4F9ZA

Crystal structure of human erp27
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
219
structure length
219
Chain Sequence
b'QEPTWLTDVPAAMEFIAATEVAVIGFFQDLEIPAVPILHSMVQKFPGVSFGISTDSEVLTHYNITGNTICLFRLVDNEQLNLEDEDIESIDATKLSRFIEINSLHMVTEYNPVTVIGLFNSVIQIHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVISFFKLKESQLPALAIYQTLDDEWDTLPTAEVSVEHVQNFCDGFLSGK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Endoplasmic reticulum resident protein 27
publication title The Crystal Structure of the Protein-Disulfide Isomerase Family Member ERp27 Provides Insights into Its Substrate Binding Capabilities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 67
structure length 219
sequence length 219
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13848 Thioredoxin_6 Thioredoxin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4f9zA02
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4f9zA01
1G6YA 6GSTA 4KW6A 4TR1A 2LUSA 3A5WA 3VWVA 3HD5A 1YF1A 4MDCA 4YAVA 1TKDB 3I69A 2VL2C 5FWGA 3WD6A 2YANA 2V6OA 4DSSB 3RDWA 2DSAA 3GHAA 1ZGNA 4QL7A 1FAAA 1SKRB 2VD1A 2IN3A 4TXOB 4JEDA 2AHEA 5AIXA 5IMVA 3HJPA 1GTBA 4PNGA 2QSIA 1FW1A 2BMXA 3GX8A 1M9AA 2L4QA 5CAXA 1SJZA 3EU3A 1K0DA 2VCVA 5DALB 2P0GA 4PUAA 1U3IA 1PRXA 2L57A 4MF7A 1PA3A 5ENUA 3KGKA 3LXTA 1ZYQB 1WPIA 1YZXA 1TDIA 5IM9A 4ISDA 2WZ9A 3LWAA 5B7CA 1I5GA 2P31A 2PUKC 1TRVA 2VLTA 2QC7A 3APOA 2B1LA 3GKNA 2L6DA 3WYWA 3UBLA 1U6TA 5J4UA 2VL9A 1GSUA 2NDOA 4HQSA 2YN1A 1EP7A 3L4NA 19GSA 4OCEA 4TRXA 1ABAA 3TJGA 1EZKA 2C0FA 1PX7A 4WETA 3GMFA 4MJCA 1A24A 4LMWA 3QD9A 5DAKA 4DSRA 3EVIA 5HR1A 2MZCA 1OVNA 4MK3A 2V41A 4EVMA 5H5SA 2LJKA 4PGTA 1PL2A 3KMOA 3A2VA 4GLTA 4BWQA 3EE2A 3J7Yk 3LXZA 3FKFA 4YAPA 4MH3A 5JWQB 3DGQA 3M9JA 3FYGA 3C73A 4KCEA 1X9WB 5ECMB 3C8EA 1URMA 1FB0A 5ID2A 5A5KA 4G2EA 1OC9B 2GVPA 3VFIA 3IRAA 3HA9A 3TKSE 4JRRA 2OKAA 5DQSA 3VPTA 1K0MA 1S3CA 2IMIA 1MTCA 2OJLA 4J56E 4ECBA 2FHEA 1OYJA 3TJFA 2XHFA 2HSHA 1XCCA 3VLNA 4IKHA 4Q5FA 2FD3A 1Z3EA 1GWCA 3DMLA 3UL3A 4N0ZA 3FZAA 2CT6A 2DIZA 3WGXA 1FB6A 1T00A 4MJBA 2VM1A 1JZDA 1Z6MA 3F4SA 1SKWB 4ZB9A 1M7TA 1G6WA 2YP6A 3NOFA 4IP1A 4WF5A 1TK5B 3H79A 1LBKA 5G5EA 1K0BA 4KSOA 1ML6A 3CSIA 3UJ1A 4K7OA 3F63A 4F0BA 3M3MA 1PL1A 3UBKA 4O7HA 2XPDA 2VD0A 3HY2A 2JSYA 1OC8A 2LJAA 5EY6A 2LJRA 1OE8A 1A8LA 3L9SA 1USBA 1AQVA 5KN1A 4YQMA 4MZWA 1EOHA 1GP1A 3F4RA 3G7YA 1B9XC 4GSNA 3TJBA 2L5OA 3O3TA 1A2LA 2H8LA 1C72A 1GSQA 4ILFA 3HXSA 5IOWA 3CSJA 3TRPA 2PPTA 3QAVA 2CX3A 2DLXA 3DVXA 4XS4A 3CSHA 3ZVJA 3VI7A 2DBCA 3BCKA 4D73B 2F8AA 1SJ6A 5EVOA 1DSBA 4QQ7A 4ID0A 3F6DA 4MJAA 2H6XA 1HD2A 1XOAA 2FA4A 6GSXA 3A2WA 1AXDA 4Q5NA 2MBSA 2H19A 4LMVA 1TJDA 2JADA 2M80A 1A0FA 3VWXA 1K3LA 1ERWA 2O85A 2M72A 4L8EA 4MMMA 1UN2A 3V1WA 5B6MA 1GL8A 3RHBA 4KE3A 6GSYA 2DJJA 1X9MB 2MMAA 3UIWA 1V57A 3CRUA 3IAS2 2LNTA 2VLVA 2VM2A 2HLSA 1WJKA 1UA5A 2C0GA 2MYGA 1Z9HA 4RI6A 2KHPA 3IE3A 1B8XA 4PX1A 3ERGA 5COHA 2F8FA 2OADA 1MDKA 4V1Ag 2YNXA 3M1GA 6GSSA 4EO3A 5DVBA 3KIJA 2VLUA 4V2NA 1OKTA 1JHBA 1KNGA 4EF0A 1MEKA 4POBA 5ECPB 2RUFA 1GSYA 2YJHA 3LFLA 3ZFLA 1CQGA 2NVLA 5JCGA 3WT2A 2FCHA 4BA7A 1EEJA 2TRCP 3F9UA 3LYPA 4BVYA 3KJYA 3TKRA 1TU8A 2DJ0A 5IPGA 2F9SA 2YPMA 3PGTA 2YOIA 4XS1A 4Z7XA 2FWFA 2XPEA 4IELA 1GTIA 5E4WA 1WOUA 3KTLA 1T4YA 1FO5A 1KEBA 1GULA 3KEBA 5GAND 1T4ZA 3QAWA 2H0GA 3GV1A 4XHMA 5J5NA 3E0UA 4WXTA 3PR8A 2RM5A 5J41A 1YKAA 3ZIJA 5CRWA 5HQPA 2AJQB 5HR3A 4OFNA 2LQOA 1GLPA 2B1KA 3UAPA 4XS6A 3ME7A 1SYXA 2E2MA 1X0RA 3C1SA 1O8XA 3C71A 4JR6A 1F3AA 4ML6A 20GSA 1F2EA 4BL7A 3GUSA 2H1DA 3QMXA 1HNCA 1SU9A 3EYTA 2VOCA 1E6BA 1H4OA 3KP9A 4K1FA 4PQ1A 3GTUB 2NPBA 4KDXA 2KP2A 2HRFA 3D21A 1O8WA 2XC2A 5CYYA 2YWIA 1GSEA 2RLIA 3H93A 1VGLA 4N11A 4TKYA 5JWRB 8GSSA 4K7NA 1A2MA 5B6NA 1SL0B 1BEDA 14GSA 2GS3A 4K9ZA 4DSSA 2FWEA 3CTFA 2R5GA 3MNGA 1AW9A 4CDOA 4JR4A 1NHYA 2H70A 2O89A 1WRYA 2YV9A 3CXGA 1K0OA 4MPFA 5CRGA 2PN8A 4OO4A 3FZ5A 4V1Ap 5ECQB 3TDGA 1GTUA 5F8BA 1GUKA 2I4AA 4I8BA 2QGVA 5J3RA 2H0IA 4ZXGA 1M2DA 1DBYA 4I6XA 1GNWA 2DC5A 2HRNA 2V2GA 4BPYA 2C3NA 3TRQA 3F8UA 1WMJA 2CAQA 1TK0B 3QAGA 13GSA 4MLYA 4J2FA 3QFAC 3W8SA 2BJXA 4FH8A 3ZTLA 2H73A 2LQQA 3H1NA 3F4TA 4NHZA 3LG6A 3HDCA 5JCUA 5D9VA 2C1YA 2HZFA 1A8YA 3E9JB 5AIVA 3R2QA 5IO0A 4O32A 2HYXA 2KOKA 1SK2A 3FZ9A 3TGZA 2YWNA 1JZRA 5B8AA 5E59A 1DE1A 1OAZA 1E2YA 4I2UA 1THXA 2LV3A 3EMPA 4O5RA 5G1KA 4HU9A 1FVJA 5D8IA 2C3TA 4WBRD 3ZVJD 3EU4A 5CO3A 2IIYA 5ECIB 4AJ8A 1T1VA 2DJKA 4G10A 2LRNA 3L9VA 3GRXA 4ECIA 4AF2A 3GKKA 5ECLB 2HNLA 4K0NA 2B5XA 4WEYA 1B48A 2GSQA 3S9FA 5G30A 3EC3A 4GQFA 2C80A 2E7PA 3D22A 3Q18A 4HEA2 2HZEA 1F6MC 1OC9A 1O85A 2MMNA 1J08A 4HJMA 2WRTA 2I81A 1B4PA 1EGOA 1AQWA 5D9TA 2D2ZA 5F05A 1G7OA 2E0QA 1EGRA 1QQ2A 3ME8A 1X5DA 2PBJA 3KZQA 4KSMA 1R5PA 3RHCA 2O8VB 3IV4A 4LL1B 1K0CA 3DWVA 2H71A 2V1MA 3QPMA 3LYKA 2L4CA 2LSTA 1M0UA 3TOUA 2FUG2 3ISOA 4ZL7A 1OE7A 2HFDA 1GUHA 2Z9SA 1QXHA 1ST9A 5IOXA 4PQIA 2G0FA 1ZCPA 3O6TA 1UVZA 2PU9C 3VI5A 1ZZYA 22GSA 3NIVA 2ON5A 1GRXA 3EMXA 1YQ1A 2DMLA 5DBQA 1QGVA 1JFUA 3I9V2 5LD0A 1TI1A 2YZHA 5J9CA 5D9XA 1MDIA 1VF4A 1GSSA 3D6IA 1ERVA 1BX9A 1O73A 3C7MA 5AN1A 3UARA 3F3QA 3TKSA 4K6XA 2CA8A 1VF1A 4JE1A 4EDZA 2H1GA 2QKEA 4OD7A 2H6YA 2O7KA 1V2AA 1J9BA 3IK7A 3IA1A 1LU4A 3TCOA 4D73A 3HKRA 2I9HA 4WR5A 1S3AA 1ZL9A 2H76A 4DEJA 12GSA 1NW2A 1JZOA 5IMFA 3TKPA 3DYRA 2C0DA 3LORA 4DVCA 1TTZA 5ECHB 2REMA 3FY7A 3SWLA 3ZMKA 5DJMA 3ERWA 1TI3A 5LCZA 3CRTA 1XW9A 5D93A 1KBNA 4HDEA 1BYEA 4ZIJA 3UVTA 3FEUA 4GF0A 2N5FA 1K0NA 4KDUA 3FRCA 3GNJA 4MP4A 2L6CA 4TXVA 2PGTA 2WDUA 1B9YC 2VL2A 2NBSA 4FIWA 2HXKA 4TR3A 2LKUA 2B3SA 4KGIA 4EUYA 3L9UA 4IP6A 4ZL9A 2JZSA 4X43A 3KH7A 3U5RE 1SYRA 2AAWA 3TB2A 1XVWA 4K7IA 3ED3A 2JACA 1GNEA 5G1LA 4KDYA 3GX0A 5AISA 1N8JA 4DSQA 3IC4A 3CBUA 2JZTA 1M9BA 2M46A 5IPHA 4N30A 2ON7A 1YDKA 2IPAA 2WS2A 4ULXA 1UC7A 5ID2B 2FWHA 2R3XA 2K8SA 2P5QA 1SENA 1OC3A 3ZIVA 4F82A 3ZYWA 4FO5A 2IFQA 2LTKA 4IQ1A 3EINA 2HI7A 4EL1A 2X8GA 2EIOA 1PMTA 1YKCA 2VAFA 4TN8A 3CYNA 1F9MA 5DCGA 2CVKA 2H75A 3HZ8A 4KX4A 4WKWA 1XIYA 4POMA 1T8EB 1HYUA 2E2GA 2JU5A 9GSSA 1ILOA 1X5EA 3GFKA 2CZ3A 3TRXA 1ZMAA 5ABRA 3HCZA 2PMTA 4MF5A 3P8WA 5AGYA 3HVXA 2K8VA 3FR3A 2OA7A 2H30A 1PX6A 2HSYA 1BQ7A 2CX4A 3D4MA 3C1RA 4MF6A 2H1AA 3M9KA 16GSA 2GT6A 5FT3A 2YV7A 4OCFA 2RUEA 1U87A 1PSQA 1PD21 5KN3A 3QFBC 3ZL5A 1DE2A 2VCXA 1YEPA 2AYTA 1H75A 1AIUA 2XBIA 3G7IA 4GSSA 3QDNA 1S3DA 1XWCA 2DIYA 1TK8B 4FYUA 1O6JA 4JZQA 4XIHA 4ZL8A 3FK8A 1F37A 2VUPA 4MH2A 4HU7A 2WJUA 4IJ3A 1K3OA 1MD4A 1XWKA 1TP9A 1B4QA 4GRFA 5DQYA 4CHSA 1MD3A 1MDJA 3F0IA 3J7Yb 3FW2A 3A3TA 4IHUA 4F2IA 3GYKA 5HFGA 2OE1A 2TIRA 3LQ7A 1NSWA 3QOUA 1TU7A 3LEFA 1V9WA 3GH6A 2GSSA 4X1UA 2G2QA 3VWWA 3WGDA 2CVDA 3I6AA 2IWTA 1V58A 4MZBA 4NV2A 1XWGA 2GQLA 3P90A 4ZBAA 2FGXA 1QMVA 1RW1A 1TRUA 3TUEA 2X8CA 2MMZA 2C4JA 4YH2A 5ECRB 2OACA 4E8EA 1XOBA 2B7JA 2C0EA 1XVQA 3D0ZA 4OMVA 2ES7A 4RQXA 4IQAA 5ECNB 2VCZA 4N10A 1GUMA 3GKMA 4TVEA 4V2LA 1ACVA 18GSA 2VCTA 1NHOA 2FY6A 4AJ6A 3DEXA 4HZ4A 4RUVA 4QL9A 4JU5A 1ZYEA 2H01A 1T3BA 3RPNA 2R37A 1U3AA 4TXOA 3IDVA 2KP1A 2CV4A 3MAKA 4AGSA 3UVHA 3HVVA 4KNDA 3FR6A 3TKQA 4MPGA 2L59A 4HUAA 4XRDA 2YCDA 5DALA 3GA4A 3GSSA 4NWYA 2J9HA 5IMCA 1RQMA 2L5LA 2R2JA 5J9BA 2I1UA 4L0WA 5CNWA 2ZNMA 2A2RA 3EWLA 3RAZA 2IL3A 2H66A 2WCIA 1SKSB 4EC0A 4ECCA 2HE3A 4HS1A 1XWBA 5HFIA 3IOSA 3N5OA 1HNAA 2KUCA 3IBHA 5ELGA 4WF4A 1TOFA 4KA0A 5IMAA 5IO2A 1XW6A 5DJLA 3FZ4A 1GSDA 2EIQA 3GURA 5KN2A 1EEMA 5D73A 2X8HA 5G5FA 3ZZXA 1T7PB 5DCHA 1A2JA 2OBIA 1R5AA 3BD2A 1A0RP 1BJXA 5IQYA 2A4VA 4OWYA 2DJ3A 3IK9A 2N5AA 3HZ4A 3IPZA 2PVOC 3GKXA 2LNSA 4HOJA 3N9JA 2H0HA 3DXBA 1GTAA 2OE3A 3VWUA 4TR0A 4F9ZA 4IJIA 3F6FA 3LGCA 1Q4JA 3D5JA 1G0TA 5D9WA 1XXUA 4EE0A 3AY8A 2V32A 1VF2A 2AB6A 5CRHA 4MJEA 4P3YB 3G9BA 2WGRA 1SK1A 4BWSA 2OBKA 1GLQA 4FYCA 2H72A 3DKSA 2PERA 3GIXA 2X64A 1Z5YE 1EV4A 1K3YA 1V40A 5HR2A 4XCSA 1WIKA 1OKDA 2IMEA 4JBBA 2RM6A 5INYA 1XZOA 1G7EA 4BVXA 4GWRA 4WBJA 2NTOA 2EC4A 3BBYA 3FR9A 3ZLPA 2O87A 1JZWA 2RIIA 2R6KA 1V98A 2OE0A 1FVKA 2TRXA 2DMMA 3IR4A 1TRSA 1I9DA 4OFTA 5JWOB 3GN3A 3VK9A 4OO5A 4PQHA 3QCPA 1DUGA 2PWJA 4TR1B 2GSTA 3VURA 3OR5A 1PKWA 2FLSA 2GDRA 4EDYA 4ZB6A 4G19A 4GTUA 1XBSA 1GH2A 4GSTA 2AV4A 4RI7A 1WWJA 2MBTA 1Z7RA 2F3MA 2FWGA 4FYBA 3HHVA 1IYIA 3DRNA 4TW5A 3ZREA 3MWHA 11GSA 4ML1A 4IBPA 5ECKB 2IMFA 2ZCTA 2HZEB 5EL8A 3HJMA 3Q74A 4YQVA 5CREA 2PVQA 5B8BA 2LS5A 1PQNA 1QK8A 2H74A 1AAZA 2K6VA 1PKZA 3UOMA 3KD0A 4XTSA 2WULA 3IAM2 1M99A 2LRTA 1W4VA 4EKZA 4PURA 3KH9A 4HQZA 3G7JA 4NV5A 1JLWA 2LEGA 3I43A 4L0UA 3DD3A 3FHKA 3UEMA 1CQHA 2GZYA 2K9FA 5IMDA 3KMNA 1AC1A 4EXJA 2VL3A 5KN0A 4OFMA 4MZCA 3ZRDA 3D4TA 1QFNA 3W6GA 1SD9A 4K0GA 4RQRA 5DAKB 4NAXA 2GLRA 3DIEA 5GZZB 3SBCA 5G2ZA 3APQA 3Q19A 2H1BA 5FHIA 4GQCA 5GSSA 1O7UA 1N2AA 1PN9A 1VRSD 3P2AA 2YWMA 7GSSA 4IS0A 4ZBBA 5D96A 2VCWA 2JL4A 2C8UA 3APSA 1HQOA 5EPFA 3U6VA 5DDLA 3IHQA 1Z7PA 5GAPD 1FG4A 3A2XA 1XWAA 1M2BA 2B6MA 5H5QA 3KCMA 4ACSA 3RBTA 4I97A 1QUWA 5IIZA 5C04A 3F3RA 4PNFA 1NM3A 1X5CA 2GTUA 1KTEA 3H4KA 3HYPA 4H86A 4I5QA 1ERTA 4GXZA 2WFCA 3BCIA 3PH9A 2X99A 3RPPA 3ZFBA 2GGTA 2IMDA 2J23A 3CMIA 5F06A 2BTOT 5F0GA 4TOPA 4NMUA 1ON4A 4V2MA 2KLXA 1J0FA 1IYHA 3CTGA 4F0CA 3ERFA 4Q5RA 4MABA 3DVWA 2VO4A 4J57E 4K2DA 5IMZA 3M0FA 4POLA 3ZMLA 2DJ1A 3TJJA 2V6KA 3GTUA 3GH9A 2GSRA 2LRCA 2R4VA 3H8QA 1VF3A 2K18A 4NHWA 4ZB8A 1YF0A 4KAEA 3US3A 3L78A 2B7KA 4PUFC 3E3EA 3EURA 3HVSA 3WGEA 4IGJA 3GL3A 3GL5A 2WB9A 1R7HA 2VCQA 6GSUA 4GCIA 3PINA 4NXIA 4ECJA 2GZPA 4XS4B 4MCUA 2HT9A 2CAIA 4IN0A 5A4VA 5C00A 2FA8A 2YJ7A 2C3QA 4L5LA 4K8MA 4PXOA 1AUCA 1A23A 1ZOFA 4N0VA 1YY7A 3KM6A 1SL2B 4LL4B 4XRAA 1TXXA 4KH7A 2N5BA 5JCWA 3TJKA 4G9HA 2FNOA 1U88A 2IFQB 2VIMA 4E8HA 1GSFA 5HFKA 1EP8A 3GSTA 5ECSA 1BG5A 5ELAA 5GSTA 4ZBDA 2GQMA 6GSVA 5ECOB 1M2AA 4IVFA 1WE0A 4O92A 3TOTA 5LNKe 2YWOA 1YEXA 4L5OA 3NZNA 2IMKA 2XBQA 1THOA 2GZZA 5L71A 2ZUPA 1Z6NA 4HI7A 2H6ZA 3UMAA 1SJIA 3MDKA 2A2SA 1FOVA 3KP8A 4YQUA 3ZITA 4MA9A 10GSA 4HZ2A 4Q5QA 1Y6EA 1BAYA 3KXOA 3LJRA 2F51A 3HJOA 3W8JA 1R4WA 1FHEA 4KCAA 2GQKA 1XPVA 1JLVA 3BOAA 1Q98A 3VPQA 2CQ9A 5CP1A 3K8NA 1EV9A 4AJ7A 1K0AA 5A4WA 5CRDA 1EOGA 4WR4A 4ZILA 2JSZA 3MSZA 3P7XA 1XW5A 3BJ5A 1WP0A 1RK4A 1TW9A 1AQXA 1ERUA 1HNBA 2P5RA 2CVBA 17GSA 3L0HA 4IW9A 3KTBA 3TKSC 3O76A 1EWXA 1O81A 5G31A 1SK0A 3Q6OA 2CZ2A 2IJYA 4F03A 5A4UA 4KB3A 1TRWA 3WT1A 2GT5A 1LJRA 1W89A 1X9SB 1SD8A 1F3BA 5H5RA 4LLRA 2B5YA 2JZRA 5HR0A 3JCML 4HJ2A 1SL1B 4TR4A 1XFLA 2AUVA 3IXRA 2B5EA 1PGTA 4POKA 5F07A 4CW9A 4NPBA 2YZUA 1YJ6A 3M8NA 2DJ2A 5KEJA 2EIRA 3LSZA 3QR6A 1R26A 2ALBA 1Y25A 4LA1A 4X0XA 4I2TA 6GSWA 2I3YA 2MMOA 4KUNA
