4FA3A

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with (r)-1-(naphthalen-2-ylsulfonyl)piperidine-3-carboxylic acid (86)
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
317
structure length
305
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title 3-(3,4-Dihydroisoquinolin-2(1H)-ylsulfonyl)benzoic acids; a New Class of Highly Potent and Selective Inhibitors of the Type 5 17-beta-hydroxysteroid Dehydrogenase AKR1C3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 114
structure length 305
sequence length 317
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4fa3A00
2FZBA 3V36A 3BUVA 1GVEA 3WBYA 3BV7A 2ISFA 2J8TA 1IEIA 4LAZA 2IKHA 2WZMA 4L1WA 4YS1A 3WCZA 2ACQA 4FAMA 5C7HA 2C91A 1AZ1A 3CV7A 3CMFA 3RX2A 3EAUA 4FALA 3DN5A 1XJBA 3MB9A 3H7RA 4JTAA 1Q13A 4GIEA 2NVDA 3RX3A 1ZQ5A 1X98A 3V0TA 3UGRA 3UG8A 3KRBA 2R9RA 3LZ3A 4JIHA 4YVPA 4JQ4A 2IS7A 2PDKA 2PDGA 2ACRA 1EF3A 4LAUA 4HMNA 4QX4A 4WDWA 4IJCA 1OG6A 2CLPA 1FRBA 2QXWA 3O3RA 2PDPA 3M64A 1S2AA 1YNPA 2PDBA 5LIKX 4LBRA 3CV6A 4JQAA 3WG6A 2FGBA 3NTYA 1AZ2A 3G5EA 4PUWA 1MI3A 4JTRA 2R24A 2IPJA 3RX4A 1X97A 4EXAA 4NKCA 4H8NA 3BURA 5AZ0A 4XVDA 4LB3A 3CAQA 3COTA 4XZMX 1HQTA 4RPQA 4I5XA 4R9OA 3LUTA 5M2FX 2PFHA 3UP8A 2ACUA 3D3FA 1S1PA 1YNQA 2I16A 2PF8A 1K8CA 1MZRA 4ZFCA 4JQ3A 3MC5A 2PDHA 4AUBA 4QXIA 3UFYA 4HBKA 1S2CA 2PDXA 3Q65A 4MHBA 1SM9A 4PMJA 1QWKA 4OTKA 2IPFA 4XZIA 1XGDA 3N6QA 3S3GA 5LIXX 3M0IA 2PDIA 2FZ9A 4QBXA 2PEVA 1Z3NA 2IPGA 2BGSA 4H7CA 2I17A 1Z8AA 1YE6A 1Q5MA 4FZIA 3R58A 1IHIA 4XK2A 4DBSA 3B3DA 3C3UA 2DV0A 1PZ0A 4XAPA 4JQ1A 4YU1A 2FZDA 4PR4A 4DZ5A 2HEJA 1HW6A 3F7JA 1AH3A 2INEA 1LWIA 1M9HA 3LN3A 1S1RA 4GACA 2BGQA 3ONBA 3R8HA 1T40A 2AGTA 2HVOA 4YVXA 3LENA 5JH1A 3Q67A 1EL3A 3U2CA 5HNTA 4ICCX 4GCAA 5KETA 4JTQA 3DOPA 2PDJA 1Z89A 4XVEA 1LQAA 4WDUA 4G5DA 5JH2A 4LB4A 1PWMA 2PD5A 2BP1A 1US0A 2HE8A 4L1XA 3R43A 2PDNA 2DUXA 3O0KA 2A79A 3R8GA 4FA3A 2F2KA 4GA8A 1VP5A 3UZWA 3VXGA 2PD9A 4XO6A 3GHSA 3UWEA 3GHRA 1ADSA 3LEPA 3GHTA 3LZ5A 2F38A 3ONCA 4YVVA 4DBWA 2IKGA 5DANA 4ASTA 2PDWA 4EXBA 1PYFA 3V35A 2PDQA 1J96A 3WBXA 3R7MA 5AZ1A 3V0UA 3P2VA 1XF0A 4JTDA 3QKZA 3UZYA 4PUUA 2PDLA 4GABA 4IGSA 5HNUA 5HA7A 1AH4A 3WBWA 3BCJA 4DBUA 3LQGA 2PDFA 4XO7A 1UR3M 4JTCA 3H7UA 3V0SA 4WGHA 1VBJA 4XZNX 1AH0A 2IQ0A 2PDMA 3UZZA 5LIUX 2IQDA 1RY8A 2ALRA 1EXBA 5LIYX 1YE4A 1ZUAX 1R38A 2HV5A 1RALA 3LD5A 4PRRA 3N2TA 4XZHA 4F40A 4JIIX 1T41A 2ACSA 3G1RA 1JEZA 3EB3A 2WZTA 2FZ8A 4WDXA 3R94A 3LNMA 2IKJA 3EB4A 3CASA 3LQLA 1C9WA 3ERPA 1PZ1A 3GHUA 2FVLA 4Q7BA 4WDTA 2IKIA 4JQ2A 3M4HA 3GUGA 4XZLX 1EKOA 4QR6A 3UZXA 1RY0A 3CAVA 1AFSA 2VDGA 2INZA 2HDJA 2IPWA 2PZNA 4PRTA 1QRQA 2PDYA 2PDCA 2NVCA 1A80A 2PDUA 1MRQA 4IJRA 4GQ0A 2P5NA 1ZSXA 3H4GA 3R6IA 4LBSA 2HE5A 3UYIA 4WEVX 3T42A 4Q3MA 1Z9AA 1PWLA 2HVNA 3FJNA 4GQGA 1X96A 5LIWX 1ZGDA 4JIRA 3LBOA 2DUZA 3FX4A 4WRHA
