A;  2L4C A;  3WYW A;  2F9S A;  6GSV A;  4K9Z A;  2E7P A;  4YAV A;  3KP8 A;  1ABA A;  2PUK C;  1GNE A;  2RUF A;  4I5Q A;  4BVX B;  4KH7 A;  3Q6O A;  2K18 A;  2I4A A;  2R2J A;  3DIE A;  4WBJ A;  4NPB A;  3RPP A;  3C1R A;  2BMX A;  2V32 A;  3TKP A;  4MZW A;  2H6Z A;  1XOB A;  4ZBD A;  4WR5 A;  2VCT A;  4EDY A;  1MD3 A;  3DGQ A;  1PFO A;  1ZYN A;  2RII A;  1M0U A;  2TIR A;  1K0C A;  2DJJ A;  3LXT A;  3ZTL A;  4EVM A;  3NIV A;  1SL1 B;  3QFA C;  2C3N A;  1JLV A;  1TP9 A;  4MLY A;  3N9J A;  5AIS A;  3APO A;  4LL4 B;  1K3Y A;  2FUG 2;  2OKA A;  1S3A A;  3QAW A;  1TKD B;  4XS4 A;  3FZ5 A;  4EKZ A;  1R5P A;  2I9H A;  3IV4 A;  4KCA A;  1A0F A;  4YKF A;  1OE8 A;  1ZYP A;  4ZBA A;  1SD9 A;  2WDU A;  5KN0 A;  1YY7 A;  4ICY A;  4MF7 A;  1Q4J A;  4KX4 A;  1WJK A;  4PGT A;  5CNW A;  3KCM A;  2RM5 A;  1GRX A;  1M3I A;  3IAM 2;  1PMT A;  2JAC A;  2C0G A;  3A2W A;  5A4V A;  2ON5 A;  1SK0 A;  5ECN B;  1OKT A;  2M72 A;  4GCI A;  4BA7 A;  4O92 A;  1R4W A;  4POM A;  1TU7 A;  1ML6 A;  3UOM A;  5G2Z A;  2OE1 A;  3HJM A;  3LXZ A;  1FHE A;  1T00 A;  1QMV A;  1YKC A;  1JLW A;  4MP4 A;  2FCH A;  5C00 A;  1MDI A;  1R5A A;  2A4V A;  3VPQ A;  2MBS A;  2CVB A;  2IJY A;  1XXU A;  3G7J A;  4KA0 A;  3TUE A;  1GUM A;  5FT3 A;  4I2T A;  2YPM A;  1ERW A;  1W4V A;  1WWJ A;  2KUC A;  4YQU A;  13GS A;  1R26 A;  3IOS A;  3CSH A;  2DJ3 A;  5HR2 A;  2HXK A;  2R0P A;  2V1M A;  3F3R A;  1QUW A;  2AJQ B;  1URM A;  5CRH A;  1Z9H A;  2TRX A;  4XS4 B;  14GS A;  4V1A g;  4RQR A;  2A2R A;  2GVP A;  4OFT A;  2MZC A;  2XPE A;  3VLN A;  2ES7 A;  3TKR A;  1BJX A;  2ZCT A;  2VIM A;  2H73 A;  5GAN D;  2N5B A;  2DJK A;  3D4M A;  3HJO A;  2XC2 A;  3TJF A;  1YF0 A;  3TRP A;  2QSI A;  5HFK A;  2GS3 A;  1VRS D;  1TW9 A;  1XWK A;  1LJR A;  2GQL A;  3ME7 A;  1LBK A;  1C72 A;  1UC7 A;  1H75 A;  4K6X A;  4ECC A;  1ERU A;  1EEM A;  2MMO A;  2PBJ A;  3A5W A;  1THX A;  5AIX A;  3DRN A;  2FWE A;  3ZIT A;  4IN0 A;  3LWA A;  2WJU A;  2IFQ A;  4J56 E;  2H8L A;  4IP1 A;  2GT6 A;  3NOF A;  1OC3 A;  1OAZ A;  5D96 A;  3IRA A;  4E8H A;  1K3L A;  2LV3 A;  4GQC A;  4KCE A;  3EU3 A;  1M7T A;  1HNA A;  4O32 A;  3CSJ A;  4IS0 A;  1QGV A;  5B6M A;  2DSA A;  2HYX A;  4FIW A;  4LL1 B;  3UBK A;  5J41 A;  2DBC A;  2C8U A;  2G2Q A;  2NVL A;  4L5O A;  4ZBB A;  2FHE A;  2H70 A;  3QMX A;  3FHK A;  2C0E A;  1U3A A;  2GSR A;  2VLU A;  2IN3 A;  4OO5 A;  2HRN A;  3F4S A;  2L5L A;  4BVY