chains in the Genus database with same CATH superfamily
1G6YA 6GSTA 4KW6A 4TR1A 2LUSA 3A5WA 3VWVA 3HD5A 1YF1A 4MDCA 4YAVA 1TKDB 3I69A 2VL2C 5FWGA 3WD6A 2YANA 2V6OA 4DSSB 3RDWA 2DSAA 3GHAA 2X49A 1ZGNA 4QL7A 1FAAA 1SKRB 2VD1A 2IN3A 4TXOB 4JEDA 2AHEA 5AIXA 5IMVA 3HJPA 1GTBA 4PNGA 2QSIA 1FW1A 2BMXA 3GX8A 1M9AA 2L4QA 5CAXA 1SJZA 3EU3A 1K0DA 2VCVA 5DALB 2P0GA 4PUAA 1U3IA 1PRXA 2L57A 4MF7A 1PA3A 5ENUA 3KGKA 3LXTA 1ZYQB 1WPIA 1YZXA 1TDIA 5IM9A 4ISDA 2WZ9A 3LWAA 5B7CA 1I5GA 2P31A 2PUKC 1TRVA 2VLTA 2QC7A 3APOA 2B1LA 3GKNA 2L6DA 3WYWA 3UBLA 1U6TA 5J4UA 2VL9A 1GSUA 2NDOA 4HQSA 2YN1A 1EP7A 3L4NA 19GSA 4CY6A 4OCEA 4TRXA 1ABAA 3TJGA 1EZKA 2C0FA 4O5UA 1PX7A 4WETA 3GMFA 5BMUA 4MJCA 4X4JA 1A24A 4LMWA 4KF9A 3QD9A 5DAKA 4DSRA 3EVIA 5HR1A 2MZCA 1OVNA 4MK3A 2V41A 4EVMA 5H5SA 2LJKA 4PGTA 1PL2A 3KMOA 3A2VA 4GLTA 4BWQA 3EE2A 3J7Yk 3LXZA 3FKFA 4YAPA 4MH3A 5JWQB 3DGQA 3M9JA 3FYGA 3C73A 4KCEA 1X9WB 5ECMB 3C8EA 1URMA 1FB0A 5ID2A 5A5KA 4G2EA 1OC9B 2GVPA 3VFIA 3IRAA 3HA9A 3TKSE 4USSA 4JRRA 2OKAA 5DQSA 3VPTA 1K0MA 1S3CA 2IMIA 1MTCA 2OJLA 4J56E 4ECBA 2FHEA 1OYJA 3TJFA 2XHFA 2HSHA 1XCCA 3VLNA 4IKHA 4Q5FA 2FD3A 1Z3EA 1GWCA 3DMLA 3UL3A 4N0ZA 1PFOA 3FZAA 2CT6A 2DIZA 3WGXA 1FB6A 1T00A 4MJBA 2VM1A 1JZDA 1Z6MA 3F4SA 1SKWB 4ZB9A 4BVXB 1M7TA 1G6WA 2YP6A 3NOFA 4IP1A 4WF5A 1TK5B 3H79A 1LBKA 5G5EA 1K0BA 4KSOA 1ML6A 3CSIA 3UJ1A 4K7OA 3F63A 4F0BA 3M3MA 1PL1A 3UBKA 4O7HA 2XPDA 2VD0A 3HY2A 2JSYA 1OC8A 2LJAA 2LJRA 1OE8A 1A8LA 3L9SA 5EY6A 1USBA 1AQVA 5KN1A 4YQMA 4MZWA 1EOHA 1GP1A 3F4RA 3G7YA 1B9XC 3MYDA 4GSNA 3TJBA 2L5OA 3O3TA 1A2LA 2H8LA 1C72A 1GSQA 4ILFA 3HXSA 5IOWA 3CSJA 3TRPA 2PPTA 3QAVA 2CX3A 2DLXA 3DVXA 1S3RA 1M3JA 4XS4A 3CSHA 3ZVJA 3VI7A 2DBCA 3BCKA 4D73B 4G0KA 2F8AA 1SJ6A 5EVOA 1DSBA 4QQ7A 4ID0A 3F6DA 4MJAA 2H6XA 1HD2A 1XOAA 2FA4A 6GSXA 3A2WA 1AXDA 4Q5NA 2MBSA 2H19A 4LMVA 1TJDA 2JADA 2M80A 1A0FA 3VWXA 1K3LA 1ERWA 2O85A 2M72A 4L8EA 4MMMA 1UN2A 3V1WA 5B6MA 4FQUA 1GL8A 3RHBA 4KE3A 6GSYA 4Z2RA 3R3EA 2DJJA 1X9MB 2MMAA 3UIWA 1V57A 3CRUA 3IAS2 2LNTA 2VLVA 2VM2A 2HLSA 1WJKA 1UA5A 2C0GA 2MYGA 1Z9HA 4RI6A 2KHPA 3IE3A 1B8XA 4PX1A 3ERGA 5COHA 2F8FA 2OADA 1MDKA 4V1Ag 2YNXA 3M1GA 6GSSA 4EO3A 5DVBA 3KIJA 2VLUA 4V2NA 1OKTA 1JHBA 1KNGA 4EF0A 1MEKA 4POBA 5ECPB 2A2PA 2QA2A 2RUFA 1GSYA 2YJHA 3LFLA 3ZFLA 1CQGA 2NVLA 5JCGA 3WT2A 2FCHA 4BA7A 1EEJA 2TRCP 3F9UA 3LYPA 4BVYA 3KJYA 3TKRA 1TU8A 2DJ0A 5IPGA 4MNNA 2F9SA 2YPMA 3IHGA 3PGTA 2YOIA 4XS1A 4Z7XA 2FWFA 2XPEA 4IELA 1GTIA 5E4WA 1WOUA 3KTLA 2HSMA 1T4YA 1FO5A 1KEBA 1GULA 3KEBA 5GAND 1T4ZA 3QAWA 2H0GA 3GV1A 4XHMA 5J5NA 3E0UA 4WXTA 3PR8A 2RM5A 5J41A 1YKAA 3ZIJA 5CRWA 5HQPA 2AJQB 5HR3A 4OFNA 2LQOA 1GLPA 2B1KA 3UAPA 4XS6A 3ME7A 1SYXA 4EIQA 2E2MA 1X0RA 3C1SA 1O8XA 4CY8A 3C71A 4JR6A 1F3AA 4ML6A 20GSA 2DKIA 1F2EA 4BL7A 3GUSA 2H1DA 3QMXA 1HNCA 1SU9A 3EYTA 2VOCA 1E6BA 1H4OA 3KP9A 4K1FA 4PQ1A 3GTUB 2NPBA 2A4HA 4KDXA 2KP2A 2HRFA 3D21A 1O8WA 2XC2A 5CYYA 2YWIA 1GSEA 2RLIA 3H93A 1VGLA 4N11A 4TKYA 5JWRB 8GSSA 4K7NA 1A2MA 5B6NA 1SL0B 1BEDA 14GSA 2GS3A 4K9ZA 4DSSA 2FWEA 3CTFA 2R5GA 3MNGA 1AW9A 3A5IA 4CDOA 4JR4A 1NHYA 2H70A 2O89A 1WRYA 2YV9A 3CXGA 1K0OA 4MPFA 5CRGA 2PN8A 4OO4A 3FZ5A 4V1Ap 5ECQB 3TDGA 1GTUA 4K2XA 5F8BA 1GUKA 2I4AA 4I8BA 2QGVA 5J3RA 2H0IA 4ZXGA 1M2DA 1DBYA 4I6XA 1GNWA 2DC5A 2HRNA 2V2GA 4BPYA 2C3NA 3TRQA 3F8UA 1WMJA 2CAQA 1TK0B 3QAGA 13GSA 4MLYA 4J2FA 3QFAC 3W8SA 2BJXA 4FH8A 3ZTLA 2H73A 2LQQA 3H1NA 3F4TA 4NHZA 3LG6A 3HDCA 5JCUA 5D9VA 2C1YA 2HZFA 1A8YA 3E9JB 5AIVA 3R2QA 5IO0A 4O32A 2HYXA 2KOKA 1SK2A 3FZ9A 3TGZA 2YWNA 1JZRA 5B8AA 5E59A 1DE1A 1OAZA 1E2YA 4I2UA 1THXA 2LV3A 3EMPA 4O5RA 5G1KA 4HU9A 1FVJA 5D8IA 2C3TA 4WBRD 3ZVJD 3EU4A 5CO3A 2IIYA 5ECIB 4AJ8A 1T1VA 2DJKA 4G10A 2LRNA 3L9VA 3GRXA 4ECIA 4AF2A 3GKKA 5ECLB 2HNLA 4K0NA 2B5XA 4WEYA 1B48A 2GSQA 3S9FA 5G30A 3EC3A 4GQFA 2C80A 2E7PA 3D22A 3Q18A 4HEA2 2HZEA 1F6MC 1OC9A 1O85A 2MMNA 1J08A 4HJMA 2WRTA 2I81A 1B4PA 1EGOA 1AQWA 5D9TA 2D2ZA 5F05A 1G7OA 2E0QA 1EGRA 1QQ2A 3ME8A 2HRKA 1X5DA 2PBJA 3KZQA 4KSMA 1R5PA 3RHCA 2O8VB 3IV4A 4LL1B 1K0CA 3DWVA 2H71A 2V1MA 3QPMA 3LYKA 2L4CA 2LSTA 1M0UA 3TOUA 2FUG2 3ISOA 4ZL7A 1OE7A 2HFDA 1GUHA 2Z9SA 1QXHA 1ST9A 5IOXA 4PQIA 2G0FA 1ZCPA 3O6TA 1UVZA 2PU9C 3VI5A 1ZZYA 22GSA 3NIVA 2ON5A 1GRXA 3EMXA 1YQ1A 2DMLA 5DBQA 1QGVA 1JFUA 3I9V2 5LD0A 1TI1A 2YZHA 5J9CA 5D9XA 1MDIA 1VF4A 1GSSA 3D6IA 1ERVA 1BX9A 1O73A 3C7MA 5AN1A 3UARA 3F3QA 3TKSA 4K6XA 2CA8A 1VF1A 4JE1A 4EDZA 2H1GA 2QKEA 4OD7A 2H6YA 2O7KA 1V2AA 1J9BA 3IK7A 3IA1A 1LU4A 3TCOA 4D73A 3HKRA 2I9HA 4WR5A 1S3AA 1ZL9A 2H76A 4DEJA 12GSA 1NW2A 1JZOA 5IMFA 3TKPA 3DYRA 2C0DA 3LORA 4DVCA 1TTZA 5ECHB 2REMA 3FY7A 3SWLA 3ZMKA 5DJMA 3ERWA 1TI3A 5LCZA 3CRTA 1XW9A 5D93A 1KBNA 4PTSA 4HDEA 1BYEA 4ZIJA 3CQFA 3UVTA 3FEUA 4GF0A 2N5FA 1K0NA 4KDUA 3FRCA 3GNJA 4MP4A 1M3IA 2L6CA 4TXVA 2PGTA 2WDUA 1B9YC 2VL2A 2NBSA 4FIWA 2HXKA 4TR3A 2LKUA 2B3SA 4KGIA 4EUYA 3L9UA 4IP6A 4ZL9A 2JZSA 4X43A 3KH7A 3U5RE 1SYRA 2AAWA 3TB2A 1XVWA 4K7IA 3ED3A 2JACA 1GNEA 5G1LA 4KDYA 3GX0A 5AISA 1N8JA 4DSQA 3IC4A 3CBUA 2JZTA 1M9BA 2M46A 5IPHA 4N30A 2ON7A 1YDKA 2IPAA 2WS2A 4ULXA 1UC7A 5ID2B 2FWHA 2R3XA 2K8SA 2P5QA 1SENA 4ICYA 1OC3A 3ZIVA 4F82A 3ZYWA 4FO5A 2IFQA 2LTKA 4IQ1A 3EINA 2HI7A 4EL1A 2X8GA 2EIOA 1PMTA 1YKCA 2VAFA 4TN8A 3CYNA 1F9MA 5DCGA 2CVKA 2H75A 4HSCX 3HZ8A 4WKWA 4KX4A 1XIYA 4POMA 1T8EB 1HYUA 2E2GA 2JU5A 9GSSA 3MIXA 1X5EA 1ILOA 3GFKA 2CZ3A 3TRXA 1ZMAA 5ABRA 3HCZA 2PMTA 4MF5A 3P8WA 5AGYA 3HVXA 2K8VA 3FR3A 2OA7A 2H30A 1PX6A 2HSYA 1BQ7A 2CX4A 3D4MA 3C1RA 4MF6A 2H1AA 3M9KA 16GSA 2GT6A 5BRTA 5FT3A 2YV7A 4OCFA 3IC8A 2RUEA 1U87A 1PSQA 1PD21 5KN3A 3QFBC 3ZL5A 1DE2A 2VCXA 1YEPA 2AYTA 1H75A 1AIUA 2XBIA 3G7IA 4GSSA 3QDNA 1S3DA 4YKFA 1XWCA 2DIYA 1TK8B 4FYUA 1O6JA 4JZQA 4XIHA 4ZL8A 3FK8A 1F37A 2VUPA 4MH2A 4HU7A 2WJUA 4IJ3A 1K3OA 1MD4A 1XWKA 1TP9A 1B4QA 4GRFA 5DQYA 4CHSA 1MD3A 1MDJA 3F0IA 3J7Yb 3FW2A 3A3TA 4IHUA 4F2IA 3GYKA 5HFGA 2OE1A 2TIRA 3LQ7A 1NSWA 3QOUA 1TU7A 3LEFA 1V9WA 3GH6A 2GSSA 4X1UA 2G2QA 3VWWA 3WGDA 2CVDA 3I6AA 2IWTA 1V58A 4MZBA 4NV2A 1XWGA 2GQLA 3P90A 4ZBAA 2FGXA 1QMVA 1RW1A 1TRUA 3TUEA 2X8CA 2MMZA 2C4JA 4YH2A 5ECRB 2OACA 4E8EA 1XOBA 2B7JA 2C0EA 1XVQA 3D0ZA 2QA1A 4OMVA 2ES7A 4RQXA 4IQAA 5ECNB 2VCZA 4N10A 1GUMA 3GKMA 4TVEA 4V2LA 1ACVA 18GSA 1FOHA 2VCTA 2X4AA 1NHOA 2FY6A 4AJ6A 3DEXA 4HZ4A 4RUVA 4QL9A 4JU5A 4BVYB 1ZYEA 2H01A 1T3BA 3RPNA 2R37A 1U3AA 4TXOA 3IDVA 2KP1A 2CV4A 3MAKA 4AGSA 3UVHA 3HVVA 4KNDA 3FR6A 3TKQA 4MPGA 2L59A 4HUAA 4XRDA 2YCDA 5DALA 3GA4A 3GSSA 4NWYA 2J9HA 5IMCA 1RQMA 2L5LA 2R2JA 5J9BA 2I1UA 4L0WA 5CNWA 2ZNMA 2A2RA 3EWLA 3RAZA 2IL3A 2H66A 2WCIA 1SKSB 4EC0A 4ECCA 2HE3A 4HS1A 1XWBA 5HFIA 3IOSA 3N5OA 1HNAA 2KUCA 3IBHA 5ELGA 4WF4A 1TOFA 4KA0A 5IMAA 5IO2A 1PN0A 1XW6A 5DJLA 3FZ4A 1GSDA 2EIQA 2DKHA 3GURA 5KN2A 1EEMA 5D73A 5KOXA 2X8HA 5G5FA 3ZZXA 4BL7B 1T7PB 5DCHA 1A2JA 2OBIA 1R5AA 3BD2A 1A0RP 1BJXA 5IQYA 2A4VA 4OWYA 2DJ3A 3IK9A 2N5AA 3HZ4A 3IPZA 2PVOC 3GKXA 2LNSA 4HOJA 3N9JA 2H0HA 3DXBA 1GTAA 2OE3A 3VWUA 4TR0A 4F9ZA 4IJIA 3F6FA 3LGCA 1Q4JA 3D5JA 1G0TA 5D9WA 1XXUA 4EE0A 3AY8A 2V32A 1VF2A 2AB6A 5CRHA 3FMWA 4MJEA 4P3YB 3G9BA 2WGRA 1SK1A 4BWSA 2OBKA 1GLQA 2HRAA 4FYCA 2H72A 3DKSA 2PERA 3GIXA 2X64A 1Z5YE 1EV4A 1K3YA 1V40A 5HR2A 4XCSA 3EPTA 1WIKA 1OKDA 2IMEA 4JBBA 2RM6A 5INYA 1XZOA 1G7EA 4BVXA 4GWRA 4WBJA 2NTOA 2EC4A 3BBYA 3FR9A 3ZLPA 2O87A 1JZWA 2RIIA 2R6KA 1V98A 2OE0A 1FVKA 2TRXA 2DMMA 3IR4A 1TRSA 1I9DA 4OFTA 5JWOB 3GN3A 3VK9A 4OO5A 4PQHA 3QCPA 1DUGA 2PWJA 4TR1B 2GSTA 3VURA 3OR5A 1PKWA 2FLSA 2GDRA 4EDYA 4ZB6A 4G19A 4GTUA 1XBSA 1GH2A 4GSTA 2AV4A 4RI7A 1WWJA 2MBTA 5KOWA 1Z7RA 2F3MA 2FWGA 4FYBA 3HHVA 4K5SA 1IYIA 3DRNA 4TW5A 3ZREA 3MWHA 11GSA 4ML1A 4IBPA 5ECKB 2IMFA 2ZCTA 2HZEB 5EL8A 3HJMA 3Q74A 4YQVA 5CREA 2PVQA 5B8BA 2LS5A 1PQNA 1QK8A 2H74A 1AAZA 2K6VA 1PKZA 3UOMA 3KD0A 4XTSA 2WULA 3IAM2 1M99A 2LRTA 1W4VA 4EKZA 4PURA 3KH9A 4HQZA 3G7JA 4NV5A 1JLWA 2LEGA 3I43A 4L0UA 3DD3A 3FHKA 3UEMA 1CQHA 2GZYA 2K9FA 5IMDA 3KMNA 1AC1A 4EXJA 2UZ8A 2VL3A 5KN0A 4OFMA 4MZCA 3ZRDA 3D4TA 1QFNA 3W6GA 1SD9A 4K0GA 4RQRA 5DAKB 4NAXA 2GLRA 3DIEA 5GZZB 3SBCA 5G2ZA 3APQA 3Q19A 2H1BA 5FHIA 4GQCA 5GSSA 1O7UA 1N2AA 1PN9A 1VRSD 3P2AA 2YWMA 4G0LA 7GSSA 4IS0A 4ZBBA 5D96A 2VCWA 2JL4A 2C8UA 3APSA 1HQOA 5EPFA 3HVNA 3U6VA 5DDLA 3IHQA 1Z7PA 