chains in the Genus database with same CATH superfamily
1Z6KA 4O57A 4O4VA 2J25A 1H5VA 4LAZA 3ZJ6A 1ZLPA 1QHOA 4L1WA 3RU6A 4F66A 1K6AA 2OLHA 3N2XA 5AYBA 3W6LA 2J9XA 3WJWA 2Z6JA 1IEVA 4J3WA 3GG8A 3IIPA 4YTQA 1I75A 4PUMA 1TMQA 4RR4A 1TPFA 1F61A 3KRBA 3OVRA 2IS7A 2PDKA 5L6UA 2A3BA 3VE7A 3A9IA 1E6XM 5AHIA 1FTXA 2X7VA 3R4IA 3TYDA 1ICSA 3ARVA 3WUBA 1V3HA 3SZ8A 2NWSA 4Y6GA 2C13A 1JDCA 3QSTA 1KBKA 5DFAA 3S2NA 2WZIA 1TSIA 1ME9A 7ENLA 1BPLB 5T91A 3N14A 2WHJA 2PS2A 4LS2A 3CAQA 4E5TA 1WZMA 2GL5A 5D02A 3T0TA 2WANA 4EE9A 2F6XA 1ONEA 4AVOA 3EWDA 3TQKA 1UKOA 4GQBA 2VEPA 4RUBA 4L80A 1XRTA 3E5BA 3TROA 2E7FA 4M6QA 3SECA 2PF8A 2ZWYA 4QLJA 1W1TA 3TA9A 4FNUA 4NX0A 3EOUA 2X1UA 1B3XA 2XH2A 3NUKA 3ARQA 1JI2A 4R7JA 4AG0A 2FH6A 1LG1A 4K3ZA 3H12A 3EA2A 3IJLA 3S5NA 4A3QA 3AHZA 1KC7A 1KW1A 1ELSA 3NQEA 5LIXX 2I7GA 3RUBL 4CNSA 1T96A 4UTWC 3SIMA 1O12A 3OVPA 4C6CA 5G4WA 4B16A 4GH3A 4LVAA 3CK5A 2HZGA 1H1YA 4RCXA 1M01A 4B5VA 1BVWA 4FXSA 3NVTA 5CZSA 1SW7A 4B4FA 3EKGA 1TPUA 4DYKA 1US2A 2WMJA 3SFKA 3WNPA 1HKVA 1DIDA 5A6LA 1CPUA 3NZ1A 1LWIA 3ARSA 2V2HA 2AQVA 4MUZA 4IOTA 2CZDA 5DCEA 3VDGA 4NI8A 3WH5A 3F5LA 4GZIA 1NDVA 3BL3A 4JNMA 4ZO6A 4R7OA 4O8RA 1F73A 4QNEA 1FY6A 3BLEA 4HOXA 4JTFA 1IR1A 1JCXA 2EBNA 4KFPA 1US0A 1B31A 3QGKC 3HQ1A 2WSPA 3VGBA 4IP5A 4MB5A 4BI7A 3W2LA 1GYMA 2F2KA 4GA8A 2IQTA 5ABFB 3THCA 3MYPA 1W3HA 3VXGA 3RJYA 3K4WA 3VNDA 1B3ZA 3W22A 7REQB 3OLDA 5A1AA 4G7FA 2W6RA 4FNTA 2RDWA 3EWCA 2OODA 4TMCA 3AU2A 3F5JA 2Q09A 4O13A 2X41A 3UWEA 1XC4A 3PBYA 3WH7A 2OZ0A 2OT0A 8XIMA 1RA5A 3C52A 3GAKA 3I6TA 1XBXA 1LBFA 1LYXA 5FACA 3N12A 2G3JA 3MYOA 3WEMA 3VNYA 3W0KA 1Q6GA 5ABTA 4U3AA 3EKZA 3ABQA 3NO5A 1HJVA 3MA8A 5EPDA 3NPVA 1DWIM 3MUAA 4S3FA 2NSOA 3UZYA 2I5IA 5BXTA 1GOXA 4N02A 3ISIX 3GLCA 3CEPA 2DIKA 3SRFA 4XO7A 1SMDA 2PC8A 3BQ6A 3KBMA 3L4TA 3W37A 3L5MA 1TCDA 2GJPA 2L5HA 3V0SA 1VBJA 3VMPA 3I3EA 4AY7A 4S3BA 3BSGA 2CLEA 4IFKA 4R88A 3U5YA 1BAGA 4ICNA 1J2WA 3BG3A 3UY7A 4C6NA 2CERA 3FN9A 2OCZA 3T78A 4XKMA 4HU4A 1KLZA 4PRRA 3N2TA 1ITUA 4XZHA 2CU0A 3S5YA 2X30A 2R91A 5E09A 3QPEA 4QGCA 3N04A 2ZA2A 1E6SM 1ZB5A 1DJHA 4LU0A 5BU6A 2VDIA 2WMGA 3EDJA 1DJNA 2X1SA 1KTBA 1OT1A 1OGSA 3SEPA 4J40A 1C9WA 4TV6A 5DRCA 3PVFA 4MTVA 5DO8A 1JF5A 4UC5A 1BSIA 4J9JA 3ZFHA 4UOJA 4H9YA 3RK8A 2VEIA 2WJZA 1LCOA 2V67A 3PZVA 4GC4A 3BXWA 3L4UA 4MLJA 5AVNA 4OBSA 1EZ2A 3PZOA 3M6DA 5B80A 3SCRA 4M19A 5JBEA 4AFYA 4IM4A 4BY3A 2PDCA 1W3IA 4JKLA 4KPLA 5C2XA 2PDUA 2P5NA 4GNJA 4O1BA 1BTCA 2J9YA 4LALA 1TE6A 3UF9A 1OX4B 1MNSA 3T4CA 5AHFA 4Q3MA 3POHA 1BQGA 1EDTA 4DJFA 1DTNA 4HN4A 1IGSA 4X60A 