A;  3HVS A;  1WRY A;  3TGZ A;  1SJ6 A;  1YKA A;  4MH3 A;  3M0F A;  3MWH A;  2ALB A;  1XW6 A;  2R37 A;  4Q5Q A;  2WCI A;  4BPY A;  1YJ6 A;  3GFK A;  3ZVJ A;  5DDL A;  1K3O A;  4MAB A;  2GSQ A;  5DQS A;  4HI7 A;  4AF2 A;  2FWG A;  3KGK A;  2B5Y A;  2HRK A;  5G5F A;  3KH9 A;  3WD6 A;  3F6D A;  1GSE A;  3FW2 A;  1FOH A;  4D73 A;  2VL2 C;  1B9X C;  2YWM A;  3HZ8 A;  2YWI A;  3UBL A;  3FR9 A;  2FNO A;  3VK9 A;  5L71 A;  5B8B A;  19GS A;  4RI7 A;  6GSU A;  2IFQ B;  2PER A;  4YKG A;  1F2E A;  5E4W A;  2TRC P;  3VUR A;  4JR6 A;  2O89 A;  2J23 A;  3DEX A;  1MEK A;  5IM9 A;  6GSW A;  20GS A;  1FO5 A;  3ZFL A;  4WF5 A;  1JZW A;  5COH A;  5ECI B;  4WR4 A;  1PL1 A;  2X99 A;  1A0R P;  3EWL A;  4ML1 A;  5H5Q A;  3CXG A;  5ELG A;  3A2V A;  4ECJ A;  3UAR A;  3VWX A;  2YJ7 A;  3WT1 A;  2VCQ A;  1HNC A;  3GUR A;  2ZUP A;  1U3I A;  5ECL B;  1EV4 A;  3UVH A;  2LJA A;  4AJ7 A;  2K8V A;  4MF6 A;  2EIR A;  5CYY A;  1NSW A;  2RUE A;  2E0Q A;  4OFM A;  2YV7 A;  4TOP A;  2IMD A;  3TDG A;  5D9V A;  2L6D A;  4LLR A;  5KOW A;  2GST A;  1I9D A;  2NDO A;  5IQY A;  1O8X A;  4GLT A;  4F0C A;  1X9S B;  3BCK A;  5IIZ A;  1NHO A;  1TTZ A;  4L0W A;  2B1K A;  1AIU A;  1YQ1 A;  1W89 A;  1EGR A;  1JZR A;  4D73 B;  2MMN A;  2R3X A;  5CO3 A;  4Z2U A;  3IC4 A;  3Q18 A;  3PIN A;  3HJP A;  2ZNM A;  4IKH A;  1X5D A;  2VCW A;  1ST9 A;  2J9H A;  4A5P A;  4POB A;  1WE0 A;  3LJR A;  3F4R A;  3QD9 A;  3MIX A;  3PH9 A;  4BIK A;  1F6M C;  2X64 A;  3V1W A;  3ERF A;  2YWN A;  2H1A A;  3CYN A;  6GSY A;  4N30 A;  1UVZ A;  4NAX A;  1HD2 A;  4F82 A;  3RPN A;  1ZZY A;  4BVX A;  1GSQ A;  4GF0 A;  2UZ8 A;  1FW1 A;  2HSM A;  3EC3 A;  2YP6 A;  3TKQ A;  5EPF A;  2IMK A;  1FG4 A;  1TRV A;  1KTE A;  4K5R A;  3CRT A;  1PD2 1;  1B4Q A;  2FA4 A;  2PU9 C;  1SJI A;  2FGX A;  2P5R A;  4Z2R A;  2DKI A;  1GTU A;  3GST A;  2IPA A;  4TR4 A;  1OYJ A;  3L78 A;  5G1L A;  1K0D A;  2G0F A;  4JRR A;  1XPV A;  4JED A;  1T4Z A;  1T4Y A;  3ZLP A;  4QL7 A;  3FR6 A;  1O85 A;  1GUH A;  4HQS A;  2P31 A;  3QAG A;  2QA2 A;  2YJH A;  5IOW A;  2V6K A;  2VLT A;  3TOT A;  3IA1 A;  2HZE A;  2OA7 A;  3IR4 A;  4Q5R A;  1EOG A;  2MMZ A;  4OFN A; 
#chains in the Genus database with same CATH homology