5GAPD 1FG4A 3A2XA 1XWAA 1M2BA 2B6MA 5H5QA 3KCMA 4ACSA 3RBTA 4I97A 1QUWA 5IIZA 5C04A 1XG8A 3F3RA 4O5QA 4PNFA 1NM3A 1X5CA 2GTUA 1KTEA 3H4KA 3HYPA 4H86A 4I5QA 1ERTA 4GXZA 2WFCA 3BCIA 3PH9A 2X99A 3PPUA 3RPPA 3ZFBA 2GGTA 2IMDA 2J23A 3CMIA 5F06A 2BTOT 5F0GA 4TOPA 4NMUA 1ON4A 4Z2TA 4V2MA 2KLXA 1J0FA 1IYHA 3CTGA 4F0CA 3ERFA 4Q5RA 4MABA 3DVWA 2VO4A 4J57E 4K2DA 5IMZA 3M0FA 4POLA 3ZMLA 2DJ1A 3TJJA 2V6KA 3GTUA 3GH9A 2GSRA 2LRCA 2R4VA 3H8QA 1VF3A 2K18A 4NHWA 4ZB8A 1YF0A 4YKGA 4KAEA 3US3A 3L78A 2B7KA 4PUFC 3E3EA 3EURA 3HVSA 3WGEA 4IGJA 3GL3A 3GL5A 2WB9A 1R7HA 2VCQA 6GSUA 4GCIA 3PINA 4NXIA 4ECJA 2GZPA 4XS4B 4MCUA 2HT9A 2CAIA 4IN0A 5A4VA 5C00A 2FA8A 2YJ7A 2C3QA 4L5LA 4K8MA 4PXOA 1AUCA 1A23A 1ZOFA 4N0VA 1YY7A 3KM6A 1SL2B 4BIKA 4EIPA 4LL4B 4XRAA 1TXXA 4KH7A 2N5BA 5JCWA 3TJKA 4G9HA 2FNOA 4A5PA 1U88A 1ZYNA 2IFQB 2VIMA 4E8HA 1GSFA 5HFKA 1EP8A 3GSTA 5ECSA 1BG5A 5ELAA 5GSTA 4ZBDA 2GQMA 6GSVA 5ECOB 1M2AA 4IVFA 1WE0A 4O92A 3TOTA 5LNKe 2YWOA 1YEXA 4L5OA 3NZNA 2IMKA 2XBQA 1THOA 2GZZA 5L71A 4G0IA 2ZUPA 4K5RA 1Z6NA 4HI7A 2H6ZA 3UMAA 1SJIA 3MDKA 2A2SA 1FOVA 3KP8A 4YQUA 3ZITA 4MA9A 10GSA 4HZ2A 4Q5QA 1Y6EA 1BAYA 3KXOA 3LJRA 4Z2UA 2F51A 3HJOA 3W8JA 1R4WA 1FHEA 4KCAA 2GQKA 1XPVA 1JLVA 3BOAA 1Q98A 3VPQA 2CQ9A 5CP1A 3K8NA 1EV9A 4AJ7A 1K0AA 5A4WA 5CRDA 1EOGA 4WR4A 4ZILA 2JSZA 3LW9A 3MSZA 2R0CA 3P7XA 1XW5A 3BJ5A 1WP0A 1RK4A 2R0GA 1TW9A 1AQXA 1ERUA 1HNBA 2P5RA 2CVBA 17GSA 3L0HA 1ZYPA 4IW9A 3KTBA 3TKSC 3O76A 1EWXA 1O81A 5G31A 1SK0A 3Q6OA 2CZ2A 2IJYA 4F03A 5A4UA 4KB3A 1TRWA 3WT1A 2GT5A 1LJRA 1W89A 1X9SB 1SD8A 1F3BA 5H5RA 4LLRA 2B5YA 2JZRA 5HR0A 3JCML 4HJ2A 1SL1B 4TR4A 1XFLA 2AUVA 3IXRA 2R0PA 2B5EA 1PGTA 4POKA 5F07A 4CW9A 4NPBA 2YZUA 1YJ6A 3M8NA 2DJ2A 5KEJA 2EIRA 3LSZA 3QR6A 1R26A 2ALBA 1Y25A 4LA1A 4X0XA 4I2TA 6GSWA 2I3YA 2MMOA 4KUNA
chains in the Genus database with same CATH topology
1G6YA 6GSTA 4KW6A 4TR1A 2LUSA 3A5WA 3VWVA 3HD5A 1YF1A 4MDCA 4YAVA 1TKDB 3I69A 2VL2C 5FWGA 3WD6A 2YANA 2V6OA 4DSSB 3RDWA 2DSAA 3GHAA 2X49A 1ZGNA 4QL7A 1FAAA 1SKRB 2VD1A 2IN3A 4TXOB 4JEDA 2AHEA 5AIXA 5IMVA 3HJPA 1GTBA 4PNGA 2QSIA 1FW1A 2BMXA 3GX8A 1M9AA 2L4QA 5CAXA 1SJZA 3EU3A 1K0DA 2VCVA 5DALB 2P0GA 4PUAA 1U3IA 1PRXA 2L57A 4MF7A 1PA3A 5ENUA 3KGKA 3LXTA 1ZYQB 1WPIA 1YZXA 1TDIA 5IM9A 4ISDA 2WZ9A 3LWAA 5B7CA 1I5GA 2P31A 2PUKC 1TRVA 2VLTA 2QC7A 3APOA 2B1LA 3GKNA 2L6DA 3WYWA 3UBLA 1U6TA 5J4UA 2VL9A 1GSUA 2NDOA 4HQSA 2YN1A 1EP7A 3L4NA 19GSA 4CY6A 4OCEA 4TRXA 1ABAA 3TJGA 1EZKA 2C0FA 4O5UA 1PX7A 4WETA 3GMFA 5BMUA 4MJCA 4X4JA 1A24A 4LMWA 4KF9A 3QD9A 5DAKA 4DSRA 3EVIA 5HR1A 2MZCA 1OVNA 4MK3A 2V41A 4EVMA 5H5SA 2LJKA 4PGTA 1PL2A 3KMOA 3A2VA 4GLTA 4BWQA 3EE2A 3J7Yk 3LXZA 3FKFA 4YAPA 4MH3A 5JWQB 3DGQA 3M9JA 3FYGA 3C73A 4KCEA 1X9WB 5ECMB 3C8EA 1URMA 1FB0A 5ID2A 5A5KA 4G2EA 1OC9B 2GVPA 3VFIA 3IRAA 3HA9A 3TKSE 4USSA 4JRRA 2OKAA 5DQSA 3VPTA 1K0MA 1S3CA 2IMIA 1MTCA 2OJLA 4J56E 4ECBA 2FHEA 1OYJA 3TJFA 2XHFA 2HSHA 1XCCA 3VLNA 4IKHA 4Q5FA 2FD3A 1Z3EA 1GWCA 3DMLA 3UL3A 4N0ZA 3FZAA 2CT6A 2DIZA 3WGXA 1FB6A 1T00A 4MJBA 2VM1A 1JZDA 1Z6MA 3F4SA 1SKWB 4ZB9A 4BVXB 1M7TA 1G6WA 2YP6A 3NOFA 4IP1A 4WF5A 1TK5B 3H79A 1LBKA 5G5EA 1K0BA 4KSOA 1ML6A 3CSIA 3UJ1A 4K7OA 3F63A 4F0BA 3M3MA 1PL1A 3UBKA 4O7HA 2XPDA 2VD0A 3HY2A 2JSYA 1OC8A 2LJAA 2LJRA 1OE8A 1A8LA 3L9SA 5EY6A 1USBA 1AQVA 5KN1A 4YQMA 4MZWA 1EOHA 1GP1A 3F4RA 3G7YA 1B9XC 3MYDA 4GSNA 3TJBA 2L5OA 3O3TA 1A2LA 2H8LA 1C72A 1GSQA 4ILFA 3HXSA 5IOWA 3CSJA 3TRPA 2PPTA 3QAVA 2CX3A 2DLXA 3DVXA 4XS4A 3CSHA 3ZVJA 3VI7A 2DBCA 3BCKA 4D73B 4G0KA 2F8AA 1SJ6A 5EVOA 1DSBA 4QQ7A 4ID0A 3F6DA 4MJAA 2H6XA 1HD2A 1XOAA 2FA4A 6GSXA 3A2WA 1AXDA 4Q5NA 2MBSA 2H19A 4LMVA 1TJDA 2JADA 2M80A 1A0FA 3VWXA 1K3LA 1ERWA 2O85A 2M72A 4L8EA 4MMMA 1UN2A 3V1WA 5B6MA 4FQUA 1GL8A 3RHBA 4KE3A 6GSYA 4Z2RA 3R3EA 2DJJA 1X9MB 2MMAA 3UIWA 1V57A 3CRUA 3IAS2 2LNTA 2VLVA 2VM2A 2HLSA 1WJKA 1UA5A 2C0GA 2MYGA 1Z9HA 4RI6A 2KHPA 3IE3A 1B8XA 4PX1A 3ERGA 5COHA 2F8FA 2OADA 1MDKA 4V1Ag 2YNXA 3M1GA 6GSSA 4EO3A 5DVBA 3KIJA 2VLUA 4V2NA 1OKTA 1JHBA 1KNGA 4EF0A 1MEKA 4POBA 5ECPB 2A2PA 2QA2A 2RUFA 1GSYA 2YJHA 3LFLA 3ZFLA 1CQGA 2NVLA 5JCGA 3WT2A 2FCHA 4BA7A 1EEJA 2TRCP 3F9UA 3LYPA 4BVYA 3KJYA 3TKRA 1TU8A 2DJ0A 5IPGA 4MNNA 2F9SA 2YPMA 3IHGA 3PGTA 2YOIA 4XS1A 4Z7XA 2FWFA 2XPEA 4IELA 1GTIA 5E4WA 1WOUA 3KTLA 2HSMA 1T4YA 1FO5A 1KEBA 1GULA 3KEBA 5GAND 1T4ZA 3QAWA 2H0GA 3GV1A 4XHMA 5J5NA 3E0UA 4WXTA 3PR8A 2RM5A 5J41A 1YKAA 3ZIJA 5CRWA 5HQPA 2AJQB 5HR3A 4OFNA 2LQOA 1GLPA 2B1KA 3UAPA 4XS6A 3ME7A 1SYXA 4EIQA 2E2MA 1X0RA 3C1SA 1O8XA 4CY8A 3C71A 4JR6A 1F3AA 4ML6A 20GSA 2DKIA 1F2EA 4BL7A 3GUSA 2H1DA 3QMXA 1HNCA 1SU9A 3EYTA 2VOCA 1E6BA 1H4OA 3KP9A 4K1FA 4PQ1A 3GTUB 2NPBA 2A4HA 4KDXA 2KP2A 2HRFA 3D21A 1O8WA 2XC2A 5CYYA 2YWIA 1GSEA 2RLIA 3H93A 1VGLA 4N11A 4TKYA 5JWRB 8GSSA 4K7NA 1A2MA 5B6NA 1SL0B 1BEDA 14GSA 2GS3A 4K9ZA 4DSSA 2FWEA 3CTFA 2R5GA 3MNGA 1AW9A 3A5IA 4CDOA 4JR4A 1NHYA 2H70A 2O89A 1WRYA 2YV9A 3CXGA 1K0OA 4MPFA 5CRGA 2PN8A 4OO4A 3FZ5A 4V1Ap 5ECQB 3TDGA 1GTUA 4K2XA 5F8BA 1GUKA 2I4AA 4I8BA 2QGVA 5J3RA 2H0IA 4ZXGA 1M2DA 1DBYA 4I6XA 1GNWA 2DC5A 2HRNA 2V2GA 4BPYA 2C3NA 3TRQA 3F8UA 1WMJA 2CAQA 1TK0B 3QAGA 13GSA 4MLYA 4J2FA 3QFAC 3W8SA 2BJXA 4FH8A 3ZTLA 2H73A 2LQQA 3H1NA 3F4TA 4NHZA 3LG6A 3HDCA 5JCUA 5D9VA 2C1YA 2HZFA 1A8YA 3E9JB 5AIVA 3R2QA 5IO0A 4O32A 2HYXA 2KOKA 1SK2A 3FZ9A 3TGZA 2YWNA 1JZRA 5B8AA 5E59A 1DE1A 1OAZA 1E2YA 4I2UA 1THXA 2LV3A 3EMPA 4O5RA 5G1KA 4HU9A 1FVJA 5D8IA 2C3TA 4WBRD 3ZVJD 3EU4A 5CO3A 2IIYA 5ECIB 4AJ8A 1T1VA 2DJKA 4G10A 2LRNA 3L9VA 3GRXA 4ECIA 4AF2A 3GKKA 5ECLB 2HNLA 4K0NA 2B5XA 4WEYA 1B48A 2GSQA 3S9FA 5G30A 3EC3A 4GQFA 2C80A 2E7PA 3D22A 3Q18A 4HEA2 2HZEA 1F6MC 1OC9A 1O85A 2MMNA 1J08A 4HJMA 2WRTA 2I81A 1B4PA 1EGOA 1AQWA 5D9TA 2D2ZA 5F05A 1G7OA 2E0QA 1EGRA 1QQ2A 3ME8A 2HRKA 1X5DA 2PBJA 3KZQA 4KSMA 1R5PA 3RHCA 2O8VB 3IV4A 4LL1B 1K0CA 3DWVA 2H71A 2V1MA 3QPMA 3LYKA 2L4CA 2LSTA 1M0UA 3TOUA 2FUG2 3ISOA 4ZL7A 1OE7A 2HFDA 1GUHA 2Z9SA 1QXHA 1ST9A 5IOXA 4PQIA 2G0FA 1ZCPA 3O6TA 1UVZA 2PU9C 3VI5A 1ZZYA 22GSA 3NIVA 2ON5A 1GRXA 3EMXA 1YQ1A 2DMLA 5DBQA 1QGVA 1JFUA 3I9V2 5LD0A 1TI1A 2YZHA 5J9CA 5D9XA 1MDIA 1VF4A 1GSSA 3D6IA 1ERVA 1BX9A 1O73A 3C7MA 5AN1A 3UARA 3F3QA 3TKSA 4K6XA 2CA8A 1VF1A 4JE1A 4EDZA 2H1GA 2QKEA 4OD7A 2H6YA 2O7KA 1V2AA 1J9BA 3IK7A 3IA1A 1LU4A 3TCOA 4D73A 3HKRA 2I9HA 4WR5A 1S3AA 1ZL9A 2H76A 4DEJA 12GSA 1NW2A 1JZOA 5IMFA 3TKPA 3DYRA 2C0DA 3LORA 4DVCA 1TTZA 5ECHB 2REMA 3FY7A 3SWLA 3ZMKA 5DJMA 3ERWA 1TI3A 5LCZA 3CRTA 1XW9A 5D93A 1KBNA 4PTSA 4HDEA 1BYEA 4ZIJA 3UVTA 3FEUA 4GF0A 2N5FA 1K0NA 4KDUA 3FRCA 3GNJA 4MP4A 2L6CA 4TXVA 2PGTA 2WDUA 1B9YC 2VL2A 2NBSA 4FIWA 2HXKA 4TR3A 2LKUA 2B3SA 4KGIA 4EUYA 3L9UA 4IP6A 4ZL9A 2JZSA 4X43A 3KH7A 3U5RE 1SYRA 2AAWA 3TB2A 1XVWA 4K7IA 3ED3A 2JACA 1GNEA 5G1LA 4KDYA 3GX0A 5AISA 1N8JA 4DSQA 3IC4A 3CBUA 2JZTA 1M9BA 2M46A 5IPHA 4N30A 2ON7A 1YDKA 2IPAA 2WS2A 4ULXA 1UC7A 5ID2B 2FWHA 2R3XA 2K8SA 2P5QA 1SENA 4ICYA 1OC3A 3ZIVA 4F82A 3ZYWA 4FO5A 2IFQA 2LTKA 4IQ1A 3EINA 2HI7A 4EL1A 2X8GA 2EIOA 1PMTA 1YKCA 2VAFA 4TN8A 3CYNA 1F9MA 5DCGA 2CVKA 2H75A 3HZ8A 4KX4A 4WKWA 1XIYA 4POMA 1T8EB 1HYUA 2E2GA 2JU5A 9GSSA 3MIXA 1X5EA 1ILOA 3GFKA 2CZ3A 3TRXA 1ZMAA 5ABRA 3HCZA 2PMTA 4MF5A 3P8WA 5AGYA 3HVXA 2K8VA 3FR3A 2OA7A 2H30A 1PX6A 2HSYA 1BQ7A 2CX4A 3D4MA 3C1RA 4MF6A 2H1AA 3M9KA 16GSA 2GT6A 5BRTA 5FT3A 2YV7A 4OCFA 3IC8A 2RUEA 1U87A 1PSQA 1PD21 5KN3A 3QFBC 3ZL5A 1DE2A 2VCXA 1YEPA 2AYTA 1H75A 1AIUA 2XBIA 3G7IA 4GSSA 3QDNA 1S3DA 4YKFA 1XWCA 2DIYA 1TK8B 4FYUA 1O6JA 4JZQA 4XIHA 4ZL8A 3FK8A 1F37A 2VUPA 4MH2A 4HU7A 2WJUA 4IJ3A 1K3OA 1MD4A 1XWKA 1TP9A 1B4QA 4GRFA 5DQYA 4CHSA 1MD3A 1MDJA 3F0IA 3J7Yb 3FW2A 3A3TA 4IHUA 4F2IA 3GYKA 5HFGA 2OE1A 2TIRA 3LQ7A 1NSWA 3QOUA 1TU7A 3LEFA 1V9WA 3GH6A 2GSSA 4X1UA 2G2QA 3VWWA 3WGDA 2CVDA 3I6AA 2IWTA 1V58A 4MZBA 4NV2A 1XWGA 2GQLA 3P90A 4ZBAA 2FGXA 1QMVA 1RW1A 1TRUA 3TUEA 2X8CA 2MMZA 2C4JA 4YH2A 5ECRB 2OACA 4E8EA 1XOBA 2B7JA 2C0EA 1XVQA 3D0ZA 2QA1A 4OMVA 2ES7A 4RQXA 4IQAA 5ECNB 2VCZA 4N10A 1GUMA 3GKMA 4TVEA 4V2LA 1ACVA 18GSA 1FOHA 2VCTA 2X4AA 1NHOA 2FY6A 4AJ6A 3DEXA 4HZ4A 4RUVA 4QL9A 4JU5A 4BVYB 1ZYEA 2H01A 1T3BA 3RPNA 2R37A 1U3AA 4TXOA 3IDVA 2KP1A 2CV4A 3MAKA 4AGSA 3UVHA 3HVVA 4KNDA 3FR6A 3TKQA 4MPGA 2L59A 4HUAA 4XRDA 2YCDA 5DALA 3GA4A 3GSSA 4NWYA 2J9HA 5IMCA 1RQMA 2L5LA 2R2JA 5J9BA 2I1UA 4L0WA 5CNWA 2ZNMA 2A2RA 3EWLA 3RAZA 2IL3A 2H66A 2WCIA 1SKSB 4EC0A 4ECCA 2HE3A 4HS1A 1XWBA 5HFIA 3IOSA 3N5OA 1HNAA 2KUCA 3IBHA 5ELGA 4WF4A 1TOFA 4KA0A 5IMAA 5IO2A 1PN0A 1XW6A 5DJLA 3FZ4A 1GSDA 2EIQA 2DKHA 3GURA 5KN2A 1EEMA 5D73A 5KOXA 2X8HA 5G5FA 3ZZXA 4BL7B 1T7PB 5DCHA 1A2JA 2OBIA 1R5AA 3BD2A 1A0RP 1BJXA 5IQYA 2A4VA 4OWYA 2DJ3A 3IK9A 2N5AA 3HZ4A 3IPZA 2PVOC 3GKXA 2LNSA 4HOJA 3N9JA 2H0HA 3DXBA 1GTAA 2OE3A 3VWUA 4TR0A 4F9ZA 4IJIA 3F6FA 3LGCA 1Q4JA 3D5JA 1G0TA 5D9WA 1XXUA 4EE0A 3AY8A 2V32A 1VF2A 2AB6A 5CRHA 3FMWA 4MJEA 4P3YB 3G9BA 2WGRA 1SK1A 4BWSA 2OBKA 1GLQA 2HRAA 4FYCA 2H72A 3DKSA 2PERA 3GIXA 2X64A 1Z5YE 1EV4A 1K3YA 1V40A 5HR2A 4XCSA 3EPTA 1WIKA 1OKDA 2IMEA 4JBBA 2RM6A 5INYA 1XZOA 1G7EA 4BVXA 4GWRA 4WBJA 2NTOA 2EC4A 3BBYA 3FR9A 3ZLPA 2O87A 1JZWA 2RIIA 2R6KA 1V98A 2OE0A 1FVKA 2TRXA 2DMMA 3IR4A 1TRSA 1I9DA 4OFTA 5JWOB 3GN3A 3VK9A 4OO5A 4PQHA 3QCPA 1DUGA 2PWJA 4TR1B 2GSTA 3VURA 3OR5A 1PKWA 2FLSA 2GDRA 4EDYA 4ZB6A 4G19A 4GTUA 1XBSA 1GH2A 4GSTA 2AV4A 4RI7A 1WWJA 2MBTA 5KOWA 1Z7RA 2F3MA 2FWGA 4FYBA 3HHVA 4K5SA 