4RXFA 1TR1A 2VR5A 2XM2A 4I90A 5KZDA 1HJQA 4ZXOA 1EA9C 4C6LA 2EG8A 2GDQA 1L8PA 4GO8A 5K2ZA 1UROA 2DU2A 1CDGA 2CBJA 1J0HA 2V2CA 2EJAA 4S39A 5I3HA 1FCQA 4GG9A 4O17A 1LT8A 3PULA 2VEMA 3KHJA 3D5HA 4PTVA 2G3NA 3EWZA 5I2UA 1QNSA 4YL2A 4NZCA 3TMQA 6REQB 3AC0A 2RH9A 2Z24A 5ECVA 1K8XA 4MY9A 4H41A 3KVKA 5G2WA 1ESWA 3TYBA 4PFHA 1UWSA 1KKOA 1VD6A 4ZSUA 4KH2A 5A6JA 1K6WA 1GKQA 3EX1A 4M6VA 3UG8A 3WK1A 3MSGA 3TZNA 5A6BD 3FA5A 1B54A 2R9RA 1JPIA 1MYRA 2KAUC 1EF3A 3V1PA 5I06A 3UNDA 3W29A 1TB3A 1JZ8A 1DQUA 4AVFA 1O94A 4PL1A 2CLKA 4QISA 3GU9A 3SB0A 3KTXA 2WSKA 3KL5A 3U7VA 5LIKX 5FSDC 4PMUA 1AQMA 4RW3A 2PE4A 4BS0A 3NTYA 4PZVA 4GYFA 3WMLA 2ADAA 2ASHA 1V6YA 1IIGA 2BFGA 3S47A 2HK0A 4EXAA 1XIEA 3TR2A 2OR2A 4H8NA 3BURA 1HUVA 1B9ZA 3JRKA 1S2WA 4LPCA 1EGZA 3FXYA 3DFOA 3HMJG 2YGYA 2ZXQA 4JKKA 1RXOB 4YN5A 2NZLA 1H1ZA 1V6VA 2PLJA 5I23A 3CM4A 4N9BA 3UWVA 4WOQA 4AZ7A 5I3KA 4FR1A 1GOMA 1REQA 4LF2A 3MUXA 3UA3A 4DNMA 5HNRA 3OBEA 3AXIA 4WKHA 1FWSA 3VX1A 2W27A 1JUKA 3M0IA 1EJSC 4Y8FA 5JVLA 4WXZA 4EAYA 3UY8A 4RE0A 1JUBA 1QHPA 1EQCA 2ALDA 3M5XA 2NV2A 4U33A 2YA1A 3WNMA 2DZBA 2V3FA 3K1GA 2D0HA 2BZNA 1V6XA 4EPBC 1ALDA 4OGZA 3A22A 3EDFA 4MB3A 4XBKA 5F2IA 3ZJ7A 1R7OA 4YU1A 3O2LA 5KSWA 2GSEA 2WBKA 1PV8A 1XG4A 4D1JA 3CEUA 3N9SA 1J0YA 4QCEA 4FSAA 3UG5A 2ZC8A 1WX0A 3I4EA 3UJEA 1XI3A 1W1YA 4QIUA 2J79A 1LWHA 5TBOA 3VTRA 1TV5A 4GRSA 4QSHA 5F4XA 2Y70A 4HK5A 3K1DA 3TEVA 3EMCA 4GCAA 4QS5A 2VOMA 1I9CB 4JTQA 4PN2A 3H54A 4JPGA 2Z1BA 4LB4A 3VO0A 4LY8A 3E5PA 1I45A 5GPRA 4G7EB 3LPPA 5DCBA 4X0NA 1FWIC 4G6CA 4L7ZA 3CJPA 4E0CA 5I24A 2PTYA 4D2JA 2A3CA 1PTDA 1IXQA 3MTWA 2WPBA 2ABAA 2O7QA 3ABRA 5C9XA 2Y7DA 3TA6A 4O52A 3ZR5A 3DYPA 4NY2A 4F0SA 2D3LA 4KEMA 2J62A 4C1NA 4WSKA 3T40A 3DFTA 3SAZA 2DT3A 4Q7NA 4DNHA 3O6CA 3FHAA 3V35A 3PR2A 4CN6A 1VIWA 1HKJA 1ML1A 1MQPA 4MMWA 3UT0A 2C1HA 3P62A 4PMQA 1VAHA 3UWWA 1GVYA 2POTA 3BGAA 2VVSA 4H6EA 1GVOA 3DFYA 3LRLA 3P0WA 6TAAA 2FMOA 5F2LA 3STGA 4PTMA 3LX9A 3HG3A 1FQ0A 4D6HA 4DI8A 1C8QA 4BFAA 2X7WA 4PMXA 1CW2A 1R86A 1LQ2A 5IFPA 3S2CA 1GVIA 1UR3M 1TJ0A 3EOEA 4JTCA 2VDHA 3FYOA 3PNUA 1CTNA 3NOEA 5A2AA 4V1YA 4O15A 2INFA 1H7RA 4Y96A 2FPTA 4GI9A 1SZFA 4B90A 5FL1A 4V33A 1F6YA 2DZUA 4HNLA 2EPKX 4CUCA 3QTPA 1NWRA 1R38A 1RALA 4QNWA 1A5NC 4E2VA 3O0FA 2YOCA 4WVXA 4JIIX 1T41A 2VQTA 1VPXA 2HCVA 3G1RA 3BLFA 5DBTA 1Q6DA 1G4PA 1OB0A 3WJYA 3TWBA 4NAEB 2Y5JA 1HF6A 4S3EA 5J8LA 1TX2A 3UCCA 3NSMA 1EJXC 1XX1A 5FJUA 4AD5A 1K4GA 1LG2A 3KXQA 1R0MA 3PG9A 3WDRA 4AVNA 1G1YA 2PLCA 4ZGYA 1O1ZA 1M65A 2BMBA 1XCFA 1HKMA 3W86A 1VLWA 5E70A 1SR9A 3GXIA 1ZENA 1QI3A 2CKRA 3Q58A 2QAPA 3GTNA 6CGTA 2DFAA 1MXGA 1VENA 5DT5A 3G1VA 4MWAC 4NXSA 4IL0A 2A6NA 2OKOA 1AVAA 1L0PA 2O4QA 2YLLA 3G1SA 5E9AA 3GU2A 3VDBA 