 2JZS A;  1MD4 A;  3CRU A;  3EIN A;  3IHG A;  2PPT A;  4KSO A;  3RHB A;  1QFN A;  1A23 A;  2E2M A;  2HZF A;  2YNX A;  2AHE A;  3L9S A;  4P3Y B;  4HU7 A;  3QFB C;  1Q98 A;  2MBT A;  5HQP A;  4HZ4 A;  2IMI A;  1XWG A;  1K0A A;  2N5A A;  4OCF A;  1XCC A;  1X9M B;  1EZK A;  3GNJ A;  4WXT A;  5IMA A;  4XS6 A;  3WT2 A;  2CZ3 A;  2OBI A;  4Q5N A;  2R0G A;  1XZO A;  1XOA A;  3GKN A;  5ECP B;  2JAD A;  2B7K A;  4NWY A;  1GUK A;  3M9K A;  3HA9 A;  4ECI A;  2R5G A;  3HYP A;  1GNW A;  4G2E A;  4TXO B;  3HCZ A;  1XWB A;  3GA4 A;  4K2D A;  2CX4 A;  3MSZ A;  1SU9 A;  2FWF A;  4MF5 A;  2M46 A;  4I6X A;  5ECK B;  4YAP A;  4DEJ A;  3I69 A;  2EC4 A;  4OD7 A;  2O8V B;  5LNK e;  1KBN A;  2GQK A;  1ILO A;  3TJJ A;  4E8E A;  1XVQ A;  1VF1 A;  5J9C A;  4KW6 A;  1OC9 B;  5D9X A;  1EP7 A;  2HZE B;  1RQM A;  3GUS A;  4AGS A;  3H93 A;  1X0R A;  2PN8 A;  1G7O A;  1GSY A;  3MNG A;  2I81 A;  5EVO A;  3KM6 A;  5DCG A;  1T3B A;  2JSZ A;  5CAX A;  1ERT A;  2YAN A;  2QGV A;  4DVC A;  1DSB A;  5D73 A;  3ME8 A;  2GZZ A;  3G7I A;  1RK4 A;  4PUF C;  1DE1 A;  1ON4 A;  2IIY A;  2I3Y A;  4GSS A;  5AIV A;  5DJM A;  4HS1 A;  3M9J A;  2WFC A;  2KP2 A;  3O6T A;  3HHV A;  2VO4 A;  1A2M A;  5IO2 A;  1M2B A;  2K8S A;  4K7O A;  4ZB6 A;  3S9F A;  2XHF A;  1U6T A;  2WZ9 A;  2MYG A;  5JWO B;  1G0T A;  6GSS A;  4FYB A;  1DE2 A;  5ECO B;  1SKR B;  4G0L A;  1PKZ A;  2KP1 A;  4JU5 A;  4TR3 A;  2LJK A;  1OKD A;  4BWS A;  2CZ2 A;  3CTF A;  1UN2 A;  3TCO A;  1XFL A;  2H72 A;  2YZH A;  4HJ2 A;  1GTB A;  1PQN A;  4IW9 A;  4HUA A;  4XTS A;  4KAE A;  2YWO A;  5ECQ B;  3M8N A;  4TVE A;  1DBY A;  2HNL A;  3K8N A;  3MAK A;  1GTA A;  3E0U A;  4MJE A;  4TW5 A;  2KHP A;  4USS A;  5J3R A;  1ZCP A;  1DUG A;  4ACS A;  4K7I A;  2H74 A;  4EO3 A;  3FZ9 A;  4HEA 2;  3OR5 A;  4MDC A;  1AW9 A;  5J4U A;  2CX3 A;  4JBB A;  5J9B A;  4KUN A;  4IP6 A;  4MMM A;  2GZP A;  4ID0 A;  1KNG A;  3TJK A;  3IXR A;  3BD2 A;  3EE2 A;  5IMD A;  3U6V A;  2VD0 A;  5B7C A;  1TU8 A;  5EY6 A;  3U5R E;  4DSQ A;  1TRS A;  1GWC A;  4PX1 A;  2FD3 A;  4YQV A;  3HXS A;  2F3M A;  3LYP A;  3CMI A;  2VOC A;  3DXB A;  2LS5 A;  1R7H A;  1GL8 A;  4JE1 A;  1HQO A;  1PN9 A;  2OE0 A;  4X4J A;  2LTK A;  2VCZ A;  1XW5 A;  3EMP A;  1YEP A;  4JR4 A;  4GWR A;  1GSD A;  2H1D A;  1M9B A;  3Q19 A;  3IBH A;  9GSS A;  4FO5 A;  3UAP A;  1PN0 A;  3O76 A;  3GYK A;  4X1U A;  1Z7R A;  2V2G A;  2PGT A;  4EIQ A;  4G0I A;  4EF0 A;  2YOI A;  2YCD A;  4OWY A;  4K0N A;  3FY7 A;  2DIY A;  2HLS A;  2N5F A;  5B8A A;  5LCZ A;  2DKH A;  1K0O A;  2CA8 A;  1XIY A;  1QK8 A;  1PA3 A;  1USB A;  3DYR A;  4EDZ A;  1E6B A;  