1IYIA 3DRNA 4TW5A 3ZREA 3MWHA 11GSA 4ML1A 4IBPA 5ECKB 2IMFA 2ZCTA 2HZEB 5EL8A 3HJMA 3Q74A 4YQVA 5CREA 2PVQA 5B8BA 2LS5A 1PQNA 1QK8A 2H74A 1AAZA 2K6VA 1PKZA 3UOMA 3KD0A 4XTSA 2WULA 3IAM2 1M99A 2LRTA 1W4VA 4EKZA 4PURA 3KH9A 4HQZA 3G7JA 4NV5A 1JLWA 2LEGA 3I43A 4L0UA 3DD3A 3FHKA 3UEMA 1CQHA 2GZYA 2K9FA 5IMDA 3KMNA 1AC1A 4EXJA 2UZ8A 2VL3A 5KN0A 4OFMA 4MZCA 3ZRDA 3D4TA 1QFNA 3W6GA 1SD9A 4K0GA 4RQRA 5DAKB 4NAXA 2GLRA 3DIEA 5GZZB 3SBCA 5G2ZA 3APQA 3Q19A 2H1BA 5FHIA 4GQCA 5GSSA 1O7UA 1N2AA 1PN9A 1VRSD 3P2AA 2YWMA 4G0LA 7GSSA 4IS0A 4ZBBA 5D96A 2VCWA 2JL4A 2C8UA 3APSA 1HQOA 5EPFA 3U6VA 5DDLA 3IHQA 1Z7PA 5GAPD 1FG4A 3A2XA 1XWAA 1M2BA 2B6MA 5H5QA 3KCMA 4ACSA 3RBTA 4I97A 1QUWA 5IIZA 5C04A 3F3RA 4O5QA 4PNFA 1NM3A 1X5CA 2GTUA 1KTEA 3H4KA 3HYPA 4H86A 4I5QA 1ERTA 4GXZA 2WFCA 3BCIA 3PH9A 2X99A 3PPUA 3RPPA 3ZFBA 2GGTA 2IMDA 2J23A 3CMIA 5F06A 2BTOT 5F0GA 4TOPA 4NMUA 1ON4A 4Z2TA 4V2MA 2KLXA 1J0FA 1IYHA 3CTGA 4F0CA 3ERFA 4Q5RA 4MABA 3DVWA 2VO4A 4J57E 4K2DA 5IMZA 3M0FA 4POLA 3ZMLA 2DJ1A 3TJJA 2V6KA 3GTUA 3GH9A 2GSRA 2LRCA 2R4VA 3H8QA 1VF3A 2K18A 4NHWA 4ZB8A 1YF0A 4YKGA 4KAEA 3US3A 3L78A 2B7KA 4PUFC 3E3EA 3EURA 3HVSA 3WGEA 4IGJA 3GL3A 3GL5A 2WB9A 1R7HA 2VCQA 6GSUA 4GCIA 3PINA 4NXIA 4ECJA 2GZPA 4XS4B 4MCUA 2HT9A 2CAIA 4IN0A 5A4VA 5C00A 2FA8A 2YJ7A 2C3QA 4L5LA 4K8MA 4PXOA 1AUCA 1A23A 1ZOFA 4N0VA 1YY7A 3KM6A 1SL2B 4EIPA 4LL4B 4XRAA 1TXXA 4KH7A 2N5BA 5JCWA 3TJKA 4G9HA 2FNOA 4A5PA 1U88A 1ZYNA 2IFQB 2VIMA 4E8HA 1GSFA 5HFKA 1EP8A 3GSTA 5ECSA 1BG5A 5ELAA 5GSTA 4ZBDA 2GQMA 6GSVA 5ECOB 1M2AA 4IVFA 1WE0A 4O92A 3TOTA 5LNKe 2YWOA 1YEXA 4L5OA 3NZNA 2IMKA 2XBQA 1THOA 2GZZA 5L71A 4G0IA 2ZUPA 4K5RA 1Z6NA 4HI7A 2H6ZA 3UMAA 1SJIA 3MDKA 2A2SA 1FOVA 3KP8A 4YQUA 3ZITA 4MA9A 10GSA 4HZ2A 4Q5QA 1Y6EA 1BAYA 3KXOA 3LJRA 4Z2UA 2F51A 3HJOA 3W8JA 1R4WA 1FHEA 4KCAA 2GQKA 1XPVA 1JLVA 3BOAA 1Q98A 3VPQA 2CQ9A 5CP1A 3K8NA 1EV9A 4AJ7A 1K0AA 5A4WA 5CRDA 1EOGA 4WR4A 4ZILA 2JSZA 3LW9A 3MSZA 2R0CA 3P7XA 1XW5A 3BJ5A 1WP0A 1RK4A 2R0GA 1TW9A 1AQXA 1ERUA 1HNBA 2P5RA 2CVBA 17GSA 3L0HA 1ZYPA 4IW9A 3KTBA 3TKSC 3O76A 1EWXA 1O81A 5G31A 1SK0A 3Q6OA 2CZ2A 2IJYA 4F03A 5A4UA 4KB3A 1TRWA 3WT1A 2GT5A 1LJRA 1W89A 1X9SB 1SD8A 1F3BA 5H5RA 4LLRA 2B5YA 2JZRA 5HR0A 3JCML 4HJ2A 1SL1B 4TR4A 1XFLA 2AUVA 3IXRA 2R0PA 2B5EA 1PGTA 4POKA 5F07A 4CW9A 4NPBA 2YZUA 1YJ6A 3M8NA 2DJ2A 5KEJA 2EIRA 3LSZA 3QR6A 1R26A 2ALBA 1Y25A 4LA1A 4X0XA 4I2TA 6GSWA 2I3YA 2MMOA 4KUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G6Y A;  6GST A;  4KW6 A;  4TR1 A;  2LUS A;  3A5W A;  3VWV A;  3HD5 A;  1YF1 A;  4MDC A;  4YAV A;  1TKD B;  3I69 A;  2VL2 C;  5FWG A;  3WD6 A;  2YAN A;  2V6O A;  4DSS B;  3RDW A;  2DSA A;  3GHA A;  1ZGN A;  4QL7 A;  1FAA A;  1SKR B;  2VD1 A;  2IN3 A;  4TXO B;  4JED A;  2AHE A;  5AIX A;  5IMV A;  3HJP A;  1GTB A;  4PNG A;  2QSI A;  1FW1 A;  2BMX A;  3GX8 A;  1M9A A;  2L4Q A;  5CAX A;  1SJZ A;  3EU3 A;  1K0D A;  2VCV A;  5DAL B;  2P0G A;  4PUA A;  1U3I A;  1PRX A;  2L57 A;  4MF7 A;  1PA3 A;  5ENU A;  3KGK A;  3LXT A;  1ZYQ B;  1WPI A;  1YZX A;  1TDI A;  5IM9 A;  4ISD A;  2WZ9 A;  3LWA A;  5B7C A;  1I5G A;  2P31 A;  2PUK C;  1TRV A;  2VLT A;  2QC7 A;  3APO A;  2B1L A;  3GKN A;  2L6D A;  3WYW A;  3UBL A;  1U6T A;  5J4U A;  2VL9 A;  1GSU A;  2NDO A;  4HQS A;  2YN1 A;  1EP7 A;  3L4N A;  19GS A;  4OCE A;  4TRX A;  1ABA A;  3TJG A;  1EZK A;  2C0F A;  1PX7 A;  4WET A;  3GMF A;  4MJC A;  1A24 A;  4LMW A;  3QD9 A;  5DAK A;  4DSR A;  3EVI A;  5HR1 A;  2MZC A;  1OVN A;  4MK3 A;  2V41 A;  4EVM A;  5H5S A;  2LJK A;  4PGT A;  1PL2 A;  3KMO A;  3A2V A;  4GLT A;  4BWQ A;  3EE2 A;  3J7Y k;  3LXZ A;  3FKF A;  4YAP A;  4MH3 A;  5JWQ B;  3DGQ A;  3M9J A;  3FYG A;  3C73 A;  4KCE A;  1X9W B;  5ECM B;  3C8E A;  1URM A;  1FB0 A;  5ID2 A;  5A5K A;  4G2E A;  1OC9 B;  2GVP A;  3VFI A;  3IRA A;  3HA9 A;  3TKS E;  4JRR A;  2OKA A;  5DQS A;  3VPT A;  1K0M A;  1S3C A;  2IMI A;  1MTC A;  2OJL A;  4J56 E;  4ECB A;  2FHE A;  1OYJ A;  3TJF A;  2XHF A;  2HSH A;  1XCC A;  3VLN A;  4IKH A;  4Q5F A;  2FD3 A;  1Z3E A;  1GWC A;  3DML A;  3UL3 A;  4N0Z A;  3FZA A;  2CT6 A;  2DIZ A;  3WGX A;  1FB6 A;  1T00 A;  4MJB A;  2VM1 A;  1JZD A;  1Z6M A;  3F4S A;  1SKW B;  4ZB9 A;  1M7T A;  1G6W A;  2YP6 A;  3NOF A;  4IP1 A;  4WF5 A;  1TK5 B;  3H79 A;  1LBK A;  5G5E A;  1K0B A;  4KSO A;  1ML6 A;  3CSI A;  3UJ1 A;  4K7O A;  3F63 A;  4F0B A;  3M3M A;  1PL1 A;  3UBK A;  4O7H A;  2XPD A;  2VD0 A;  3HY2 A;  2JSY A;  1OC8 A;  2LJA A;  5EY6 A;  2LJR A;  1OE8 A;  1A8L A;  3L9S A;  1USB A;  1AQV A;  5KN1 A;  4YQM A;  4MZW A;  1EOH A;  1GP1 A;  3F4R A;  3G7Y A;  1B9X C;  4GSN A;  3TJB A;  2L5O A;  3O3T A;  1A2L A;  2H8L A;  1C72 A;  1GSQ A;  4ILF A;  3HXS A;  5IOW A;  3CSJ A;  3TRP A;  2PPT A;  3QAV A;  2CX3 A;  2DLX A;  3DVX A;  4XS4 A;  3CSH A;  3ZVJ A;  3VI7 A;  2DBC A;  3BCK A;  4D73 B;  2F8A A;  1SJ6 A;  5EVO A;  1DSB A;  4QQ7 A;  4ID0 A;  3F6D A;  4MJA A;  2H6X A;  1HD2 A;  1XOA A;  2FA4 A;  6GSX A;  3A2W A;  1AXD A;  4Q5N A;  2MBS A;  2H19 A;  4LMV A;  1TJD A;  2JAD A;  2M80 A;  1A0F A;  3VWX A;  1K3L A;  1ERW A;  2O85 A;  2M72 A;  4L8E A;  4MMM A;  1UN2 A;  3V1W A;  5B6M A;  1GL8 A;  3RHB A;  4KE3 A;  6GSY A;  2DJJ A;  1X9M B;  2MMA A;  3UIW A;  1V57 A;  3CRU A;  3IAS 2;  2LNT A;  2VLV A;  2VM2 A;  2HLS A;  1WJK A;  1UA5 A;  2C0G A;  2MYG A;  1Z9H A;  4RI6 A;  2KHP A;  3IE3 A;  1B8X A;  4PX1 A;  3ERG A;  5COH A;  2F8F A;  2OAD A;  1MDK A;  4V1A g;  2YNX A;  3M1G A;  6GSS A;  4EO3 A;  5DVB A;  3KIJ A;  2VLU A;  4V2N A;  1OKT A;  1JHB A;  1KNG A;  4EF0 A;  1MEK A;  4POB A;  5ECP B;  2RUF A;  1GSY A;  2YJH A;  3LFL A;  3ZFL A;  1CQG A;  2NVL A;  5JCG A;  3WT2 A;  2FCH A;  4BA7 A;  1EEJ A;  2TRC P;  3F9U A;  3LYP A;  4BVY A;  3KJY A;  3TKR A;  1TU8 A;  2DJ0 A;  5IPG A;  2F9S A;  2YPM A;  3PGT A;  2YOI A;  4XS1 A;  4Z7X A;  2FWF A;  2XPE A;  4IEL A;  1GTI A;  5E4W A;  1WOU A;  3KTL A;  1T4Y A;  1FO5 A;  1KEB A;  1GUL A;  3KEB A;  5GAN D;  1T4Z A;  3QAW A;  2H0G A;  3GV1 A;  4XHM A;  5J5N A;  3E0U A;  4WXT A;  3PR8 A;  2RM5 A;  5J41 A;  1YKA A;  3ZIJ A;  5CRW A;  5HQP A;  2AJQ B;  5HR3 A;  4OFN A;  2LQO A;  1GLP A;  2B1K A;  3UAP A;  4XS6 A;  3ME7 A;  1SYX A;  2E2M A;  1X0R A;  3C1S A;  1O8X A;  3C71 A;  4JR6 A;  1F3A A;  4ML6 A;  20GS A;  1F2E A;  4BL7 A;  3GUS A;  2H1D A;  3QMX A;  1HNC A;  1SU9 A;  3EYT A;  2VOC A;  1E6B A;  1H4O A;  3KP9 A;  4K1F A;  4PQ1 A;  3GTU B;  2NPB A;  4KDX A;  2KP2 A;  2HRF A;  3D21 A;  1O8W A;  2XC2 A;  5CYY A;  2YWI A;  1GSE A;  2RLI A;  3H93 A;  1VGL A;  4N11 A;  4TKY A;  5JWR B;  8GSS A;  4K7N A;  1A2M A;  5B6N A;  1SL0 B;  1BED A;  14GS A;  2GS3 A;  4K9Z A;  4DSS A;  2FWE A;  3CTF A;  2R5G A;  3MNG A;  1AW9 A;  4CDO A;  4JR4 A;  1NHY A;  2H70 A;  2O89 A;  1WRY A;  2YV9 A;  3CXG A;  1K0O A;  4MPF A;  5CRG A;  2PN8 A;  4OO4 A;  3FZ5 A;  4V1A p;  5ECQ B;  3TDG A;  1GTU A;  5F8B A;  1GUK A;  2I4A A;  4I8B A;  2QGV A;  5J3R A;  2H0I A;  4ZXG A;  1M2D A;  1DBY A;  4I6X A;  1GNW A;  2DC5 A;  2HRN A;  2V2G A;  4BPY A;  2C3N A;  3TRQ A;  3F8U A;  1WMJ A;  2CAQ A;  1TK0 B;  3QAG A;  13GS A;  4MLY A;  4J2F A;  3QFA C;  3W8S A;  2BJX A;  4FH8 A;  3ZTL A;  2H73 A;  2LQQ A;  3H1N A;  3F4T A;  4NHZ A;  3LG6 A;  3HDC A;  5JCU A;  5D9V A;  2C1Y A;  2HZF A;  1A8Y A;  3E9J B;  5AIV A;  3R2Q A;  5IO0 A;  4O32 A;  2HYX A;  2KOK A;  1SK2 A;  3FZ9 A;  3TGZ A;  2YWN A;  1JZR A;  5B8A A;  5E59 A;  1DE1 A;  1OAZ A;  1E2Y A;  4I2U A;  1THX A;  2LV3 A;  3EMP A;  4O5R A;  5G1K A;  4HU9 A;  1FVJ A;  5D8I A;  2C3T A;  4WBR D;  3ZVJ D;  3EU4 A;  5CO3 A;  2IIY A;  5ECI B;  4AJ8 A;  1T1V A;  2DJK A;  4G10 A;  2LRN A;  3L9V A;  3GRX A;  4ECI A;  4AF2 A;  3GKK A;  5ECL B;  2HNL A;  4K0N A;  2B5X A;  4WEY A;  1B48 A;  2GSQ A;  3S9F A;  5G30 A;  3EC3 A;  4GQF A;  2C80 A;  2E7P A;  3D22 A;  3Q18 A;  4HEA 2;  2HZE A;  1F6M C;  1OC9 A;  1O85 A;  2MMN A;  1J08 A;  4HJM A;  2WRT A;  2I81 A;  1B4P A;  1EGO A;  1AQW A;  5D9T A;  2D2Z A;  5F05 A;  1G7O A;  2E0Q A;  1EGR A;  1QQ2 A;  3ME8 A;  1X5D A;  2PBJ A;  3KZQ A;  4KSM A;  1R5P A;  3RHC A;  2O8V B;  3IV4 A;  4LL1 B;  1K0C A;  3DWV A;  2H71 A;  2V1M A;  3QPM A;  3LYK A;  2L4C A;  2LST A;  1M0U A;  3TOU A;  2FUG 2;  3ISO A;  4ZL7 A;  1OE7 A;  2HFD A;  1GUH A;  2Z9S A;  1QXH A;  1ST9 A;  5IOX A;  4PQI A;  2G0F A;  1ZCP A;  3O6T A;  1UVZ A;  2PU9 C;  3VI5 A;  1ZZY A;  22GS A;  3NIV A;  2ON5 A;  1GRX A;  3EMX A;  1YQ1 A;  2DML A;  5DBQ A;  1QGV A;  1JFU A;  3I9V 2;  5LD0 A;  1TI1 A;  2YZH A;  5J9C A;  5D9X A;  1MDI A;  1VF4 A;  1GSS A;  3D6I A;  1ERV A;  1BX9 A;  1O73 A;  3C7M A;  5AN1 A;  3UAR A;  3F3Q A;  3TKS A;  4K6X A;  2CA8 A;  1VF1 A;  4JE1 A;  4EDZ A;  2H1G A;  2QKE A;  4OD7 A;  2H6Y A;  2O7K A;  1V2A A;  1J9B A;  3IK7 A;  3IA1 A;  1LU4 A;  3TCO A;  4D73 A;  3HKR A;  2I9H A;  4WR5 A;  1S3A A;  1ZL9 A;  2H76 A;  4DEJ A;  12GS A;  1NW2 A;  1JZO A;  5IMF A;  3TKP A;  3DYR A;  2C0D A;  3LOR A;  4DVC A;  1TTZ A;  5ECH B;  2REM A;  3FY7 A;  3SWL A;  3ZMK A;  5DJM A;  3ERW A;  1TI3 A;  5LCZ A;  3CRT A;  1XW9 A;  5D93 A;  1KBN A;  4HDE A;  1BYE A;  4ZIJ A;  3UVT A;  3FEU A;  4GF0 A;  2N5F A;  1K0N A;  4KDU A;  3FRC A;  3GNJ A;  4MP4 A;  2L6C A;  4TXV A;  2PGT A;  2WDU A;  1B9Y C;  2VL2 A;  2NBS A;  4FIW A;  2HXK A;  4TR3 A;  