1SZGA 4PMNA 4MAZA 1TVNA 1O95A 1Z9AA 2OLSA 2Q02A 2B0MA 1EO7A 3ZS4A 3R0UA 3W2NA 4IUOA 1IF2A 4W87A 5FKYA 1TPVA 4ZOCA 3IVSA 5HJXA 3HV9A 4HK7A 3KL0A 2OQLA 1GKRA 5FJRA 5EL1A 5E6ZA 1RQHA 1V5XA 3WFAA 1BKSA 4US5D 4J5NA 4FLRA 2QV5A 4CNUA 1U22A 4IISA 1OM0A 3M0JA 1PCKA 4XX6A 1UR2A 2ISFA 2J8TA 1XIBA 1G6CA 3PPHA 2F84A 1O60A 2WZMA 4YS1A 4OV4A 2PWVA 2CPUA 2AKZA 4JDBA 2PMQA 1UH4A 3P82A 1KTCA 4A3RA 4DM1A 2OKTA 1VJSA 2AL1A 1KGXA 3M0KA 3NURA 1TPEA 1ITCA 2OEJA 3CMJA 1V4YA 5AFDA 1ZJAA 3VIPA 1LOSA 3H8AA 1F4AA 3IANA 1KM0A 1ZQ5A 5C2GA 5FF0A 4KETA 1WV2A 1W5OA 3EX6A 3AALA 3AIRA 2WW5A 1NVMA 1VHNA 1M7JA 2PDGA 3WNNA 3ANVA 1T8QA 3MMUA 4HU8A 3WF1A 4XD4A 3GVRA 1IQ8A 3B8TA 1EJTC 4NJIA 2P1FA 2HS8A 3ES8A 1KM6A 1AQ0A 1U5JA 1EBHA 4RV3A 3S8HA 4UTFA 1RLDA 3AHXA 5FAJA 3CZEA 1XQKA 1R2RA 1UP3A 3GNRA 4I9TA 1JZ7A 1H41A 3C8NA 1A5KC 1XSIA 1QPQA 5H91A 4CU7A 1GT8A 3H2FA 4K1WA 2YDQA 2YFNA 5AC6A 1KKRA 1PZ2A 3QMSA 3AAMA 5A8NA 2WZEA 2PA6A 2YX0A 5J5DA 2W3ZA 1I2OA 4M3PA 4G56A 3WN6A 1FWRA 4I5UA 2BS9A 4Z08A 4LXFA 1TIMA 3A4WA 4H9TA 4HNOA 2I57A 2DJLA 3P7YA 1MZRA 3N4FA 3VOJA 1ENUA 1V6TA 3BW4A 1W1A1 1TA3A 3N2CA 4A2SA 3IIZA 3MUIA 4FR6A 1LP6A 4UMCA 5DXYA 3WH6A 1TX0A 3E1F1 3N3TA 5T9CE 5AC5A 4HSNA 1P7TA 1TJPA 4W93A 1Z48A 2W4XA 3SCWA 3S3GA 5HAOA 4PULA 2ZX5A 2OZ8A 4L6OA 3U3HA 6PTDA 3UXDA 1ODZA 1YE6A 3WMSA 4DF1A 2Y7GA 1VKFA 2QGHA 3QZAA 3S2LA 4UQ9A 2I9UA 1D7FA 1GPWA 1J01A 1EIXA 2QUTA 4UNKA 2QCEA 3CUHA 4IXXA 3NQ6A 2QCLA 9XIAA 1X6NA 5REQB 4QJ1A 2NV9A 4IICA 1LM1A 3IAQA 1Z69A 4HZ8A 2WC7A 2PSNA 4NX5A 1JZ4A 4O10A 5BU9A 4EACA 4U5IA 1R3WA 3PZ9A 1E4MM 2FZMA 3L4XA 4DN1A 3RR1A 4CKQA 4XQ6A 1W31A 3HG5A 4LUJA 1CXIA 3PPFA 5BROA 1IXNA 2QUNA 3VIJA 3FVDA 2WXDM 5KEZA 4WY0F 1Q66A 3ARTA 2C8NA 2VVNA 5F4WA 1JZ6A 1KM5A 1UWUA 3CZLA 1P48A 9XIMA 2R1LA 2ZVRA 3L2IA 4WY0B 1GUVA 3H6OA 1YMYA 3M7SA 2GUYA 3KDOA 3PANA 2E5DA 1PO9A 3PSWA 3F2DA 3L4YA 3PNZA 3BZJA 2GZXA 3GKFA 4ERGA 4XAZA 5A8QA 2W67A 3A4XA 1F76A 4D72A 4PMOA 2RDUA 3IJ6A 1TJ2A 2R1KA 4NU7A 5JUVA 5C9RA 2DVTA 1W6TA 3HPAA 3EDDA 2NX9A 4ERIA 1B90A 5CSYA 1M7OA 1K77A 1UBSA 2PDQA 1YKWA 1ZBVA 1S2TA 1KBLA 1QFEA 1J4EA 1J0ZA 3SJ3A 3C61A 3M5YA 2C1GA 4NZ4A 4DPQA 3UJFA 1QI4A 3IK4A 4UFLA 1QI5A 3I7SA 5EBAA 3STCA 2GQ8A 3S2MA 1UKQA 2FHBA 1HKWA 3GVQA 3HJZA 4U5KA 3KTCA 2PP3A 1GJUA 4CNOA 5A8MA 4XUGA 3WELA 4OZOA 3KOZA 2ALRA 1OY0A 4IT1A 1W0MA 3QF0A 3VKCA 2Y88A 3NQVA 2G0WA 3LGEA 5BXRA 2ZXBA 4TMBA 3NQCA 4F40A 3KL3A 1XYZA 1H7PA 3WQDA 4C90A 2ATSA 1JEZA 3EWXA 4ZQMA 2I56A 4PMVA 3M9YA 4UR7A 2XVPA 4JTUA 2R94A 2Y63A 4WDXA 4AF0A 4KF1A 4UOZA 1TV4A 3AYTA 3RIKA 1NOFA 3EB4A 3WJXA 1PZ1A 4JXCA 4IPJA 1LLOA 3WQPA 4UTWA 3LM7A 2ZZ2A 4C7DA 1RD5A 4DQWA 1M04A 3KRUA 1DJZA 3H2NA 4QR6A 4ATWA 1W37A 2J74A 2QCDA 3CAVA 1AFSA 