2H66 A;  1THO A;  2GTU A;  4IQA A;  5CRE A;  1CQG A;  5DAK A;  2GGT A;  2HE3 A;  22GS A;  2YN1 A;  4RUV A;  3ZML A;  3F9U A;  1E2Y A;  2C3Q A;  4CHS A;  5IPH A;  5HFG A;  3H4K A;  4TXV A;  1V57 A;  4V2N A;  4MZB A;  3DML A;  1PX6 A;  3A2X A;  2F51 A;  2FWH A;  4WF4 A;  4Q5F A;  2LNS A;  1I5G A;  3KH7 A;  1GSU A;  3D6I A;  4MZC A;  3HD5 A;  5F05 A;  2H1B A;  1SK1 A;  1AQX A;  12GS A;  4MPG A;  4WKW A;  4H86 A;  1S3D A;  1EEJ A;  2CV4 A;  3J7Y k;  1AXD A;  2PVQ A;  4F03 A;  4FH8 A;  4V1A p;  7GSS A;  4NV2 A;  3ZZX A;  1GLQ A;  4XIH A;  5GST A;  3VFI A;  4GXZ A;  5ECH B;  1WPI A;  4EXJ A;  1YZX A;  4N11 A;  2LEG A;  3PPU A;  2LST A;  3QCP A;  3EUR A;  1X9W B;  2H01 A;  2QKE A;  1ZYE A;  4KDY A;  1G7E A;  1K0M A;  1M9A A;  4WBR D;  1GUL A;  2HFD A;  2OAC A;  4PTS A;  1WOU A;  4ZL8 A;  4HOJ A;  4MJC A;  5IO0 A;  3L4N A;  1EP8 A;  3DVX A;  2QA1 A;  2OJL A;  3GV1 A;  4XCS A;  1Z6M A;  3MDK A;  3DVW A;  3LW9 A;  3LG6 A;  5DAK B;  1Y25 A;  3KTB A;  16GS A;  1K0N A;  4G10 A;  5ECM B;  5DQY A;  1BED A;  1ZGN A;  4ZIL A;  5ELA A;  1A2J A;  1A8L A;  1AAZ A;  4K8M A;  2M80 A;  4K7N A;  2FA8 A;  2R0C A;  1BYE A;  5ENU A;  2DC5 A;  4CW9 A;  2B6M A;  1F3A A;  3GRX A;  1WIK A;  3TJG A;  3FEU A;  3UEM A;  3ERG A;  3P8W A;  3GN3 A;  1ERV A;  4HQZ A;  3ISO A;  2H30 A;  3L9U A;  4NHW A;  3UMA A;  5KN1 A;  1F37 A;  2IL3 A;  3HDC A;  3TJB A;  2GZY A;  1K0B A;  3TRQ A;  1RW1 A;  1SYR A;  1O73 A;  5F07 A;  4BL7 A;  3GKM A;  2GDR A;  3A5I A;  3IC8 A;  5ABR A;  4TRX A;  4MCU A;  3IDV A;  1YDK A;  2WUL A;  4AJ6 A;  2VAF A;  5DAL A;  5IMF A;  3D0Z A;  1BQ7 A;  3ZRD A;  1A24 A;  3E3E A;  4KDX A;  2JZR A;  4CY6 A;  4V2L A;  5KEJ A;  4MPF A;  3UJ1 A;  2O85 A;  2WB9 A;  1PKW A;  2OBK A;  3GSS A;  3KP9 A;  1HYU A;  1B4P A;  1VF4 A;  4KDU A;  3GX0 A;  2AYT A;  5HR0 A;  3CTG A;  3TKS A;  2VCX A;  1T8E B;  1J9B A;  4TXO A;  3APQ A;  4LMV A;  5G1K A;  5G30 A;  4NMU A;  5ECS A;  1WP0 A;  3H79 A;  2CQ9 A;  4HZ2 A;  3VPT A;  3FMW A;  4ILF A;  1SJZ A;  3A3T A;  5CP1 A;  4XRA A;  4MJB A;  3G9B A;  2L5O A;  3DD3 A;  2VL9 A;  2O7K A;  2HT9 A;  5F0G A;  4PNG A;  5IOX A;  4K5S A;  3RDW A;  3IHQ A;  3GX8 A;  3AY8 A;  2VM2 A;  1OC9 A;  3R3E A;  4Z7X A;  4J57 E;  4I8B A;  5CRW A;  2R4V A;  4DSR A;  3W6G A;  2LKU A;  5D93 A;  3GL3 A;  2WGR A;  5G5E A;  3PR8 A;  2XBQ A;  4PNF A;  4LA1 A;  3GIX A;  3D22 A;  2LRN A;  4BL7 B;  5KN2 A;  1TI3 A;  