2LKU A;  2B3S A;  4KGI A;  4EUY A;  3L9U A;  4IP6 A;  4ZL9 A;  2JZS A;  4X43 A;  3KH7 A;  3U5R E;  1SYR A;  2AAW A;  3TB2 A;  1XVW A;  4K7I A;  3ED3 A;  2JAC A;  1GNE A;  5G1L A;  4KDY A;  3GX0 A;  5AIS A;  1N8J A;  4DSQ A;  3IC4 A;  3CBU A;  2JZT A;  1M9B A;  2M46 A;  5IPH A;  4N30 A;  2ON7 A;  1YDK A;  2IPA A;  2WS2 A;  4ULX A;  1UC7 A;  5ID2 B;  2FWH A;  2R3X A;  2K8S A;  2P5Q A;  1SEN A;  1OC3 A;  3ZIV A;  4F82 A;  3ZYW A;  4FO5 A;  2IFQ A;  2LTK A;  4IQ1 A;  3EIN A;  2HI7 A;  4EL1 A;  2X8G A;  2EIO A;  1PMT A;  1YKC A;  2VAF A;  4TN8 A;  3CYN A;  1F9M A;  5DCG A;  2CVK A;  2H75 A;  3HZ8 A;  4KX4 A;  4WKW A;  1XIY A;  4POM A;  1T8E B;  1HYU A;  2E2G A;  2JU5 A;  9GSS A;  1ILO A;  1X5E A;  3GFK A;  2CZ3 A;  3TRX A;  1ZMA A;  5ABR A;  3HCZ A;  2PMT A;  4MF5 A;  3P8W A;  5AGY A;  3HVX A;  2K8V A;  3FR3 A;  2OA7 A;  2H30 A;  1PX6 A;  2HSY A;  1BQ7 A;  2CX4 A;  3D4M A;  3C1R A;  4MF6 A;  2H1A A;  3M9K A;  16GS A;  2GT6 A;  5FT3 A;  2YV7 A;  4OCF A;  2RUE A;  1U87 A;  1PSQ A;  1PD2 1;  5KN3 A;  3QFB C;  3ZL5 A;  1DE2 A;  2VCX A;  1YEP A;  2AYT A;  1H75 A;  1AIU A;  2XBI A;  3G7I A;  4GSS A;  3QDN A;  1S3D A;  1XWC A;  2DIY A;  1TK8 B;  4FYU A;  1O6J A;  4JZQ A;  4XIH A;  4ZL8 A;  3FK8 A;  1F37 A;  2VUP A;  4MH2 A;  4HU7 A;  2WJU A;  4IJ3 A;  1K3O A;  1MD4 A;  1XWK A;  1TP9 A;  1B4Q A;  4GRF A;  5DQY A;  4CHS A;  1MD3 A;  1MDJ A;  3F0I A;  3J7Y b;  3FW2 A;  3A3T A;  4IHU A;  4F2I A;  3GYK A;  5HFG A;  2OE1 A;  2TIR A;  3LQ7 A;  1NSW A;  3QOU A;  1TU7 A;  3LEF A;  1V9W A;  3GH6 A;  2GSS A;  4X1U A;  2G2Q A;  3VWW A;  3WGD A;  2CVD A;  3I6A A;  2IWT A;  1V58 A;  4MZB A;  4NV2 A;  1XWG A;  2GQL A;  3P90 A;  4ZBA A;  2FGX A;  1QMV A;  1RW1 A;  1TRU A;  3TUE A;  2X8C A;  2MMZ A;  2C4J A;  4YH2 A;  5ECR B;  2OAC A;  4E8E A;  1XOB A;  2B7J A;  2C0E A;  1XVQ A;  3D0Z A;  4OMV A;  2ES7 A;  4RQX A;  4IQA A;  5ECN B;  2VCZ A;  4N10 A;  1GUM A;  3GKM A;  4TVE A;  4V2L A;  1ACV A;  18GS A;  2VCT A;  1NHO A;  2FY6 A;  4AJ6 A;  3DEX A;  4HZ4 A;  4RUV A;  4QL9 A;  4JU5 A;  1ZYE A;  2H01 A;  1T3B A;  3RPN A;  2R37 A;  1U3A A;  4TXO A;  3IDV A;  2KP1 A;  2CV4 A;  3MAK A;  4AGS A;  3UVH A;  3HVV A;  4KND A;  3FR6 A;  3TKQ A;  4MPG A;  2L59 A;  4HUA A;  4XRD A;  2YCD A;  5DAL A;  3GA4 A;  3GSS A;  4NWY A;  2J9H A;  5IMC A;  1RQM A;  2L5L A;  2R2J A;  5J9B A;  2I1U A;  4L0W A;  5CNW A;  2ZNM A;  2A2R A;  3EWL A;  3RAZ A;  2IL3 A;  2H66 A;  2WCI A;  1SKS B;  4EC0 A;  4ECC A;  2HE3 A;  4HS1 A;  1XWB A;  5HFI A;  3IOS A;  3N5O A;  1HNA A;  2KUC A;  3IBH A;  5ELG A;  4WF4 A;  1TOF A;  4KA0 A;  5IMA A;  5IO2 A;  1XW6 A;  5DJL A;  3FZ4 A;  1GSD A;  2EIQ A;  3GUR A;  5KN2 A;  1EEM A;  5D73 A;  2X8H A;  5G5F A;  3ZZX A;  1T7P B;  5DCH A;  1A2J A;  2OBI A;  1R5A A;  3BD2 A;  1A0R P;  1BJX A;  5IQY A;  2A4V A;  4OWY A;  2DJ3 A;  3IK9 A;  2N5A A;  3HZ4 A;  3IPZ A;  2PVO C;  3GKX A;  2LNS A;  4HOJ A;  3N9J A;  2H0H A;  3DXB A;  1GTA A;  2OE3 A;  3VWU A;  4TR0 A;  4F9Z A;  4IJI A;  3F6F A;  3LGC A;  1Q4J A;  3D5J A;  1G0T A;  5D9W A;  1XXU A;  4EE0 A;  3AY8 A;  2V32 A;  1VF2 A;  2AB6 A;  5CRH A;  4MJE A;  4P3Y B;  3G9B A;  2WGR A;  1SK1 A;  4BWS A;  2OBK A;  1GLQ A;  4FYC A;  2H72 A;  3DKS A;  2PER A;  3GIX A;  2X64 A;  1Z5Y E;  1EV4 A;  1K3Y A;  1V40 A;  5HR2 A;  4XCS A;  1WIK A;  1OKD A;  2IME A;  4JBB A;  2RM6 A;  5INY A;  1XZO A;  1G7E A;  4BVX A;  4GWR A;  4WBJ A;  2NTO A;  2EC4 A;  3BBY A;  3FR9 A;  3ZLP A;  2O87 A;  1JZW A;  2RII A;  2R6K A;  1V98 A;  2OE0 A;  1FVK A;  2TRX A;  2DMM A;  3IR4 A;  1TRS A;  1I9D A;  4OFT A;  5JWO B;  3GN3 A;  3VK9 A;  4OO5 A;  4PQH A;  3QCP A;  1DUG A;  2PWJ A;  4TR1 B;  2GST A;  3VUR A;  3OR5 A;  1PKW A;  2FLS A;  2GDR A;  4EDY A;  4ZB6 A;  4G19 A;  4GTU A;  1XBS A;  1GH2 A;  4GST A;  2AV4 A;  4RI7 A;  1WWJ A;  2MBT A;  1Z7R A;  2F3M A;  2FWG A;  4FYB A;  3HHV A;  1IYI A;  3DRN A;  4TW5 A;  3ZRE A;  3MWH A;  11GS A;  4ML1 A;  4IBP A;  5ECK B;  2IMF A;  2ZCT A;  2HZE B;  5EL8 A;  3HJM A;  3Q74 A;  4YQV A;  5CRE A;  2PVQ A;  5B8B A;  2LS5 A;  1PQN A;  1QK8 A;  2H74 A;  1AAZ A;  2K6V A;  1PKZ A;  3UOM A;  3KD0 A;  4XTS A;  2WUL A;  3IAM 2;  1M99 A;  2LRT A;  1W4V A;  4EKZ A;  4PUR A;  3KH9 A;  4HQZ A;  3G7J A;  4NV5 A;  1JLW A;  2LEG A;  3I43 A;  4L0U A;  3DD3 A;  3FHK A;  3UEM A;  1CQH A;  2GZY A;  2K9F A;  5IMD A;  3KMN A;  1AC1 A;  4EXJ A;  2VL3 A;  5KN0 A;  4OFM A;  4MZC A;  3ZRD A;  3D4T A;  1QFN A;  3W6G A;  1SD9 A;  4K0G A;  4RQR A;  5DAK B;  4NAX A;  2GLR A;  3DIE A;  5GZZ B;  3SBC A;  5G2Z A;  3APQ A;  3Q19 A;  2H1B A;  5FHI A;  4GQC A;  5GSS A;  1O7U A;  1N2A A;  1PN9 A;  1VRS D;  3P2A A;  2YWM A;  7GSS A;  4IS0 A;  4ZBB A;  5D96 A;  2VCW A;  2JL4 A;  2C8U A;  3APS A;  1HQO A;  5EPF A;  3U6V A;  5DDL A;  3IHQ A;  1Z7P A;  5GAP D;  1FG4 A;  3A2X A;  1XWA A;  1M2B A;  2B6M A;  5H5Q A;  3KCM A;  4ACS A;  3RBT A;  4I97 A;  1QUW A;  5IIZ A;  5C04 A;  3F3R A;  4PNF A;  1NM3 A;  1X5C A;  2GTU A;  1KTE A;  3H4K A;  3HYP A;  4H86 A;  4I5Q A;  1ERT A;  4GXZ A;  2WFC A;  3BCI A;  3PH9 A;  2X99 A;  3RPP A;  3ZFB A;  2GGT A;  2IMD A;  2J23 A;  3CMI A;  5F06 A;  2BTO T;  5F0G A;  4TOP A;  4NMU A;  1ON4 A;  4V2M A;  2KLX A;  1J0F A;  1IYH A;  3CTG A;  4F0C A;  3ERF A;  4Q5R A;  4MAB A;  3DVW A;  2VO4 A;  4J57 E;  4K2D A;  5IMZ A;  3M0F A;  4POL A;  3ZML A;  2DJ1 A;  3TJJ A;  2V6K A;  3GTU A;  3GH9 A;  2GSR A;  2LRC A;  2R4V A;  3H8Q A;  1VF3 A;  2K18 A;  4NHW A;  4ZB8 A;  1YF0 A;  4KAE A;  3US3 A;  3L78 A;  2B7K A;  4PUF C;  3E3E A;  3EUR A;  3HVS A;  3WGE A;  4IGJ A;  3GL3 A;  3GL5 A;  2WB9 A;  1R7H A;  2VCQ A;  6GSU A;  4GCI A;  3PIN A;  4NXI A;  4ECJ A;  2GZP A;  4XS4 B;  4MCU A;  2HT9 A;  2CAI A;  4IN0 A;  5A4V A;  5C00 A;  2FA8 A;  2YJ7 A;  2C3Q A;  4L5L A;  4K8M A;  4PXO A;  1AUC A;  1A23 A;  1ZOF A;  4N0V A;  1YY7 A;  3KM6 A;  1SL2 B;  4LL4 B;  4XRA A;  1TXX A;  4KH7 A;  2N5B A;  5JCW A;  3TJK A;  4G9H A;  2FNO A;  1U88 A;  2IFQ B;  2VIM A;  4E8H A;  1GSF A;  5HFK A;  1EP8 A;  3GST A;  5ECS A;  1BG5 A;  5ELA A;  5GST A;  4ZBD A;  2GQM A;  6GSV A;  5ECO B;  1M2A A;  4IVF A;  1WE0 A;  4O92 A;  3TOT A;  5LNK e;  2YWO A;  1YEX A;  4L5O A;  3NZN A;  2IMK A;  2XBQ A;  1THO A;  2GZZ A;  5L71 A;  2ZUP A;  1Z6N A;  4HI7 A;  2H6Z A;  3UMA A;  1SJI A;  3MDK A;  2A2S A;  1FOV A;  3KP8 A;  4YQU A;  3ZIT A;  4MA9 A;  10GS A;  4HZ2 A;  4Q5Q A;  1Y6E A;  1BAY A;  3KXO A;  3LJR A;  2F51 A;  3HJO A;  3W8J A;  1R4W A;  1FHE A;  4KCA A;  2GQK A;  1XPV A;  1JLV A;  3BOA A;  1Q98 A;  3VPQ A;  2CQ9 A;  5CP1 A;  3K8N A;  1EV9 A;  4AJ7 A;  1K0A A;  5A4W A;  5CRD A;  1EOG A;  4WR4 A;  4ZIL A;  2JSZ A;  3MSZ A;  3P7X A;  1XW5 A;  3BJ5 A;  1WP0 A;  1RK4 A;  1TW9 A;  1AQX A;  1ERU A;  1HNB A;  2P5R A;  2CVB A;  17GS A;  3L0H A;  4IW9 A;  3KTB A;  3TKS C;  3O76 A;  1EWX A;  1O81 A;  5G31 A;  1SK0 A;  3Q6O A;  2CZ2 A;  2IJY A;  4F03 A;  5A4U A;  4KB3 A;  1TRW A;  3WT1 A;  2GT5 A;  1LJR A;  1W89 A;  1X9S B;  1SD8 A;  1F3B A;  5H5R A;  4LLR A;  2B5Y A;  2JZR A;  5HR0 A;  3JCM L;  4HJ2 A;  1SL1 B;  4TR4 A;  1XFL A;  2AUV A;  3IXR A;  2B5E A;  1PGT A;  4POK A;  5F07 A;  4CW9 A;  4NPB A;  2YZU A;  1YJ6 A;  3M8N A;  2DJ2 A;  5KEJ A;  2EIR A;  3LSZ A;  3QR6 A;  1R26 A;  2ALB A;  1Y25 A;  4LA1 A;  4X0X A;  4I2T A;  6GSW A;  2I3Y A;  2MMO A;  4KUN A; 
#chains in the Genus database with same CATH topology
 1G6Y A;  6GST A;  4KW6 A;  4TR1 A;  2LUS A;  3A5W A;  3VWV A;  3HD5 A;  1YF1 A;  4MDC A;  4YAV A;  1TKD B;  3I69 A;  2VL2 C;  5FWG A;  3WD6 A;  2YAN A;  2V6O A;  4DSS B;  3RDW A;  2DSA A;  3GHA A;  2X49 A;  1ZGN A;  4QL7 A;  1FAA A;  1SKR B;  2VD1 A;  2IN3 A;  4TXO B;  4JED A;  2AHE A;  5AIX A;  5IMV A;  3HJP A;  1GTB A;  4PNG A;  2QSI A;  1FW1 A;  2BMX A;  3GX8 A;  1M9A A;  2L4Q A;  5CAX A;  1SJZ A;  3EU3 A;  1K0D A;  2VCV A;  5DAL B;  2P0G A;  4PUA A;  1U3I A;  1PRX A;  2L57 A;  4MF7 A;  1PA3 A;  5ENU A;  3KGK A;  3LXT A;  1ZYQ B;  1WPI A;  1YZX A;  1TDI A;  5IM9 A;  4ISD A;  2WZ9 A;  3LWA A;  5B7C A;  1I5G A;  2P31 A;  2PUK C;  1TRV A;  2VLT A;  2QC7 A;  3APO A;  2B1L A;  3GKN A;  2L6D A;  3WYW A;  3UBL A;  1U6T A;  5J4U A;  2VL9 A;  1GSU A;  2NDO A;  4HQS A;  2YN1 A;  1EP7 A;  3L4N A;  19GS A;  4CY6 A;  4OCE A;  4TRX A;  1ABA A;  3TJG A;  1EZK A;  2C0F A;  4O5U A;  1PX7 A;  4WET A;  3GMF A;  5BMU A;  4MJC A;  4X4J A;  1A24 A;  4LMW A;  4KF9 A;  3QD9 A;  5DAK A;  4DSR A;  3EVI A;  5HR1 A;  2MZC A;  1OVN A;  4MK3 A;  2V41 A;  4EVM A;  5H5S A;  2LJK A;  4PGT A;  1PL2 A;  3KMO A;  3A2V A;  4GLT A;  4BWQ A;  3EE2 A;  3J7Y k;  3LXZ A;  3FKF A;  4YAP A;  4MH3 A;  5JWQ B;  3DGQ A;  3M9J A;  3FYG A;  3C73 A;  4KCE A;  1X9W B;  5ECM B;  3C8E A;  1URM A;  1FB0 A;  5ID2 A;  5A5K A;  4G2E A;  1OC9 B;  2GVP A;  3VFI A;  3IRA A;  3HA9 A;  3TKS E;  4USS A;  4JRR A;  2OKA A;  5DQS A;  3VPT A;  1K0M A;  1S3C A;  2IMI A;  1MTC A;  2OJL A;  4J56 E;  4ECB A;  2FHE A;  1OYJ A;  3TJF A;  2XHF A;  2HSH A;  1XCC A;  3VLN A;  4IKH A;  4Q5F A;  2FD3 A;  1Z3E A;  1GWC A;  3DML A;  3UL3 A;  4N0Z A;  1PFO A;  3FZA A;  2CT6 A;  2DIZ A;  3WGX A;  1FB6 A;  1T00 A;  4MJB A;  2VM1 A;  1JZD A;  1Z6M A;  3F4S A;  1SKW B;  4ZB9 A;  4BVX B;  1M7T A;  1G6W A;  2YP6 A;  3NOF A;  4IP1 A;  