2INZA 3O7UA 3UVAA 1OFQA 2ZUWA 4Q8QA 4F0HA 1EF2A 1VRXA 3UPBA 1DKWA 1A49A 3DUGA 4QQ3A 1ZAIA 2PTWA 3QMTA 1YADA 2E5CA 4AZCA 3HQPA 2FIQA 3TTYA 2VP8A 4LY4A 4AX7A 3OQEA 3N11A 1HP4A 3AIVA 4H6QA 2G50A 2J27A 4FNQA 4YXGA 1WCGA 5BW6A 4KWVA 1TPDA 3F5KA 3S5ZA 2V3EA 3SUTA 3UR8A 2Y5SA 2YPIA 4GH1A 4ADTA 1W9VA 1BYBA 5D9OA 5T8GA 4BR1A 1HJSA 2ZQ0A 3KBWA 1UWIA 3C2YA 4GO9A 1WYIA 4GYKA 1LRQA 5M03A 3IGSA 4TQTA 4MNKA 3P8IA 3EX3A 1EO5A 1BEUA 4LAMA 4R3UA 4UMBA 1W1ZA 3TSBA 1BG9A 4PSRA 1YTEA 5LNSA 3ARWA 5BWAA 5I3IA 1DP0A 4A22A 2YBUA 3T0BA 3S1VA 3LBMA 4KEUA 3LXCA 1JD9A 2WJEA 3RX3A 4AIEA 1KBBA 3SUUA 1IEXA 3KLKA 1JZ3A 1XQLA 2CETA 4JIQA 4Z1YA 1T8XA 5I7GA 5IDIA 3W70A 3C2EA 3SCOA 4JQ4A 4FLOA 4IH3A 1FKWA 1JCJA 1B30A 2RGMA 3TYUA 3EMZA 2QIWA 4O8AA 2LLEA 2G3FA 3U8GA 3KE0A 1OCQA 2FGBA 3JVAA 5A69A 5PTDA 3TDFA 2DT1A 4EWJA 1YRRA 4ZB5A 3KOXA 3WYZA 1QW8A 4JEJA 5CBBA 4GY1A 1SYTA 2YDSA 3GO2A 1GHRA 3SBFA 3N34A 1HZYA 5D30A 2V5CA 3B06A 1VS1A 4IQDA 1YW1A 3LHZA 2DZTA 4H8VA 3LUTA 3ZM8A 4M80A 1H11A 5CH9A 5T26A 2FGLA 4FI4A 3PN8A 4AIUA 3WF0A 3MC5A 4KWSA 1LOQA 4RE3A 1WAWA 3N13A 3H7VA 1EGMA 2FGZA 4I6VA 3TOPA 3GC4A 4IZGA 5HNNA 4K36A 3WQGA 2QJMA 3I3DA 3PWIA 1U83A 2Y6ZA 1J5TA 3AICA 4W89A 7CGTA 1H0GA 5EMMA 3WQOA 2BTMA 1IT7A 4I8DA 3NQ8A 3BE7A 1ME8A 1E43A 1F6KA 7A3HA 2PDIA 3K8MA 3S42A 7ODCA 1S39A 2W62A 4CN1A 3R0KA 4HHMA 3TX9A 4AZIA 2J6XA 3W1UA 3R58A 5H2ZA 3HOJA 5I3DA 4GY7A 1VZWA 2RDTA 3K30A 3GIYA 4DLMA 2EO7A 2PZ0A 4BKNA 3NEHA 1JXJA 1EEPA 3CHFA 3VIFA 1RHCA 2KZHA 1ZJHA 1DXEA 4PH6A 4GACA 3W1NA 4N9EA 5EFFA 1G69A 1KRMA 2YW3A 4ZVJA 4LNCA 2W79A 4Q4RA 4Z2GA 1JGMA 3U2CA 3KVJA 3N29A 5HMFA 2CCRA 1V3KA 3MSDA 4H3DA 4M24A 2VZOA 5KETA 3F4CA 4XUYA 1LQAA 4DWSD 4WDUA 1TQJA 5LNRA 1E55A 1E0WA 3DX5A 4U3CA 2QS8A 3TVAA 1BTMA 4E8GA 2H9AB 4OV9A 5C70A 2PGEA 1OX6A 3O0KA 3CH9A 2P10A 2D0GA 2FFCA 5DMYA 4F2TA 4Z2HA 3B0VC 3VX0A 1SPQA 1WDRA 4KESA 2WMIA 1RJPA 1BXNA 3EPOA 3T0CA 2Y8VA 4GC3A 1ISYA 1RJRA 1D9EA 4PFMA 1V0NA 2R8WA 5BOFA 1QNPA 3WJZA 4AHOA 3R0DA 2XIBA 4DWDA 3NZPA 3FSTA 4KBXA 5GQBA 4N42A 1P1MA 4J3SA 3BC9A 1JVNA 3RPDA 1A3HA 1W3LA 3GQYA 3TKFA 4IJBA 4P8XA 2ZUSA 3CUZA 2C7FA 4U10A 1PKNA 4QG9A 1G94A 4LS1A 1DHPA 3L7RA 4JFSA 1H4PA 3WL0A 4TVUA 1CWYA 1C92A 3CQKA 3BOLA 3RMJA 4UQEA 1R30A 1BVNP 4OU1A 5G2IA 3KW3A 4GY0A 3C2FA 3CU2A 5HNUA 2XZ9A 4BF5A 1J5SA 3WUFA 2QV4A 1WKYA 2Z4GA 4DXXA 5EMJA 2G4FA 3IIOA 2I5QA 4N7QA 1D8CA 2RDXA 4Q4SA 4WLCA 1U5HA 4JBRA 2CHNA 3GG7A 3QRHA 5JBDA 3SN1A 3CQHA 3K8LA 2ACSA 3LCFA 1S2VA 4CEUC 5AYIA 5EMLA 1HT6A 5HK4A 1XKJA 2ZRVA 3VABA 1BF6A 3R94A 2YL9A 4HPNA 3QQ1A 1O68A 3VC5A 1EGVA 1OCJA 2YYTA 5JXQA 2YA0A 1FCUA 2CWNA 1EEXA 1V77A 3WNLA 5K4XA 2Z28A 1I2PA 3M0VA 4MOZA 1DJYA 3GDLA 4AQLA 3NQBA 1KFEA 4LRSA 3P8JA 3LNPA 