3BOA A;  1PSQ A;  2LJR A;  3GKX A;  3ZYW A;  3ERW A;  1HNB A;  1BX9 A;  3VWW A;  3ZVJ D;  4POL A;  18GS A;  1PGT A;  2DML A;  1TK8 B;  17GS A;  2C1Y A;  3P7X A;  2DJ0 A;  2JU5 A;  4XRD A;  5DAL B;  4QL9 A;  1YF1 A;  5G31 A;  3ZIJ A;  5KN3 A;  4G0K A;  3W8S A;  3PGT A;  4PQ1 A;  2B5E A;  5C04 A;  2BJX A;  1N8J A;  3IAS 2;  3HKR A;  2A2S A;  2NBS A;  4FQU A;  3KEB A;  3FZA A;  1MDJ A;  4OO4 A;  3E9J B;  2L4Q A;  5FHI A;  2HSH A;  4KB3 A;  4HJM A;  3UIW A;  3US3 A;  2XPD A;  1NM3 A;  3FR3 A;  1M99 A;  3KTL A;  4L0U A;  2JZT A;  4DSS B;  3KMO A;  1PRX A;  4N10 A;  4I2U A;  3KIJ A;  1XVW A;  3W8J A;  4G9H A;  5A5K A;  5JWQ B;  1O7U A;  1A8Y A;  5J5N A;  2LQO A;  1SKW B;  2C0D A;  5AGY A;  3H8Q A;  3IPZ A;  5H5R A;  4YH2 A;  1O8W A;  2LRT A;  4OCE A;  4ZIJ A;  10GS A;  3KJY A;  5A4W A;  2RM6 A;  3RHC A;  2HSY A;  1V98 A;  1SL2 B;  4NXI A;  1V58 A;  3L0H A;  3M3M A;  3FZ4 A;  3SBC A;  4O7H A;  4EL1 A;  2VD1 A;  4IEL A;  2MMA A;  5JWR B;  3F0I A;  4EUY A;  4PUR A;  4L5L A;  2GSS A;  4K2X A;  3WGD A;  1AUC A;  2GT5 A;  4ECB A;  2NPB A;  2D2Z A;  3NZN A;  4PXO A;  4ZB9 A;  1Z6N A;  4CY8 A;  1X5C A;  3HVX A;  3P90 A;  4FYC A;  3H1N A;  5D8I A;  1Z7P A;  2VUP A;  4O5R A;  1SKS B;  4TR1 A;  1EWX A;  1PX7 A;  4YQM A;  2H0G A;  2P0G A;  2FLS A;  3CBU A;  4GRF A;  4O5Q A;  5CRG A;  1T1V A;  1SEN A;  3Q74 A;  1S3C A;  3GTU A;  4POK A;  2KLX A;  2L59 A;  2H1G A;  2H75 A;  1AQV A;  3GHA A;  4G19 A;  4NHZ A;  4GSN A;  4XS1 A;  4OMV A;  2AB6 A;  5GAP D;  3DKS A;  3F8U A;  4ZB8 A;  4PQI A;  4N0Z A;  5EL8 A;  5E59 A;  3QR6 A;  3FKF A;  2OAD A;  2QC7 A;  5DCH A;  1LU4 A;  1Z5Y E;  1ZMA A;  3TB2 A;  1ZOF A;  1IYH A;  4K0G A;  3UVT A;  3APS A;  4IJ3 A;  1PL2 A;  2L57 A;  3IE3 A;  1TOF A;  3LOR A;  1F9M A;  2HI7 A;  1A2L A;  2PMT A;  1ZL9 A;  5ECR B;  1JFU A;  1G6W A;  3EVI A;  3FK8 A;  3KXO A;  8GSS A;  3ZMK A;  1H4O A;  2X8G A;  2AAW A;  5H5S A;  3IK9 A;  4EE0 A;  4MNN A;  1ACV A;  3DWV A;  1XWA A;  3SWL A;  1XW9 A;  2LUS A;  1TRU A;  1G6Y A;  4KND A;  2CVD A;  3HY2 A;  4L8E A;  2LRC A;  2HRA A;  1YEX A;  5D9T A;  2DJ1 A;  3TKS C;  1F3B A;  4TR1 B;  3GH6 A;  4BWQ A;  2AUV A;  2C80 A;  1TDI A;  4WET A;  11GS A;  4ULX A;  3JCM L;  3F4T A;  2C0F A;  2OE3 A;  1B48 A;  3FRC A;  1GP1 A;  4HDE A;  1MTC A;  4JZQ A;  4ML6 A;  3GTU B;  1SK2 A;  5CRD A;  5IMZ A;  4ISD A;  5BMU A;  3M1G A;  1X5E A;  1O6J A;  4F9Z A;  3D21 A;  