4WF5 A;  1TK5 B;  3H79 A;  1LBK A;  5G5E A;  1K0B A;  4KSO A;  1ML6 A;  3CSI A;  3UJ1 A;  4K7O A;  3F63 A;  4F0B A;  3M3M A;  1PL1 A;  3UBK A;  4O7H A;  2XPD A;  2VD0 A;  3HY2 A;  2JSY A;  1OC8 A;  2LJA A;  2LJR A;  1OE8 A;  1A8L A;  3L9S A;  5EY6 A;  1USB A;  1AQV A;  5KN1 A;  4YQM A;  4MZW A;  1EOH A;  1GP1 A;  3F4R A;  3G7Y A;  1B9X C;  3MYD A;  4GSN A;  3TJB A;  2L5O A;  3O3T A;  1A2L A;  2H8L A;  1C72 A;  1GSQ A;  4ILF A;  3HXS A;  5IOW A;  3CSJ A;  3TRP A;  2PPT A;  3QAV A;  2CX3 A;  2DLX A;  3DVX A;  1S3R A;  1M3J A;  4XS4 A;  3CSH A;  3ZVJ A;  3VI7 A;  2DBC A;  3BCK A;  4D73 B;  4G0K A;  2F8A A;  1SJ6 A;  5EVO A;  1DSB A;  4QQ7 A;  4ID0 A;  3F6D A;  4MJA A;  2H6X A;  1HD2 A;  1XOA A;  2FA4 A;  6GSX A;  3A2W A;  1AXD A;  4Q5N A;  2MBS A;  2H19 A;  4LMV A;  1TJD A;  2JAD A;  2M80 A;  1A0F A;  3VWX A;  1K3L A;  1ERW A;  2O85 A;  2M72 A;  4L8E A;  4MMM A;  1UN2 A;  3V1W A;  5B6M A;  4FQU A;  1GL8 A;  3RHB A;  4KE3 A;  6GSY A;  4Z2R A;  3R3E A;  2DJJ A;  1X9M B;  2MMA A;  3UIW A;  1V57 A;  3CRU A;  3IAS 2;  2LNT A;  2VLV A;  2VM2 A;  2HLS A;  1WJK A;  1UA5 A;  2C0G A;  2MYG A;  1Z9H A;  4RI6 A;  2KHP A;  3IE3 A;  1B8X A;  4PX1 A;  3ERG A;  5COH A;  2F8F A;  2OAD A;  1MDK A;  4V1A g;  2YNX A;  3M1G A;  6GSS A;  4EO3 A;  5DVB A;  3KIJ A;  2VLU A;  4V2N A;  1OKT A;  1JHB A;  1KNG A;  4EF0 A;  1MEK A;  4POB A;  5ECP B;  2A2P A;  2QA2 A;  2RUF A;  1GSY A;  2YJH A;  3LFL A;  3ZFL A;  1CQG A;  2NVL A;  5JCG A;  3WT2 A;  2FCH A;  4BA7 A;  1EEJ A;  2TRC P;  3F9U A;  3LYP A;  4BVY A;  3KJY A;  3TKR A;  1TU8 A;  2DJ0 A;  5IPG A;  4MNN A;  2F9S A;  2YPM A;  3IHG A;  3PGT A;  2YOI A;  4XS1 A;  4Z7X A;  2FWF A;  2XPE A;  4IEL A;  1GTI A;  5E4W A;  1WOU A;  3KTL A;  2HSM A;  1T4Y A;  1FO5 A;  1KEB A;  1GUL A;  3KEB A;  5GAN D;  1T4Z A;  3QAW A;  2H0G A;  3GV1 A;  4XHM A;  5J5N A;  3E0U A;  4WXT A;  3PR8 A;  2RM5 A;  5J41 A;  1YKA A;  3ZIJ A;  5CRW A;  5HQP A;  2AJQ B;  5HR3 A;  4OFN A;  2LQO A;  1GLP A;  2B1K A;  3UAP A;  4XS6 A;  3ME7 A;  1SYX A;  4EIQ A;  2E2M A;  1X0R A;  3C1S A;  1O8X A;  4CY8 A;  3C71 A;  4JR6 A;  1F3A A;  4ML6 A;  20GS A;  2DKI A;  1F2E A;  4BL7 A;  3GUS A;  2H1D A;  3QMX A;  1HNC A;  1SU9 A;  3EYT A;  2VOC A;  1E6B A;  1H4O A;  3KP9 A;  4K1F A;  4PQ1 A;  3GTU B;  2NPB A;  2A4H A;  4KDX A;  2KP2 A;  2HRF A;  3D21 A;  1O8W A;  2XC2 A;  5CYY A;  2YWI A;  1GSE A;  2RLI A;  3H93 A;  1VGL A;  4N11 A;  4TKY A;  5JWR B;  8GSS A;  4K7N A;  1A2M A;  5B6N A;  1SL0 B;  1BED A;  14GS A;  2GS3 A;  4K9Z A;  4DSS A;  2FWE A;  3CTF A;  2R5G A;  3MNG A;  1AW9 A;  3A5I A;  4CDO A;  4JR4 A;  1NHY A;  2H70 A;  2O89 A;  1WRY A;  2YV9 A;  3CXG A;  1K0O A;  4MPF A;  5CRG A;  2PN8 A;  4OO4 A;  3FZ5 A;  4V1A p;  5ECQ B;  3TDG A;  1GTU A;  4K2X A;  5F8B A;  1GUK A;  2I4A A;  4I8B A;  2QGV A;  5J3R A;  2H0I A;  4ZXG A;  1M2D A;  1DBY A;  4I6X A;  1GNW A;  2DC5 A;  2HRN A;  2V2G A;  4BPY A;  2C3N A;  3TRQ A;  3F8U A;  1WMJ A;  2CAQ A;  1TK0 B;  3QAG A;  13GS A;  4MLY A;  4J2F A;  3QFA C;  3W8S A;  2BJX A;  4FH8 A;  3ZTL A;  2H73 A;  2LQQ A;  3H1N A;  3F4T A;  4NHZ A;  3LG6 A;  3HDC A;  5JCU A;  5D9V A;  2C1Y A;  2HZF A;  1A8Y A;  3E9J B;  5AIV A;  3R2Q A;  5IO0 A;  4O32 A;  2HYX A;  2KOK A;  1SK2 A;  3FZ9 A;  3TGZ A;  2YWN A;  1JZR A;  5B8A A;  5E59 A;  1DE1 A;  1OAZ A;  1E2Y A;  4I2U A;  1THX A;  2LV3 A;  3EMP A;  4O5R A;  5G1K A;  4HU9 A;  1FVJ A;  5D8I A;  2C3T A;  4WBR D;  3ZVJ D;  3EU4 A;  5CO3 A;  2IIY A;  5ECI B;  4AJ8 A;  1T1V A;  2DJK A;  4G10 A;  2LRN A;  3L9V A;  3GRX A;  4ECI A;  4AF2 A;  3GKK A;  5ECL B;  2HNL A;  4K0N A;  2B5X A;  4WEY A;  1B48 A;  2GSQ A;  3S9F A;  5G30 A;  3EC3 A;  4GQF A;  2C80 A;  2E7P A;  3D22 A;  3Q18 A;  4HEA 2;  2HZE A;  1F6M C;  1OC9 A;  1O85 A;  2MMN A;  1J08 A;  4HJM A;  2WRT A;  2I81 A;  1B4P A;  1EGO A;  1AQW A;  5D9T A;  2D2Z A;  5F05 A;  1G7O A;  2E0Q A;  1EGR A;  1QQ2 A;  3ME8 A;  2HRK A;  1X5D A;  2PBJ A;  3KZQ A;  4KSM A;  1R5P A;  3RHC A;  2O8V B;  3IV4 A;  4LL1 B;  1K0C A;  3DWV A;  2H71 A;  2V1M A;  3QPM A;  3LYK A;  2L4C A;  2LST A;  1M0U A;  3TOU A;  2FUG 2;  3ISO A;  4ZL7 A;  1OE7 A;  2HFD A;  1GUH A;  2Z9S A;  1QXH A;  1ST9 A;  5IOX A;  4PQI A;  2G0F A;  1ZCP A;  3O6T A;  1UVZ A;  2PU9 C;  3VI5 A;  1ZZY A;  22GS A;  3NIV A;  2ON5 A;  1GRX A;  3EMX A;  1YQ1 A;  2DML A;  5DBQ A;  1QGV A;  1JFU A;  3I9V 2;  5LD0 A;  1TI1 A;  2YZH A;  5J9C A;  5D9X A;  1MDI A;  1VF4 A;  1GSS A;  3D6I A;  1ERV A;  1BX9 A;  1O73 A;  3C7M A;  5AN1 A;  3UAR A;  3F3Q A;  3TKS A;  4K6X A;  2CA8 A;  1VF1 A;  4JE1 A;  4EDZ A;  2H1G A;  2QKE A;  4OD7 A;  2H6Y A;  2O7K A;  1V2A A;  1J9B A;  3IK7 A;  3IA1 A;  1LU4 A;  3TCO A;  4D73 A;  3HKR A;  2I9H A;  4WR5 A;  1S3A A;  1ZL9 A;  2H76 A;  4DEJ A;  12GS A;  1NW2 A;  1JZO A;  5IMF A;  3TKP A;  3DYR A;  2C0D A;  3LOR A;  4DVC A;  1TTZ A;  5ECH B;  2REM A;  3FY7 A;  3SWL A;  3ZMK A;  5DJM A;  3ERW A;  1TI3 A;  5LCZ A;  3CRT A;  1XW9 A;  5D93 A;  1KBN A;  4PTS A;  4HDE A;  1BYE A;  4ZIJ A;  3CQF A;  3UVT A;  3FEU A;  4GF0 A;  2N5F A;  1K0N A;  4KDU A;  3FRC A;  3GNJ A;  4MP4 A;  1M3I A;  2L6C A;  4TXV A;  2PGT A;  2WDU A;  1B9Y C;  2VL2 A;  2NBS A;  4FIW A;  2HXK A;  4TR3 A;  2LKU A;  2B3S A;  4KGI A;  4EUY A;  3L9U A;  4IP6 A;  4ZL9 A;  2JZS A;  4X43 A;  3KH7 A;  3U5R E;  1SYR A;  2AAW A;  3TB2 A;  1XVW A;  4K7I A;  3ED3 A;  2JAC A;  1GNE A;  5G1L A;  4KDY A;  3GX0 A;  5AIS A;  1N8J A;  4DSQ A;  3IC4 A;  3CBU A;  2JZT A;  1M9B A;  2M46 A;  5IPH A;  4N30 A;  2ON7 A;  1YDK A;  2IPA A;  2WS2 A;  4ULX A;  1UC7 A;  5ID2 B;  2FWH A;  2R3X A;  2K8S A;  2P5Q A;  1SEN A;  4ICY A;  1OC3 A;  3ZIV A;  4F82 A;  3ZYW A;  4FO5 A;  2IFQ A;  2LTK A;  4IQ1 A;  3EIN A;  2HI7 A;  4EL1 A;  2X8G A;  2EIO A;  1PMT A;  1YKC A;  2VAF A;  4TN8 A;  3CYN A;  1F9M A;  5DCG A;  2CVK A;  2H75 A;  4HSC X;  3HZ8 A;  4WKW A;  4KX4 A;  1XIY A;  4POM A;  1T8E B;  1HYU A;  2E2G A;  2JU5 A;  9GSS A;  3MIX A;  1X5E A;  1ILO A;  3GFK A;  2CZ3 A;  3TRX A;  1ZMA A;  5ABR A;  3HCZ A;  2PMT A;  4MF5 A;  3P8W A;  5AGY A;  3HVX A;  2K8V A;  3FR3 A;  2OA7 A;  2H30 A;  1PX6 A;  2HSY A;  1BQ7 A;  2CX4 A;  3D4M A;  3C1R A;  4MF6 A;  2H1A A;  3M9K A;  16GS A;  2GT6 A;  5BRT A;  5FT3 A;  2YV7 A;  4OCF A;  3IC8 A;  2RUE A;  1U87 A;  1PSQ A;  1PD2 1;  5KN3 A;  3QFB C;  3ZL5 A;  1DE2 A;  2VCX A;  1YEP A;  2AYT A;  1H75 A;  1AIU A;  2XBI A;  3G7I A;  4GSS A;  3QDN A;  1S3D A;  4YKF A;  1XWC A;  2DIY A;  1TK8 B;  4FYU A;  1O6J A;  4JZQ A;  4XIH A;  4ZL8 A;  3FK8 A;  1F37 A;  2VUP A;  4MH2 A;  4HU7 A;  2WJU A;  4IJ3 A;  1K3O A;  1MD4 A;  1XWK A;  1TP9 A;  1B4Q A;  4GRF A;  5DQY A;  4CHS A;  1MD3 A;  1MDJ A;  3F0I A;  3J7Y b;  3FW2 A;  3A3T A;  4IHU A;  4F2I A;  3GYK A;  5HFG A;  2OE1 A;  2TIR A;  3LQ7 A;  1NSW A;  3QOU A;  1TU7 A;  3LEF A;  1V9W A;  3GH6 A;  2GSS A;  4X1U A;  2G2Q A;  3VWW A;  3WGD A;  2CVD A;  3I6A A;  2IWT A;  1V58 A;  4MZB A;  4NV2 A;  1XWG A;  2GQL A;  3P90 A;  4ZBA A;  2FGX A;  1QMV A;  1RW1 A;  1TRU A;  3TUE A;  2X8C A;  2MMZ A;  2C4J A;  4YH2 A;  5ECR B;  2OAC A;  4E8E A;  1XOB A;  2B7J A;  2C0E A;  1XVQ A;  3D0Z A;  2QA1 A;  4OMV A;  2ES7 A;  4RQX A;  4IQA A;  5ECN B;  2VCZ A;  4N10 A;  1GUM A;  3GKM A;  4TVE A;  4V2L A;  1ACV A;  18GS A;  1FOH A;  2VCT A;  2X4A A;  1NHO A;  2FY6 A;  4AJ6 A;  3DEX A;  4HZ4 A;  4RUV A;  4QL9 A;  4JU5 A;  4BVY B;  1ZYE A;  2H01 A;  1T3B A;  3RPN A;  2R37 A;  1U3A A;  4TXO A;  3IDV A;  2KP1 A;  2CV4 A;  3MAK A;  4AGS A;  3UVH A;  3HVV A;  4KND A;  3FR6 A;  3TKQ A;  4MPG A;  2L59 A;  4HUA A;  4XRD A;  2YCD A;  5DAL A;  3GA4 A;  3GSS A;  4NWY A;  2J9H A;  5IMC A;  1RQM A;  2L5L A;  2R2J A;  5J9B A;  2I1U A;  4L0W A;  5CNW A;  2ZNM A;  2A2R A;  3EWL A;  3RAZ A;  2IL3 A;  2H66 A;  2WCI A;  1SKS B;  4EC0 A;  4ECC A;  2HE3 A;  4HS1 A;  1XWB A;  5HFI A;  3IOS A;  3N5O A;  1HNA A;  2KUC A;  3IBH A;  5ELG A;  4WF4 A;  1TOF A;  4KA0 A;  5IMA A;  5IO2 A;  1PN0 A;  1XW6 A;  5DJL A;  3FZ4 A;  1GSD A;  2EIQ A;  2DKH A;  3GUR A;  5KN2 A;  1EEM A;  5D73 A;  5KOX A;  2X8H A;  5G5F A;  3ZZX A;  4BL7 B;  1T7P B;  5DCH A;  1A2J A;  2OBI A;  1R5A A;  3BD2 A;  1A0R P;  1BJX A;  5IQY A;  2A4V A;  4OWY A;  2DJ3 A;  3IK9 A;  2N5A A;  3HZ4 A;  3IPZ A;  2PVO C;  3GKX A;  2LNS A;  4HOJ A;  3N9J A;  2H0H A;  3DXB A;  1GTA A;  2OE3 A;  3VWU A;  4TR0 A;  4F9Z A;  4IJI A;  3F6F A;  3LGC A;  1Q4J A;  3D5J A;  1G0T A;  5D9W A;  1XXU A;  4EE0 A;  3AY8 A;  2V32 A;  1VF2 A;  2AB6 A;  5CRH A;  3FMW A;  4MJE A;  4P3Y B;  3G9B A;  2WGR A;  1SK1 A;  4BWS A;  2OBK A;  1GLQ A;  2HRA A;  4FYC A;  2H72 A;  3DKS A;  2PER A;  3GIX A;  2X64 A;  1Z5Y E;  1EV4 A;  1K3Y A;  1V40 A;  5HR2 A;  4XCS A;  3EPT A;  1WIK A;  1OKD A;  2IME A;  4JBB A;  2RM6 A;  5INY A;  1XZO A;  1G7E A;  4BVX A;  4GWR A;  4WBJ A;  2NTO A;  2EC4 A;  3BBY A;  3FR9 A;  3ZLP A;  2O87 A;  1JZW A;  2RII A;  2R6K A;  1V98 A;  2OE0 A;  1FVK A;  2TRX A;  2DMM A;  3IR4 A;  1TRS A;  1I9D A;  4OFT A;  5JWO B;  3GN3 A;  3VK9 A;  4OO5 A;  4PQH A;  3QCP A;  1DUG A;  2PWJ A;  4TR1 B;  2GST A;  3VUR A;  3OR5 A;  1PKW A;  2FLS A;  2GDR A;  4EDY A;  4ZB6 A;  4G19 A;  4GTU A;  1XBS A;  1GH2 A;  4GST A;  2AV4 A;  4RI7 A;  1WWJ A;  2MBT A;  5KOW A;  1Z7R A;  