3NQ2A 3P61A 1V79A 1K7XA 4LOCA 1TPB1 4US6A 3W00A 1I60A 2ZX8A 2J66A 2X0SA 1W9BM 1E4LA 1PHQA 4GVFA 1GEQA 1ZSXA 8TIMA 5C9WA 1FCBA 4D6JA 3AISA 4IIBA 1FFRA 3R6IA 4HNNA 5DRIA 2DSWA 2XGBA 3OZOA 1S5WA 3T42A 4IMDA 1KCXA 3ZJ8A 2ZA1A 3QTGA 2DH3A 1HX0A 3T09A 1XYMA 3AI0A 2DSZA 2OB3A 4NZ1A 4LVFA 2ZUMA 1MUMA 1RCOB 3SSJA 3LHVA 4WRHA 2C0AA 3IJ7A 4NILA 5ENLA 2V3GA 1VBUA 2VZUA 3WQ6A 1SJAA 3H23A 4RE2A 5D2TA 1ADOA 4Q4OA 2YBVA 3QLLA 5FF3A 4H83A 4LV4A 3KRZA 1CBGA 3TN5A 3FV9A 4N6FA 5DT7A 3T0DA 3CZJA 1XJBA 1YBQB 4L9YA 1GYNA 1UKTA 4AD2A 4DAIA 1GNXA 2EAWA 1GK8A 3HG4A 3UZ5A 1EZWA 3CWHA 4AZ5A 3TYCA 3ZT5A 3HV8A 3USBA 2VC7A 4HCHA 5EYWA 2O4MA 1FBAA 2I14A 1E5NA 4GX8A 4XD6A 2OZ3A 3T0AA 1DYSA 2CLPA 1NARA 2ZZ4A 2QXWA 3VD4A 4QS6A 5D9PA 2PDPA 3EOLA 4JTGA 3FA3A 3LLFA 1VBHA 4A05A 3K4AA 1VFOA 2C79A 3SUVA 1PYMA 1TFVA 4ZTXA 1CI1A 2Z29A 2NXGA 4ROPA 4C6MA 3VMOA 4Z42C 4S3DA 2CKSA 4S3KA 3EXSA 2A7RA 4L5ZA 4LVDA 3WK3A 3B8WA 3KBSA 3NQFA 4R9OA 1OHLA 1NH6A 1OSEA 3QLDA 3GR4A 2WWCA 3WENA 4ZB2A 4Z1BA 3HM7A 1XRFA 1XKYA 3VYLA 4XZBA 1UUQA 3ITOA 1ISZA 4ZOAA 1OYAA 3GVWA 3HJEA 5D2VA 1VFHA 2CESA 2A5HA 3G1DA 3W82A 4C6EA 3PUDA 1PIIA 4ZEPA 1GHSA 3ZLGA 1XGDA 3QQ0A 2OYKA 3VNMA 3LMYA 3NYDA 3CZGA 4F0MA 4XKYB 2P0IA 3IGXA 4JTTA 4A3UA 4I8YA 3VGFA 3GB6A 1ICPA 1QTWA 1Y5XA 4AC7C 1F3XA 2XIJA 1RP9A 1I2RA 4MWAA 4FMVA 1PHWA 2PWEA 3O63A 3OQ8A 1J12A 3ALFA 5KZ6A 1C9DA 3PJWA 3HO8A 3JUGA 2QLYA 3B8SA 3F7JA 4LUSB 1MNZA 2G95A 4JICA 4YLWA 2OVLA 3VDCA 2DW6A 5CZ0A 4ZCWA 4KMQA 4V28A 3GUWA 4G9PA 2AGTA 1Y0EA 4D9PA 1XLEA 3PWGA 2Q8ZA 5D2WA 3S46A 2Z2UA 1E0TA 5LGZA 1MW2A 3N1AA 3BOXA 1GTEA 4DXVA 1X1OA 1A4LA 1LLWA 4UCGA 2YL6A 5FEPA 2W9MA 5CPNA 3KLLA 5LNUA 4P7QA 1M5WA 3CAKA 2ZC1A 1AODA 5M3WA 3N15A 4IGNA 3R8GA 4PB4A 4PMZA 3UPWA 4OOZA 5BMWA 5CGTA 3SGGA 5E9XA 3IJDA 4B3KA 4CCZA 2DZAA 1M3UA 4JY9A 3GHSA 1MDLA 4QDMA 3OW1A 1KFWA 4WX2A 1GG1A 3W7KA 5CSRA 2UY3A 2DY3A 3CL7A 1Y7VA 3PBVA 3EX4A 5CSUA 3LGDA 4Z1DA 2VGBA 3K4DA 3MU7A 3H2CA 4DLFA 3UR7A 1KO0A 5D2XA 4O18A 4ASTA 2WHKA 3LXBA 5AC8A 4KWWA 3I3BA 3PZQA 3LLXA 3WBXA 3D3AA 5EU9A 1UYQA 3DI1A 3WKZA 3AWOA 3DFNA 4H8HA 3II1A 3TXZA 1A4MA 3PM6A 3OBKA 3LI0A 3BV4A 1JL8A 1ZNNA 3MI6A 3NZQA 1FXQA 1VC4A 4NL1A 3LG3A 3HPSA 2IXUA 3WLRA 5HUPA 3BANA 3N9KA 3WLHA 4HCDA 1TPWA 3VIIA 4RZ4A 2J78A 2UY5A 5BWFA 3VU2A 2FB2A 1I1XA 3CL6A 1UIPA 3T55A 3NFUA 2TYSA 1DTUA 3C3NA 2WAGA 3O8AA 1EXBA 1M7PA 3ATZA 5MHBA 5F7UA 2PF0A 2CITA 1V6WA 2GVLA 4D8AA 3TAKA 3ITVA 1YXCA 3LCGA 3URAA 2DIEA 2V5DA 1IZJA 1TWWA 4P7LA 2Y4SA 1WDDA 3T2PA 2P88A 5EBUA 2WZTA 3E96A 4RZ5A 2FZ8A 2VX4A 3N2BA 1PCWA 1F5ZA 4MGGA 1M41A 4GNVA 3TLLA 2IKIA 5HMEA 3NVDA 3H22A 2VQUA 3NPWA 3TE9A 2ZZ1A 1G67A 4ZZ9A 3VPLA 3L4WA 1DIKA 2QCNA 2A3AA 3G3MA 4ZOBA 2BDQA 2J47A 3VUPA 