3G7Y A;  5KOX A;  4MK3 A;  1Z3E A;  4MJA A;  2DJ2 A;  5AN1 A;  1Y6E A;  2VL3 A;  2DLX A;  3D4T A;  2P5Q A;  2A2P A;  1EV9 A;  5GSS A;  3C8E A;  3QAV A;  2GLR A;  3EU4 A;  1M2D A;  5FWG A;  3ZL5 A;  2HRF A;  4NV5 A;  2CT6 A;  4K1F A;  1V9W A;  3FYG A;  4F0B A;  2K9F A;  1TK0 B;  2X8C A;  1OVN A;  5IMC A;  2C4J A;  3GMF A;  3KZQ A;  2PVO C;  4EC0 A;  1U87 A;  4KSM A;  4O5U A;  1VGL A;  4IHU A;  2AV4 A;  3GL5 A;  3EYT A;  1KEB A;  2H19 A;  2GQM A;  5LD0 A;  3VWU A;  1B9Y C;  1TK5 B;  1TI1 A;  2H0I A;  3BBY A;  4ZL9 A;  1GLP A;  4V2M A;  2DIZ A;  2JSY A;  6GSX A;  1N2A A;  4RI6 A;  2YZU A;  3HZ4 A;  4EIP A;  1FAA A;  3LSZ A;  4IBP A;  3J7Y b;  1AC1 A;  3LYK A;  2H76 A;  1GH2 A;  1T7P B;  1EOH A;  1GSF A;  1TXX A;  3P2A A;  3F3Q A;  5A4U A;  1V2A A;  3VI5 A;  3TOU A;  1SL0 B;  3I43 A;  4GTU A;  3KD0 A;  4MH2 A;  2CAI A;  3RAZ A;  4IVF A;  1AQW A;  3N5O A;  4ZL7 A;  2A4H A;  2X4A A;  3CSI A;  3C1S A;  3I9V 2;  5DJL A;  2XBI A;  5INY A;  4BVY B;  1WMJ A;  2V41 A;  2H71 A;  2B5X A;  2DMM A;  5JCW A;  1VF2 A;  5F8B A;  2NTO A;  2RLI A;  3C71 A;  4RQX A;  1GSS A;  2KOK A;  2PWJ A;  4PQH A;  5ID2 A;  2IMF A;  3UL3 A;  2FY6 A;  3GH9 A;  2VM1 A;  1V40 A;  4IQ1 A;  4Z2T A;  3TRX A;  1IYI A;  2R6K A;  4AJ8 A;  4WEY A;  1BG5 A;  3KMN A;  1QQ2 A;  1JHB A;  4X0X A;  5DVB A;  3LQ7 A;  3L9V A;  3TKS E;  2LNT A;  4J2F A;  1JZO A;  4KGI A;  2JL4 A;  1JZD A;  4IJI A;  3ZFB A;  2REM A;  4GQF A;  2B3S A;  3O3T A;  2O87 A;  4TR0 A;  3C73 A;  1OE7 A;  1J0F A;  1FVK A;  3F63 A;  5F06 A;  5JCU A;  1TRW A;  2WRT A;  5DBQ A;  1J08 A;  1EGO A;  4CDO A;  3I6A A;  4IGJ A;  3VI7 A;  1SYX A;  1FVJ A;  2EIQ A;  4GST A;  1SD8 A;  1UA5 A;  2L6C A;  5HR3 A;  3WGE A;  3D5J A;  1FB6 A;  4HU9 A;  3EPT A;  2VCV A;  3QDN A;  3HVV A;  1VF3 A;  4MA9 A;  1O81 A;  1NHY A;  1M2A A;  1B8X A;  2F8F A;  5GZZ B;  1QXH A;  4DSS A;  4FYU A;  4XHM A;  5HR1 A;  2F8A A;  2X8H A;  3GKK A;  1ZYQ B;  2BTO T;  3ED3 A;  5D9W A;  1TJD A;  1XWC A;  1BAY A;  2I1U A;  4F2I A;  3IK7 A;  2B1L A;  2YV9 A;  2B7J A;  1OC8 A;  2X49 A;  3F6F A;  5B6N A;  1MDK A;  2CAQ A;  5ID2 B;  3BCI A;  4TN8 A;  3QOU A;  4QQ7 A;  5IMV A;  5BRT A;  3LFL A;  2H6Y A;  3QPM A;  3BJ5 A;  2H6X A;  3LGC A;  2H0H A;  4ZXG A;  1U88 A;  2EIO A;  4LMW A;  4TKY A;  3C7M A;  3RBT A;  2Z9S A;  2VLV A;  5HFI A;  5IPG A;  3LEF A;  3MYD A;  1FB0 A;  2WS2 A;  2IWT A;  2K6V A;  3R2Q A;  4KF9 