2F3M A;  2FWG A;  4FYB A;  3HHV A;  4K5S A;  1IYI A;  3DRN A;  4TW5 A;  3ZRE A;  3MWH A;  11GS A;  4ML1 A;  4IBP A;  5ECK B;  2IMF A;  2ZCT A;  2HZE B;  5EL8 A;  3HJM A;  3Q74 A;  4YQV A;  5CRE A;  2PVQ A;  5B8B A;  2LS5 A;  1PQN A;  1QK8 A;  2H74 A;  1AAZ A;  2K6V A;  1PKZ A;  3UOM A;  3KD0 A;  4XTS A;  2WUL A;  3IAM 2;  1M99 A;  2LRT A;  1W4V A;  4EKZ A;  4PUR A;  3KH9 A;  4HQZ A;  3G7J A;  4NV5 A;  1JLW A;  2LEG A;  3I43 A;  4L0U A;  3DD3 A;  3FHK A;  3UEM A;  1CQH A;  2GZY A;  2K9F A;  5IMD A;  3KMN A;  1AC1 A;  4EXJ A;  2UZ8 A;  2VL3 A;  5KN0 A;  4OFM A;  4MZC A;  3ZRD A;  3D4T A;  1QFN A;  3W6G A;  1SD9 A;  4K0G A;  4RQR A;  5DAK B;  4NAX A;  2GLR A;  3DIE A;  5GZZ B;  3SBC A;  5G2Z A;  3APQ A;  3Q19 A;  2H1B A;  5FHI A;  4GQC A;  5GSS A;  1O7U A;  1N2A A;  1PN9 A;  1VRS D;  3P2A A;  2YWM A;  4G0L A;  7GSS A;  4IS0 A;  4ZBB A;  5D96 A;  2VCW A;  2JL4 A;  2C8U A;  3APS A;  1HQO A;  5EPF A;  3HVN A;  3U6V A;  5DDL A;  3IHQ A;  1Z7P A;  5GAP D;  1FG4 A;  3A2X A;  1XWA A;  1M2B A;  2B6M A;  5H5Q A;  3KCM A;  4ACS A;  3RBT A;  4I97 A;  1QUW A;  5IIZ A;  5C04 A;  1XG8 A;  3F3R A;  4O5Q A;  4PNF A;  1NM3 A;  1X5C A;  2GTU A;  1KTE A;  3H4K A;  3HYP A;  4H86 A;  4I5Q A;  1ERT A;  4GXZ A;  2WFC A;  3BCI A;  3PH9 A;  2X99 A;  3PPU A;  3RPP A;  3ZFB A;  2GGT A;  2IMD A;  2J23 A;  3CMI A;  5F06 A;  2BTO T;  5F0G A;  4TOP A;  4NMU A;  1ON4 A;  4Z2T A;  4V2M A;  2KLX A;  1J0F A;  1IYH A;  3CTG A;  4F0C A;  3ERF A;  4Q5R A;  4MAB A;  3DVW A;  2VO4 A;  4J57 E;  4K2D A;  5IMZ A;  3M0F A;  4POL A;  3ZML A;  2DJ1 A;  3TJJ A;  2V6K A;  3GTU A;  3GH9 A;  2GSR A;  2LRC A;  2R4V A;  3H8Q A;  1VF3 A;  2K18 A;  4NHW A;  4ZB8 A;  1YF0 A;  4YKG A;  4KAE A;  3US3 A;  3L78 A;  2B7K A;  4PUF C;  3E3E A;  3EUR A;  3HVS A;  3WGE A;  4IGJ A;  3GL3 A;  3GL5 A;  2WB9 A;  1R7H A;  2VCQ A;  6GSU A;  4GCI A;  3PIN A;  4NXI A;  4ECJ A;  2GZP A;  4XS4 B;  4MCU A;  2HT9 A;  2CAI A;  4IN0 A;  5A4V A;  5C00 A;  2FA8 A;  2YJ7 A;  2C3Q A;  4L5L A;  4K8M A;  4PXO A;  1AUC A;  1A23 A;  1ZOF A;  4N0V A;  1YY7 A;  3KM6 A;  1SL2 B;  4BIK A;  4EIP A;  4LL4 B;  4XRA A;  1TXX A;  4KH7 A;  2N5B A;  5JCW A;  3TJK A;  4G9H A;  2FNO A;  4A5P A;  1U88 A;  1ZYN A;  2IFQ B;  2VIM A;  4E8H A;  1GSF A;  5HFK A;  1EP8 A;  3GST A;  5ECS A;  1BG5 A;  5ELA A;  5GST A;  4ZBD A;  2GQM A;  6GSV A;  5ECO B;  1M2A A;  4IVF A;  1WE0 A;  4O92 A;  3TOT A;  5LNK e;  2YWO A;  1YEX A;  4L5O A;  3NZN A;  2IMK A;  2XBQ A;  1THO A;  2GZZ A;  5L71 A;  4G0I A;  2ZUP A;  4K5R A;  1Z6N A;  4HI7 A;  2H6Z A;  3UMA A;  1SJI A;  3MDK A;  2A2S A;  1FOV A;  3KP8 A;  4YQU A;  3ZIT A;  4MA9 A;  10GS A;  4HZ2 A;  4Q5Q A;  1Y6E A;  1BAY A;  3KXO A;  3LJR A;  4Z2U A;  2F51 A;  3HJO A;  3W8J A;  1R4W A;  1FHE A;  4KCA A;  2GQK A;  1XPV A;  1JLV A;  3BOA A;  1Q98 A;  3VPQ A;  2CQ9 A;  5CP1 A;  3K8N A;  1EV9 A;  4AJ7 A;  1K0A A;  5A4W A;  5CRD A;  1EOG A;  4WR4 A;  4ZIL A;  2JSZ A;  3LW9 A;  3MSZ A;  2R0C A;  3P7X A;  1XW5 A;  3BJ5 A;  1WP0 A;  1RK4 A;  2R0G A;  1TW9 A;  1AQX A;  1ERU A;  1HNB A;  2P5R A;  2CVB A;  17GS A;  3L0H A;  1ZYP A;  4IW9 A;  3KTB A;  3TKS C;  3O76 A;  1EWX A;  1O81 A;  5G31 A;  1SK0 A;  3Q6O A;  2CZ2 A;  2IJY A;  4F03 A;  5A4U A;  4KB3 A;  1TRW A;  3WT1 A;  2GT5 A;  1LJR A;  1W89 A;  1X9S B;  1SD8 A;  1F3B A;  5H5R A;  4LLR A;  2B5Y A;  2JZR A;  5HR0 A;  3JCM L;  4HJ2 A;  1SL1 B;  4TR4 A;  1XFL A;  2AUV A;  3IXR A;  2R0P A;  2B5E A;  1PGT A;  4POK A;  5F07 A;  4CW9 A;  4NPB A;  2YZU A;  1YJ6 A;  3M8N A;  2DJ2 A;  5KEJ A;  2EIR A;  3LSZ A;  3QR6 A;  1R26 A;  2ALB A;  1Y25 A;  4LA1 A;  4X0X A;  4I2T A;  6GSW A;  2I3Y A;  2MMO A;  4KUN A; 
#chains in the Genus database with same CATH homology
 1G6Y A;  6GST A;  4KW6 A;  4TR1 A;  2LUS A;  3A5W A;  3VWV A;  3HD5 A;  1YF1 A;  4MDC A;  4YAV A;  1TKD B;  3I69 A;  2VL2 C;  5FWG A;  3WD6 A;  2YAN A;  2V6O A;  4DSS B;  3RDW A;  2DSA A;  3GHA A;  2X49 A;  1ZGN A;  4QL7 A;  1FAA A;  1SKR B;  2VD1 A;  2IN3 A;  4TXO B;  4JED A;  2AHE A;  5AIX A;  5IMV A;  3HJP A;  1GTB A;  4PNG A;  2QSI A;  1FW1 A;  2BMX A;  3GX8 A;  1M9A A;  2L4Q A;  5CAX A;  1SJZ A;  3EU3 A;  1K0D A;  2VCV A;  5DAL B;  2P0G A;  4PUA A;  1U3I A;  1PRX A;  2L57 A;  4MF7 A;  1PA3 A;  5ENU A;  3KGK A;  3LXT A;  1ZYQ B;  1WPI A;  1YZX A;  1TDI A;  5IM9 A;  4ISD A;  2WZ9 A;  3LWA A;  5B7C A;  1I5G A;  2P31 A;  2PUK C;  1TRV A;  2VLT A;  2QC7 A;  3APO A;  2B1L A;  3GKN A;  2L6D A;  3WYW A;  3UBL A;  1U6T A;  5J4U A;  2VL9 A;  1GSU A;  2NDO A;  4HQS A;  2YN1 A;  1EP7 A;  3L4N A;  19GS A;  4CY6 A;  4OCE A;  4TRX A;  1ABA A;  3TJG A;  1EZK A;  2C0F A;  4O5U A;  1PX7 A;  4WET A;  3GMF A;  5BMU A;  4MJC A;  4X4J A;  1A24 A;  4LMW A;  4KF9 A;  3QD9 A;  5DAK A;  4DSR A;  3EVI A;  5HR1 A;  2MZC A;  1OVN A;  4MK3 A;  2V41 A;  4EVM A;  5H5S A;  2LJK A;  4PGT A;  1PL2 A;  3KMO A;  3A2V A;  4GLT A;  4BWQ A;  3EE2 A;  3J7Y k;  3LXZ A;  3FKF A;  4YAP A;  4MH3 A;  5JWQ B;  3DGQ A;  3M9J A;  3FYG A;  3C73 A;  4KCE A;  1X9W B;  5ECM B;  3C8E A;  1URM A;  1FB0 A;  5ID2 A;  5A5K A;  4G2E A;  1OC9 B;  2GVP A;  3VFI A;  3IRA A;  3HA9 A;  3TKS E;  4USS A;  4JRR A;  2OKA A;  5DQS A;  3VPT A;  1K0M A;  1S3C A;  2IMI A;  1MTC A;  2OJL A;  4J56 E;  4ECB A;  2FHE A;  1OYJ A;  3TJF A;  2XHF A;  2HSH A;  1XCC A;  3VLN A;  4IKH A;  4Q5F A;  2FD3 A;  1Z3E A;  1GWC A;  3DML A;  3UL3 A;  4N0Z A;  3FZA A;  2CT6 A;  2DIZ A;  3WGX A;  1FB6 A;  1T00 A;  4MJB A;  2VM1 A;  1JZD A;  1Z6M A;  3F4S A;  1SKW B;  4ZB9 A;  4BVX B;  1M7T A;  1G6W A;  2YP6 A;  3NOF A;  4IP1 A;  4WF5 A;  1TK5 B;  3H79 A;  1LBK A;  5G5E A;  1K0B A;  4KSO A;  1ML6 A;  3CSI A;  3UJ1 A;  4K7O A;  3F63 A;  4F0B A;  3M3M A;  1PL1 A;  3UBK A;  4O7H A;  2XPD A;  2VD0 A;  3HY2 A;  2JSY A;  1OC8 A;  2LJA A;  2LJR A;  1OE8 A;  1A8L A;  3L9S A;  5EY6 A;  1USB A;  1AQV A;  5KN1 A;  4YQM A;  4MZW A;  1EOH A;  1GP1 A;  3F4R A;  3G7Y A;  1B9X C;  3MYD A;  4GSN A;  3TJB A;  2L5O A;  3O3T A;  1A2L A;  2H8L A;  1C72 A;  1GSQ A;  4ILF A;  3HXS A;  5IOW A;  3CSJ A;  3TRP A;  2PPT A;  3QAV A;  2CX3 A;  2DLX A;  3DVX A;  4XS4 A;  3CSH A;  3ZVJ A;  3VI7 A;  2DBC A;  3BCK A;  4D73 B;  4G0K A;  2F8A A;  1SJ6 A;  5EVO A;  1DSB A;  4QQ7 A;  4ID0 A;  3F6D A;  4MJA A;  2H6X A;  1HD2 A;  1XOA A;  2FA4 A;  6GSX A;  3A2W A;  1AXD A;  4Q5N A;  2MBS A;  2H19 A;  4LMV A;  1TJD A;  2JAD A;  2M80 A;  1A0F A;  3VWX A;  1K3L A;  1ERW A;  2O85 A;  2M72 A;  4L8E A;  4MMM A;  1UN2 A;  3V1W A;  5B6M A;  4FQU A;  1GL8 A;  3RHB A;  4KE3 A;  6GSY A;  4Z2R A;  3R3E A;  2DJJ A;  1X9M B;  2MMA A;  3UIW A;  1V57 A;  3CRU A;  3IAS 2;  2LNT A;  2VLV A;  2VM2 A;  2HLS A;  1WJK A;  1UA5 A;  2C0G A;  2MYG A;  1Z9H A;  4RI6 A;  2KHP A;  3IE3 A;  1B8X A;  4PX1 A;  3ERG A;  5COH A;  2F8F A;  2OAD A;  1MDK A;  4V1A g;  2YNX A;  3M1G A;  6GSS A;  4EO3 A;  5DVB A;  3KIJ A;  2VLU A;  4V2N A;  1OKT A;  1JHB A;  1KNG A;  4EF0 A;  1MEK A;  4POB A;  5ECP B;  2A2P A;  2QA2 A;  2RUF A;  1GSY A;  2YJH A;  3LFL A;  3ZFL A;  1CQG A;  2NVL A;  5JCG A;  3WT2 A;  2FCH A;  4BA7 A;  1EEJ A;  2TRC P;  3F9U A;  3LYP A;  4BVY A;  3KJY A;  3TKR A;  1TU8 A;  2DJ0 A;  5IPG A;  4MNN A;  2F9S A;  2YPM A;  3IHG A;  3PGT A;  2YOI A;  4XS1 A;  4Z7X A;  2FWF A;  2XPE A;  4IEL A;  1GTI A;  5E4W A;  1WOU A;  3KTL A;  2HSM A;  1T4Y A;  1FO5 A;  1KEB A;  1GUL A;  3KEB A;  5GAN D;  1T4Z A;  3QAW A;  2H0G A;  3GV1 A;  4XHM A;  5J5N A;  3E0U A;  4WXT A;  3PR8 A;  2RM5 A;  5J41 A;  1YKA A;  3ZIJ A;  5CRW A;  5HQP A;  2AJQ B;  5HR3 A;  4OFN A;  2LQO A;  1GLP A;  2B1K A;  3UAP A;  4XS6 A;  3ME7 A;  1SYX A;  4EIQ A;  2E2M A;  1X0R A;  3C1S A;  1O8X A;  4CY8 A;  3C71 A;  4JR6 A;  1F3A A;  4ML6 A;  20GS A;  2DKI A;  1F2E A;  4BL7 A;  3GUS A;  2H1D A;  3QMX A;  1HNC A;  1SU9 A;  3EYT A;  2VOC A;  1E6B A;  1H4O A;  3KP9 A;  4K1F A;  4PQ1 A;  3GTU B;  2NPB A;  2A4H A;  4KDX A;  2KP2 A;  2HRF A;  3D21 A;  1O8W A;  2XC2 A;  5CYY A;  2YWI A;  1GSE A;  2RLI A;  3H93 A;  1VGL A;  4N11 A;  4TKY A;  5JWR B;  8GSS A;  4K7N A;  1A2M A;  5B6N A;  1SL0 B;  1BED A;  14GS A;  2GS3 A;  4K9Z A;  4DSS A;  2FWE A;  3CTF A;  2R5G A;  3MNG A;  1AW9 A;  3A5I A;  4CDO A;  4JR4 A;  1NHY A;  2H70 A;  2O89 A;  1WRY A;  2YV9 A;  3CXG A;  1K0O A;  4MPF A;  5CRG A;  2PN8 A;  4OO4 A;  3FZ5 A;  4V1A p;  5ECQ B;  3TDG A;  1GTU A;  4K2X A;  5F8B A;  1GUK A;  2I4A A;  4I8B A;  2QGV A;  5J3R A;  2H0I A;  4ZXG A;  1M2D A;  1DBY A;  4I6X A;  1GNW A;  2DC5 A;  2HRN A;  2V2G A;  4BPY A;  2C3N A;  3TRQ A;  3F8U A;  1WMJ A;  2CAQ A;  1TK0 B;  3QAG A;  13GS A;  4MLY A;  4J2F A;  3QFA C;  3W8S A;  2BJX A;  4FH8 A;  3ZTL A;  2H73 A;  2LQQ A;  3H1N A;  3F4T A;  4NHZ A;  3LG6 A;  3HDC A;  5JCU A;  5D9V A;  2C1Y A;  2HZF A;  1A8Y A;  3E9J B;  5AIV A;  3R2Q A;  5IO0 A;  4O32 A;  2HYX A;  2KOK A;  1SK2 A;  3FZ9 A;  3TGZ A;  2YWN A;  1JZR A;  5B8A A;  5E59 A;  1DE1 A;  1OAZ A;  1E2Y A;  4I2U A;  1THX A;  2LV3 A;  3EMP A;  4O5R A;  5G1K A;  4HU9 A;  1FVJ A;  5D8I A;  2C3T A;  4WBR D;  3ZVJ D;  3EU4 A;  5CO3 A;  2IIY A;  5ECI B;  4AJ8 A;  1T1V A;  2DJK A;  4G10 A;  2LRN A;  3L9V A;  3GRX A;  4ECI A;  4AF2 A;  3GKK A;  5ECL B;  2HNL A;  4K0N A;  2B5X A;  4WEY A;  1B48 A;  2GSQ A;  3S9F A;  5G30 