3RLGA 4TV5A 1A80A 4DAFA 3LLDA 5CPQA 4BJHA 1VBRA 5G5IA 1V7YA 4IMGA 4N4QA 1QBBA 2ESCA 3MDWA 4GIYA 5C9ZA 1EP3A 1B3WA 3SM0A 3TC3A 5A95A 1XIMA 4GFIA 4WEVX 1E9LA 4UTIA 3CZKA 2PU1A 4XAGA 3PS7A 4IMFA 1X1ZA 4L1GA 3U4FA 1F6PA 1XGZA 3QFEA 2Z2AA 2PTDA 3V4BA 2QCFA 3VVGA 1NF7A 3RDKA 1SMAA 1VFSA 1ZBKA 4DX3A 4S1FA 2FZBA 2XH0A 3EWYA 4C1LA 4JIPA 3WLLA 2YB4A 4HSOA 3VCRA 2E3ZA 4ZSTA 4LYRA 4RLIA 5H8PA 3O05A 3DG7A 1Q8JA 4MJ4A 1W5PA 4W8BA 2ACQA 3BCDA 5C7HA 1C8YA 3CV7A 1V51A 3RX2A 4ZL1A 3QN3A 4WD0A 3V5FA 2X1IA 1GQNA 1XG3A 4ZO9A 1N82A 2PGRA 1POKA 1GCYA 3CO8A 1E0UA 4B91A 4ATDA 4D6FA 4RK8A 1A53A 2QF8A 4CNPA 1L2UA 1IE7C 1QBAA 3I7QA 4Q6JA 3RJXA 3GK0A 1VBGA 3CT2A 3QW4B 5MKGA 1K1DA 2F7FA 4HYRA 4J3VA 1CECA 1R3YA 1DORA 2PBGA 3SUWA 3M64A 5DELA 2F6KA 3ABOA 1NWTA 2Z1SA 2Z1VA 4NNCA 3AJXA 2OXNA 1G4SA 3AYSA 4H2HA 4Z0SA 2B7QA 4NKCA 5LA2A 2WCGA 2AMXA 2O55A 3A3XA 4MB1A 2FJKA 4MYXA 1T5AA 2VELA 3VOFA 1E73M 3SY8A 3OZPA 1CGXA 1FDJA 3CB8A 3ORWA 4DY1A 1P43A 1UMLA 4JCMA 4L9XA 1UP2A 3UP8A 3W7MA 3PJXA 2JF7A 3T44A 3G1YA 1UH2A 2PTXA 4PGLA 3C2RA 1H49A 2ZRWA 3W4RA 1D3GA 2PC4A 5A2CA 4HN8A 1CLVA 3QJAA 3Q65A 4ACZA 2GJXA 1LUCA 4ALDA 4DJFD 2IPFA 4FX7A 4RNJA 1Q3NA 5CPSA 1ISVA 1NQ6A 4Z2JA 2PBOA 4Y9AA 5C54A 3ZMRA 5FEZA 3W76A 4O53A 3CH0A 5CCZA 4HSHA 2IPGA 5AHEA 1WZLA 2QJNA 1FCVA 4KKXA 4NXKA 3IGUA 1H63A 3BICA 1OYCA 4FZIA 4KT2A 1E70M 4DBSA 4XD5A 2FTYA 3S2JA 4RDVA 4K7VA 3KRSA 2F9RA 3L12A 5U4NA 4ZOEA 3SO7A 2QUMA 4BQ2A 3WY1A 3RG6A 4ZO7A 3E0IA 3M44A 2JGQA 3HFTA 3K5XA 5HBFA 1Q6RA 4UOQA 3R2GA 3QYQA 4NQ1A 2FPYA 1FHUA 1UW9A 2EPLX 4GKLA 3HTWA 1EUAA 3XISA 4HTYA 4EPEC 6XIMA 3B9DA 2OX1A 4QP0A 3VGGA 3PZGA 1X39A 1KA9F 4UQCA 4O28A 1Q6FA 1SFTA 4XVEA 1OF6A 5IFTA 5JH2A 3F4DA 2J24A 3JZEA 4PTWA 1JZ2A 1JUEA 4W7VA 3W7EA 1P0NA 1KQZA 3WZ0E 3G18A 3HF3A 4XIMA 4MPQA 4O0KA 4MVAA 1GOOA 3EWBX 1AL8A 1XDMA 4C6JA 3U4AA 3GS6A 3W6YA 2V63A 1J8VA 3C0QA 1N8IA 4LWWA 5M5DA 4NYUA 4EVZA 3A4JA 2YFOA 2YCLA 1WZAA 4GNKB 2GLKA 1TMLA 3UA4A 3TW6A 5BCAA 3PZNA 2DT2A 1W3NA 3LM3A 4OKDA 3H2MA 3NQDA 1E1CB 1PYFA 3M0HA 5ABEA 2BODX 5EMKA 3R7MA 2J7FA 4FNPA 4Y9PA 2O92A 1QOQA 1U30A 4UQDA 4F4RA 2Q8LA 5EKYA 4B2DA 4PUUA 4GABA 1WDQA 3VD3A 4NZ3A 2ZVIA 1H2JA 4IIEA 4X2RA 2CZFA 4HNTA 3EA1A 4MAVA 2DEPA 4GWEA 1DXFA 3CNYA 4HQVA 1P6CA 3VNLA 3BDKA 2GGHA 4XZNX 2IQ0A 1UG6A 3NG3A 4M8UA 2VFHA 2WYSA 3AFBA 3W7HA 1WB0A 4O16A 3OGSA 5DXXA 3AHVA 3LTYA 1SU5A 3S6DA 3LYEA 2X1TA 2WJFA 4B92A 3C2OA 2PLMA 4EXQA 1E1EA 1JNDA 3JZUA 2DSKA 4R85A 2V5KA 2VC6A 3ABZA 4C6PA 2VZTA 3W88A 1KD0A 3A12A 1PIGA 1OFEA 4ZE4A 4Z2KA 3MPGA 3C0LA 5HPOA 4HPGA 3S1XA 5IXEA 2VR4A 4K7YA 2NUYA 4L61A 3U7BA 3M4HA 3DESA 4U31A 2JGYA 4EPDC 3SFWA 1XINA 3PUGA 4HIBA 3PJTA 4QJ4B 3EBVA 1OFBA 2VDGA 1AMKA 4RZBA 4XZWA 3NQ7A 