A;  2V6O A;  4PUA A;  1CQH A;  3VWV A;  1NW2 A;  2LQQ A;  1FOV A;  2CVK A;  3WGX A;  2VL2 A;  4KE3 A;  3ZIV A;  5JCG A;  4I97 A;  2ON7 A;  2E2G A;  1XBS A;  4N0V A;  2IME A;  3ZRE A;  2C3T A;  4X43 A;  6GST A;  3EMX A;  1GTI A;  2L4C A;  3WYW A;  2F9S A;  6GSV A;  4K9Z A;  2E7P A;  4YAV A;  3KP8 A;  1ABA A;  2PUK C;  1GNE A;  2RUF A;  4I5Q A;  4BVX B;  4KH7 A;  3Q6O A;  2K18 A;  2I4A A;  2R2J A;  3DIE A;  4WBJ A;  4NPB A;  3RPP A;  3C1R A;  2BMX A;  2V32 A;  3TKP A;  4MZW A;  2H6Z A;  1XOB A;  4ZBD A;  4WR5 A;  2VCT A;  4EDY A;  1MD3 A;  3DGQ A;  1ZYN A;  2RII A;  1M0U A;  2TIR A;  1K0C A;  2DJJ A;  3LXT A;  3ZTL A;  4EVM A;  3NIV A;  1SL1 B;  3QFA C;  2C3N A;  1JLV A;  1TP9 A;  4MLY A;  3N9J A;  5AIS A;  3APO A;  4LL4 B;  1K3Y A;  2FUG 2;  2OKA A;  1S3A A;  3QAW A;  1TKD B;  4XS4 A;  3FZ5 A;  4EKZ A;  1R5P A;  2I9H A;  3IV4 A;  4KCA A;  1A0F A;  4YKF A;  1OE8 A;  1ZYP A;  4ZBA A;  1SD9 A;  2WDU A;  5KN0 A;  1YY7 A;  4ICY A;  4MF7 A;  1Q4J A;  4KX4 A;  1WJK A;  4PGT A;  5CNW A;  3KCM A;  2RM5 A;  1GRX A;  3IAM 2;  1PMT A;  2JAC A;  2C0G A;  3A2W A;  5A4V A;  2ON5 A;  1SK0 A;  5ECN B;  1OKT A;  2M72 A;  4GCI A;  4BA7 A;  4O92 A;  1R4W A;  4POM A;  1TU7 A;  1ML6 A;  3UOM A;  5G2Z A;  2OE1 A;  3HJM A;  3LXZ A;  1FHE A;  1T00 A;  1QMV A;  1YKC A;  1JLW A;  4MP4 A;  2FCH A;  5C00 A;  1MDI A;  1R5A A;  2A4V A;  3VPQ A;  2MBS A;  2CVB A;  2IJY A;  1XXU A;  3G7J A;  4KA0 A;  3TUE A;  1GUM A;  5FT3 A;  4I2T A;  2YPM A;  1ERW A;  1W4V A;  1WWJ A;  2KUC A;  4YQU A;  13GS A;  1R26 A;  3IOS A;  3CSH A;  2DJ3 A;  5HR2 A;  2HXK A;  2R0P A;  2V1M A;  3F3R A;  1QUW A;  2AJQ B;  1URM A;  5CRH A;  1Z9H A;  2TRX A;  4XS4 B;  14GS A;  4V1A g;  4RQR A;  2A2R A;  2GVP A;  4OFT A;  2MZC A;  2XPE A;  3VLN A;  2ES7 A;  3TKR A;  1BJX A;  2ZCT A;  2VIM A;  2H73 A;  5GAN D;  2N5B A;  2DJK A;  3D4M A;  3HJO A;  2XC2 A;  3TJF A;  1YF0 A;  3TRP A;  2QSI A;  5HFK A;  2GS3 A;  1VRS D;  1TW9 A;  1XWK A;  1LJR A;  2GQL A;  3ME7 A;  1LBK A;  1C72 A;  1UC7 A;  1H75 A;  4K6X A;  4ECC A;  1ERU A;  1EEM A;  2MMO A;  2PBJ A;  3A5W A;  1THX A;  5AIX A;  3DRN A;  2FWE A;  3ZIT A;  4IN0 A;  3LWA A;  2WJU A;  2IFQ A;  4J56 E;  2H8L A;  4IP1 A;  2GT6 A;  3NOF A;  1OC3 A;  1OAZ A;  5D96 A;  3IRA A;  4E8H A;  1K3L A;  2LV3 A;  4GQC A;  4KCE A;  3EU3 A;  1M7T A;  1HNA A;  4O32 A;  3CSJ A;  4IS0 A;  1QGV A;  5B6M A;  2DSA A;  2HYX A;  4FIW