A;  3EC3 A;  4GQF A;  2C80 A;  2E7P A;  3D22 A;  3Q18 A;  4HEA 2;  2HZE A;  1F6M C;  1OC9 A;  1O85 A;  2MMN A;  1J08 A;  4HJM A;  2WRT A;  2I81 A;  1B4P A;  1EGO A;  1AQW A;  5D9T A;  2D2Z A;  5F05 A;  1G7O A;  2E0Q A;  1EGR A;  1QQ2 A;  3ME8 A;  2HRK A;  1X5D A;  2PBJ A;  3KZQ A;  4KSM A;  1R5P A;  3RHC A;  2O8V B;  3IV4 A;  4LL1 B;  1K0C A;  3DWV A;  2H71 A;  2V1M A;  3QPM A;  3LYK A;  2L4C A;  2LST A;  1M0U A;  3TOU A;  2FUG 2;  3ISO A;  4ZL7 A;  1OE7 A;  2HFD A;  1GUH A;  2Z9S A;  1QXH A;  1ST9 A;  5IOX A;  4PQI A;  2G0F A;  1ZCP A;  3O6T A;  1UVZ A;  2PU9 C;  3VI5 A;  1ZZY A;  22GS A;  3NIV A;  2ON5 A;  1GRX A;  3EMX A;  1YQ1 A;  2DML A;  5DBQ A;  1QGV A;  1JFU A;  3I9V 2;  5LD0 A;  1TI1 A;  2YZH A;  5J9C A;  5D9X A;  1MDI A;  1VF4 A;  1GSS A;  3D6I A;  1ERV A;  1BX9 A;  1O73 A;  3C7M A;  5AN1 A;  3UAR A;  3F3Q A;  3TKS A;  4K6X A;  2CA8 A;  1VF1 A;  4JE1 A;  4EDZ A;  2H1G A;  2QKE A;  4OD7 A;  2H6Y A;  2O7K A;  1V2A A;  1J9B A;  3IK7 A;  3IA1 A;  1LU4 A;  3TCO A;  4D73 A;  3HKR A;  2I9H A;  4WR5 A;  1S3A A;  1ZL9 A;  2H76 A;  4DEJ A;  12GS A;  1NW2 A;  1JZO A;  5IMF A;  3TKP A;  3DYR A;  2C0D A;  3LOR A;  4DVC A;  1TTZ A;  5ECH B;  2REM A;  3FY7 A;  3SWL A;  3ZMK A;  5DJM A;  3ERW A;  1TI3 A;  5LCZ A;  3CRT A;  1XW9 A;  5D93 A;  1KBN A;  4PTS A;  4HDE A;  1BYE A;  4ZIJ A;  3UVT A;  3FEU A;  4GF0 A;  2N5F A;  1K0N A;  4KDU A;  3FRC A;  3GNJ A;  4MP4 A;  2L6C A;  4TXV A;  2PGT A;  2WDU A;  1B9Y C;  2VL2 A;  2NBS A;  4FIW A;  2HXK A;  4TR3 A;  2LKU A;  2B3S A;  4KGI A;  4EUY A;  3L9U A;  4IP6 A;  4ZL9 A;  2JZS A;  4X43 A;  3KH7 A;  3U5R E;  1SYR A;  2AAW A;  3TB2 A;  1XVW A;  4K7I A;  3ED3 A;  2JAC A;  1GNE A;  5G1L A;  4KDY A;  3GX0 A;  5AIS A;  1N8J A;  4DSQ A;  3IC4 A;  3CBU A;  2JZT A;  1M9B A;  2M46 A;  5IPH A;  4N30 A;  2ON7 A;  1YDK A;  2IPA A;  2WS2 A;  4ULX A;  1UC7 A;  5ID2 B;  2FWH A;  2R3X A;  2K8S A;  2P5Q A;  1SEN A;  4ICY A;  1OC3 A;  3ZIV A;  4F82 A;  3ZYW A;  4FO5 A;  2IFQ A;  2LTK A;  4IQ1 A;  3EIN A;  2HI7 A;  4EL1 A;  2X8G A;  2EIO A;  1PMT A;  1YKC A;  2VAF A;  4TN8 A;  3CYN A;  1F9M A;  5DCG A;  2CVK A;  2H75 A;  3HZ8 A;  4KX4 A;  4WKW A;  1XIY A;  4POM A;  1T8E B;  1HYU A;  2E2G A;  2JU5 A;  9GSS A;  3MIX A;  1X5E A;  1ILO A;  3GFK A;  2CZ3 A;  3TRX A;  1ZMA A;  5ABR A;  3HCZ A;  2PMT A;  4MF5 A;  3P8W A;  5AGY A;  3HVX A;  2K8V A;  3FR3 A;  2OA7 A;  2H30 A;  1PX6 A;  2HSY A;  1BQ7 A;  2CX4 A;  3D4M A;  3C1R A;  4MF6 A;  2H1A A;  3M9K A;  16GS A;  2GT6 A;  5BRT A;  5FT3 A;  2YV7 A;  4OCF A;  3IC8 A;  2RUE A;  1U87 A;  1PSQ A;  1PD2 1;  5KN3 A;  3QFB C;  3ZL5 A;  1DE2 A;  2VCX A;  1YEP A;  2AYT A;  1H75 A;  1AIU A;  2XBI A;  3G7I A;  4GSS A;  3QDN A;  1S3D A;  4YKF A;  1XWC A;  2DIY A;  1TK8 B;  4FYU A;  1O6J A;  4JZQ A;  4XIH A;  4ZL8 A;  3FK8 A;  1F37 A;  2VUP A;  4MH2 A;  4HU7 A;  2WJU A;  4IJ3 A;  1K3O A;  1MD4 A;  1XWK A;  1TP9 A;  1B4Q A;  4GRF A;  5DQY A;  4CHS A;  1MD3 A;  1MDJ A;  3F0I A;  3J7Y b;  3FW2 A;  3A3T A;  4IHU A;  4F2I A;  3GYK A;  5HFG A;  2OE1 A;  2TIR A;  3LQ7 A;  1NSW A;  3QOU A;  1TU7 A;  3LEF A;  1V9W A;  3GH6 A;  2GSS A;  4X1U A;  2G2Q A;  3VWW A;  3WGD A;  2CVD A;  3I6A A;  2IWT A;  1V58 A;  4MZB A;  4NV2 A;  1XWG A;  2GQL A;  3P90 A;  4ZBA A;  2FGX A;  1QMV A;  1RW1 A;  1TRU A;  3TUE A;  2X8C A;  2MMZ A;  2C4J A;  4YH2 A;  5ECR B;  2OAC A;  4E8E A;  1XOB A;  2B7J A;  2C0E A;  1XVQ A;  3D0Z A;  2QA1 A;  4OMV A;  2ES7 A;  4RQX A;  4IQA A;  5ECN B;  2VCZ A;  4N10 A;  1GUM A;  3GKM A;  4TVE A;  4V2L A;  1ACV A;  18GS A;  1FOH A;  2VCT A;  2X4A A;  1NHO A;  2FY6 A;  4AJ6 A;  3DEX A;  4HZ4 A;  4RUV A;  4QL9 A;  4JU5 A;  4BVY B;  1ZYE A;  2H01 A;  1T3B A;  3RPN A;  2R37 A;  1U3A A;  4TXO A;  3IDV A;  2KP1 A;  2CV4 A;  3MAK A;  4AGS A;  3UVH A;  3HVV A;  4KND A;  3FR6 A;  3TKQ A;  4MPG A;  2L59 A;  4HUA A;  4XRD A;  2YCD A;  5DAL A;  3GA4 A;  3GSS A;  4NWY A;  2J9H A;  5IMC A;  1RQM A;  2L5L A;  2R2J A;  5J9B A;  2I1U A;  4L0W A;  5CNW A;  2ZNM A;  2A2R A;  3EWL A;  3RAZ A;  2IL3 A;  2H66 A;  2WCI A;  1SKS B;  4EC0 A;  4ECC A;  2HE3 A;  4HS1 A;  1XWB A;  5HFI A;  3IOS A;  3N5O A;  1HNA A;  2KUC A;  3IBH A;  5ELG A;  4WF4 A;  1TOF A;  4KA0 A;  5IMA A;  5IO2 A;  1PN0 A;  1XW6 A;  5DJL A;  3FZ4 A;  1GSD A;  2EIQ A;  2DKH A;  3GUR A;  5KN2 A;  1EEM A;  5D73 A;  5KOX A;  2X8H A;  5G5F A;  3ZZX A;  4BL7 B;  1T7P B;  5DCH A;  1A2J A;  2OBI A;  1R5A A;  3BD2 A;  1A0R P;  1BJX A;  5IQY A;  2A4V A;  4OWY A;  2DJ3 A;  3IK9 A;  2N5A A;  3HZ4 A;  3IPZ A;  2PVO C;  3GKX A;  2LNS A;  4HOJ A;  3N9J A;  2H0H A;  3DXB A;  1GTA A;  2OE3 A;  3VWU A;  4TR0 A;  4F9Z A;  4IJI A;  3F6F A;  3LGC A;  1Q4J A;  3D5J A;  1G0T A;  5D9W A;  1XXU A;  4EE0 A;  3AY8 A;  2V32 A;  1VF2 A;  2AB6 A;  5CRH A;  3FMW A;  4MJE A;  4P3Y B;  3G9B A;  2WGR A;  1SK1 A;  4BWS A;  2OBK A;  1GLQ A;  2HRA A;  4FYC A;  2H72 A;  3DKS A;  2PER A;  3GIX A;  2X64 A;  1Z5Y E;  1EV4 A;  1K3Y A;  1V40 A;  5HR2 A;  4XCS A;  3EPT A;  1WIK A;  1OKD A;  2IME A;  4JBB A;  2RM6 A;  5INY A;  1XZO A;  1G7E A;  4BVX A;  4GWR A;  4WBJ A;  2NTO A;  2EC4 A;  3BBY A;  3FR9 A;  3ZLP A;  2O87 A;  1JZW A;  2RII A;  2R6K A;  1V98 A;  2OE0 A;  1FVK A;  2TRX A;  2DMM A;  3IR4 A;  1TRS A;  1I9D A;  4OFT A;  5JWO B;  3GN3 A;  3VK9 A;  4OO5 A;  4PQH A;  3QCP A;  1DUG A;  2PWJ A;  4TR1 B;  2GST A;  3VUR A;  3OR5 A;  1PKW A;  2FLS A;  2GDR A;  4EDY A;  4ZB6 A;  4G19 A;  4GTU A;  1XBS A;  1GH2 A;  4GST A;  2AV4 A;  4RI7 A;  1WWJ A;  2MBT A;  5KOW A;  1Z7R A;  2F3M A;  2FWG A;  4FYB A;  3HHV A;  4K5S A;  1IYI A;  3DRN A;  4TW5 A;  3ZRE A;  3MWH A;  11GS A;  4ML1 A;  4IBP A;  5ECK B;  2IMF A;  2ZCT A;  2HZE B;  5EL8 A;  3HJM A;  3Q74 A;  4YQV A;  5CRE A;  2PVQ A;  5B8B A;  2LS5 A;  1PQN A;  1QK8 A;  2H74 A;  1AAZ A;  2K6V A;  1PKZ A;  3UOM A;  3KD0 A;  4XTS A;  2WUL A;  3IAM 2;  1M99 A;  2LRT A;  1W4V A;  4EKZ A;  4PUR A;  3KH9 A;  4HQZ A;  3G7J A;  4NV5 A;  1JLW A;  2LEG A;  3I43 A;  4L0U A;  3DD3 A;  3FHK A;  3UEM A;  1CQH A;  2GZY A;  2K9F A;  5IMD A;  3KMN A;  1AC1 A;  4EXJ A;  2UZ8 A;  2VL3 A;  5KN0 A;  4OFM A;  4MZC A;  3ZRD A;  3D4T A;  1QFN A;  3W6G A;  1SD9 A;  4K0G A;  4RQR A;  5DAK B;  4NAX A;  2GLR A;  3DIE A;  5GZZ B;  3SBC A;  5G2Z A;  3APQ A;  3Q19 A;  2H1B A;  5FHI A;  4GQC A;  5GSS A;  1O7U A;  1N2A A;  1PN9 A;  1VRS D;  3P2A A;  2YWM A;  4G0L A;  7GSS A;  4IS0 A;  4ZBB A;  5D96 A;  2VCW A;  2JL4 A;  2C8U A;  3APS A;  1HQO A;  5EPF A;  3U6V A;  5DDL A;  3IHQ A;  1Z7P A;  5GAP D;  1FG4 A;  3A2X A;  1XWA A;  1M2B A;  2B6M A;  5H5Q A;  3KCM A;  4ACS A;  3RBT A;  4I97 A;  1QUW A;  5IIZ A;  5C04 A;  3F3R A;  4O5Q A;  4PNF A;  1NM3 A;  1X5C A;  2GTU A;  1KTE A;  3H4K A;  3HYP A;  4H86 A;  4I5Q A;  1ERT A;  4GXZ A;  2WFC A;  3BCI A;  3PH9 A;  2X99 A;  3PPU A;  3RPP A;  3ZFB A;  2GGT A;  2IMD A;  2J23 A;  3CMI A;  5F06 A;  2BTO T;  5F0G A;  4TOP A;  4NMU A;  1ON4 A;  4Z2T A;  4V2M A;  2KLX A;  1J0F A;  1IYH A;  3CTG A;  4F0C A;  3ERF A;  4Q5R A;  4MAB A;  3DVW A;  2VO4 A;  4J57 E;  4K2D A;  5IMZ A;  3M0F A;  4POL A;  3ZML A;  2DJ1 A;  3TJJ A;  2V6K A;  3GTU A;  3GH9 A;  2GSR A;  2LRC A;  2R4V A;  3H8Q A;  1VF3 A;  2K18 A;  4NHW A;  4ZB8 A;  1YF0 A;  4YKG A;  4KAE A;  3US3 A;  3L78 A;  2B7K A;  4PUF C;  3E3E A;  3EUR A;  3HVS A;  3WGE A;  4IGJ A;  3GL3 A;  3GL5 A;  2WB9 A;  1R7H A;  2VCQ A;  6GSU A;  4GCI A;  3PIN A;  4NXI A;  4ECJ A;  2GZP A;  4XS4 B;  4MCU A;  2HT9 A;  2CAI A;  4IN0 A;  5A4V A;  5C00 A;  2FA8 A;  2YJ7 A;  2C3Q A;  4L5L A;  4K8M A;  4PXO A;  1AUC A;  1A23 A;  1ZOF A;  4N0V A;  1YY7 A;  3KM6 A;  1SL2 B;  4EIP A;  4LL4 B;  4XRA A;  1TXX A;  4KH7 A;  2N5B A;  5JCW A;  3TJK A;  4G9H A;  2FNO A;  4A5P A;  1U88 A;  1ZYN A;  2IFQ B;  2VIM A;  4E8H A;  1GSF A;  5HFK A;  1EP8 A;  3GST A;  5ECS A;  1BG5 A;  5ELA A;  5GST A;  4ZBD A;  2GQM A;  6GSV A;  5ECO B;  1M2A A;  4IVF A;  1WE0 A;  4O92 A;  3TOT A;  5LNK e;  2YWO A;  1YEX A;  4L5O A;  3NZN A;  2IMK A;  2XBQ A;  1THO A;  2GZZ A;  5L71 A;  4G0I A;  2ZUP A;  4K5R A;  1Z6N A;  4HI7 A;  2H6Z A;  3UMA A;  1SJI A;  3MDK A;  2A2S A;  1FOV A;  3KP8 A;  4YQU A;  3ZIT A;  4MA9 A;  10GS A;  4HZ2 A;  4Q5Q A;  1Y6E A;  1BAY A;  3KXO A;  3LJR A;  4Z2U A;  2F51 A;  3HJO A;  3W8J A;  1R4W A;  1FHE A;  4KCA A;  2GQK A;  1XPV A;  1JLV A;  3BOA A;  1Q98 A;  3VPQ A;  2CQ9 A;  5CP1 A;  3K8N A;  1EV9 A;  4AJ7 A;  1K0A A;  5A4W A;  5CRD A;  1EOG A;  4WR4 A;  4ZIL A;  2JSZ A;  3LW9 A;  3MSZ A;  2R0C A;  3P7X A;  1XW5 A;  3BJ5 A;  1WP0 A;  1RK4 A;  2R0G A;  1TW9 A;  1AQX A;  1ERU A;  1HNB A;  2P5R A;  2CVB A;  17GS A;  3L0H A;  1ZYP A;  4IW9 A;  3KTB A;  3TKS C;  3O76 A;  1EWX A;  1O81 A;  5G31 A;  1SK0 A;  3Q6O A;  2CZ2 A;  2IJY A;  4F03 A;  5A4U A;  4KB3 A;  1TRW A;  3WT1 A;  2GT5 A;  1LJR A;  1W89 A;  1X9S B;  1SD8 A;  1F3B A;  5H5R A;  4LLR A;  2B5Y A;  2JZR A;  5HR0 A;  3JCM L;  4HJ2 A;  1SL1 B;  4TR4 A;  1XFL A;  2AUV A;  3IXR A;  2R0P A;  2B5E A;  1PGT A;  4POK A;  5F07 A;  4CW9 A;  4NPB A;  2YZU A;  1YJ6 A;  3M8N A;  2DJ2 A;  5KEJ A;  2EIR A;  3LSZ A;  3QR6 A;  1R26 A;  2ALB A;  1Y25 A;  4LA1 A;  4X0X A;  4I2T A;  6GSW A;  2I3Y A;  2MMO A;  4KUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...