A;  4LL1 B;  3UBK A;  5J41 A;  2DBC A;  2C8U A;  2G2Q A;  2NVL A;  4L5O A;  4ZBB A;  2FHE A;  2H70 A;  3QMX A;  3FHK A;  2C0E A;  1U3A A;  2GSR A;  2VLU A;  2IN3 A;  4OO5 A;  2HRN A;  3F4S A;  2L5L A;  4BVY A;  3HVS A;  1WRY A;  3TGZ A;  1SJ6 A;  1YKA A;  4MH3 A;  3M0F A;  3MWH A;  2ALB A;  1XW6 A;  2R37 A;  4Q5Q A;  2WCI A;  4BPY A;  1YJ6 A;  3GFK A;  3ZVJ A;  5DDL A;  1K3O A;  4MAB A;  2GSQ A;  5DQS A;  4HI7 A;  4AF2 A;  2FWG A;  3KGK A;  2B5Y A;  2HRK A;  5G5F A;  3KH9 A;  3WD6 A;  3F6D A;  1GSE A;  3FW2 A;  1FOH A;  4D73 A;  2VL2 C;  1B9X C;  2YWM A;  3HZ8 A;  2YWI A;  3UBL A;  3FR9 A;  2FNO A;  3VK9 A;  5L71 A;  5B8B A;  19GS A;  4RI7 A;  6GSU A;  2IFQ B;  2PER A;  4YKG A;  1F2E A;  5E4W A;  2TRC P;  3VUR A;  4JR6 A;  2O89 A;  2J23 A;  3DEX A;  1MEK A;  5IM9 A;  6GSW A;  20GS A;  1FO5 A;  3ZFL A;  4WF5 A;  1JZW A;  5COH A;  5ECI B;  4WR4 A;  1PL1 A;  2X99 A;  1A0R P;  3EWL A;  4ML1 A;  5H5Q A;  3CXG A;  5ELG A;  3A2V A;  4ECJ A;  3UAR A;  3VWX A;  2YJ7 A;  3WT1 A;  2VCQ A;  1HNC A;  3GUR A;  2ZUP A;  1U3I A;  5ECL B;  1EV4 A;  3UVH A;  2LJA A;  4AJ7 A;  2K8V A;  4MF6 A;  2EIR A;  5CYY A;  1NSW A;  2RUE A;  2E0Q A;  4OFM A;  2YV7 A;  4TOP A;  2IMD A;  3TDG A;  5D9V A;  2L6D A;  4LLR A;  5KOW A;  2GST A;  1I9D A;  2NDO A;  5IQY A;  1O8X A;  4GLT A;  4F0C A;  1X9S B;  3BCK A;  5IIZ A;  1NHO A;  1TTZ A;  4L0W A;  2B1K A;  1AIU A;  1YQ1 A;  1W89 A;  1EGR A;  1JZR A;  4D73 B;  2MMN A;  2R3X A;  5CO3 A;  4Z2U A;  3IC4 A;  3Q18 A;  3PIN A;  3HJP A;  2ZNM A;  4IKH A;  1X5D A;  2VCW A;  1ST9 A;  2J9H A;  4A5P A;  4POB A;  1WE0 A;  3LJR A;  3F4R A;  3QD9 A;  3MIX A;  3PH9 A;  1F6M C;  2X64 A;  3V1W A;  3ERF A;  2YWN A;  2H1A A;  3CYN A;  6GSY A;  4N30 A;  1UVZ A;  4NAX A;  1HD2 A;  4F82 A;  3RPN A;  1ZZY A;  4BVX A;  1GSQ A;  4GF0 A;  2UZ8 A;  1FW1 A;  2HSM A;  3EC3 A;  2YP6 A;  3TKQ A;  5EPF A;  2IMK A;  1FG4 A;  1TRV A;  1KTE A;  4K5R A;  3CRT A;  1PD2 1;  1B4Q A;  2FA4 A;  2PU9 C;  1SJI A;  2FGX A;  2P5R A;  4Z2R A;  2DKI A;  1GTU A;  3GST A;  2IPA A;  4TR4 A;  1OYJ A;  3L78 A;  5G1L A;  1K0D A;  2G0F A;  4JRR A;  1XPV A;  4JED A;  1T4Z A;  1T4Y A;  3ZLP A;  4QL7 A;  3FR6 A;  1O85 A;  1GUH A;  4HQS A;  2P31 A;  3QAG A;  2QA2 A;  2YJH A;  5IOW A;  2V6K A;  2VLT A;  3TOT A;  3IA1 A;  2HZE A;  2OA7 A;  3IR4 A;  4Q5R A;  1EOG A;  2MMZ A;  4OFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...