5D37A 3KHDA 5CLWA 2C18A 1CB7B 4OUIA 4LC8A 3QC0A 3ZVHB 3OHMB 4M29A 3ARPA 2HXUA 4GQ0A 2X8RA 2CIPA 5LZLA 4Q8VA 2XVKA 4EOUA 3LPGA 2AMGA 2QJJA 4KCUA 1FWAC 4W88A 3MHUA 1K9FA 3UYIA 3TV8A 4A8LA 2VRQA 4YHEA 1Q6CA 3MV01 2HTMA 3DH7A 1K7EA 1WBHA 4EX4A 1SFJA 3GBEA 4UZSA 1IV8A 3KBVA 1NTHA 1UQYA 4Q8MA 5KINA 1KBJA 3MSRA 3AZTA 2NT1A 3RILA 1VYRA 3N19B 1CENA 1XYLA 2A3HA 2YZ5A 1V0LA 5HANA 1RBLA 3BV7A 2XHYA 4KCTA 1QHZA 4F0RA 3GH5A 2HMCA 1CLXA 2BV9A 4UNIA 5AN7A 4B5XA 3GX9A 2B7OA 4L9ZA 4Q7IA 5A6BA 3GR7A 3PC0A 3OB8A 4Q4KA 1FHVA 1PKMA 5A8PA 1MXDA 2PCEA 3QPYA 3CPGA 5AHLA 3MKCA 1HL2A 5ABHA 4MADA 1F3EA 3NDOA 1EB3A 4IX0A 3OU8A 4ATLA 1RVKA 2NXIA 4DO4A 3WD3A 1QXLA 1VR6A 2AOSA 5G2HA 4WDWA 1K70A 2ZXDA 4LV9A 4X9YA 5AC7A 5DMNA 1OIMA 5ABGA 3BLOA 3GXNA 1UA3A 4GI6A 4V2XA 1W2VA 4E4UA 3R1ZA 1KV5A 3CV6A 3W2MA 2GOUA 3WG6A 4FX8A 3GZ3A 1HNYA 1MI3A 4KIEA 4GX9A 1X97A 2YKKA 1TUFA 4NJGA 1I6NA 3GG0A 4J2PA 1UZ1A 3IV8A 1HFBA 1FWWA 4HA1A 5ABFA 1XRSA 3QV7A 2VX6A 3TCEA 4S2CA 4XZMX 7REQA 3TR9A 2CBVA 3OVGA 4HNUA 1I1WA 3E2VA 4CEXC 3M6YA 5FI8A 3AWNA 2PFHA 5DF0A 1QU4A 1DWFM 5EGRA 2EGZA 3L4ZA 2ZE3A 4ERAA 2A3LA 5A5WA 5LXXA 3ZR6A 3VKBA 5AYYA 3MDUA 4MHBA 4GJIA 3S1WA 3WQFA 3QBUA 3M0LA 4W85A 1GTHA 2VZVA 4GVGA 5FSEC 5HR7A 3OBAA 4WXYA 1Q4NX 3AQUA 2VO5A 1TVLA 2VD8A 1OZQA 3FVMA 1JAEA 4LUTB 4DJED 2OPJA 3CHCA 3FLUA 4NG3A 1ZPTA 1DIOA 1W9PA 1YLVA 1HJUA 1P4CA 4OUEA 3B03A 4FIRA 5F1VA 4CQ9A 2FZDA 3EXRA 5HWJA 1S5NA 4L6HA 1A5BA 4IQLA 4ICMA 1W2PA 1YDOA 5JBFA 3SGZA 2B4GA 5TIMA 4AF0B 4F9DA 1W9DM 3AYVA 1ZAHA 1XISA 1H7NA 4KQNA 1YYAA 1LRNA 3GTXA 3KCJA 3VDHA 3TCSA 1C91A 3W1TA 5G1MA 3B9OA 3WQVA 3E0FA 2PWFA 3E6EA 5EMYA 2JQXA 4HZ6A 4J28A 4JX6A 3DOPA 3FKKA 2O9OA 2QVNA 4JIEA 1K9EA 1A5SA 1HIZA 2HISA 3N9RA 1TWZA 1IT8A 2YIHA 2Z1KA 4C60A 1VB9A 3DDMA 2VUYA 1IXPA 1FHDA 3LRKA 2ZFAA 1TYGA 4AZCB 3W83A 4O1AA 1KXTA 2POZA 4ADUA 4RDYA 4CU6A 3NL5A 4S3JA 4Q8TA 3P81A 3MS8A 1ISXA 4GJ1A 4N0RA 2P3ZA 5D38A 3VILA 3VNIA 3M07A 1A5LC 3LRMA 4AISA 1QK0A 5FJPA 3S1UA 2EHHA 1BGAA 5I77A 3B9EA 3NM1A 4A8RA 2FLIA 3REQB 4JTSA 2BHUA 4P8UA 4DBWA 3PB0A 4A6GA 1RR2A 3ENLA 2YCEA 5FIPA 4PCSA 4DXKA 1I8JA 5K3VA 3GVVA 1OX4A 1TTPA 4Q32A 2SFPA 2Z1XA 2PRMA 4UTTC 4HA0A 1IYXA 1FKXA 1OIFA 4FXRA 2XN0A 1XF0A 1EOMA 1AQFA 2ZTJA 3BOFA 2E5BA 2XDFA 2PDLA 4QAWA 1FWGC 1EJUC 3WBEA 5GJMA 4ZE5A 2QDHA 1U1UA 5AHMA 3LQGA 1S38A 3MJYA 1BLIA 2J7HA 2Y2WA 4NAFB 4QITA 3K46A 4PTNA 2D22A 3DFQA 1B3OA 3FJ6A 4YPJA 2GPTA 2W92A 4LCSA 1QOXA 3QOKA 3PJUA 1ZCOA 1MEHA 2OYLA 1FWTA 6REQA 2XVNA 3B8UA 2BY0A 3LU2A 4UCFA 1GQKA 4HD5A 1CXLA 1WO2A 4GPNA 4TOQA 1N2VA 1ZFJA 2UY4A 1DQWA 1RJQA 3FEQA 1LL7A 4MJ2A 1XH1A 3N6HA 1OT2A 2GGGA 4MY8A 1JQXA 1V02E 4GISA 4DBDA 4OWGA 4LYQA 2ZX6A 1POJA 3P60A 1F9CA 3T1GA 4BQ5A 1ZL1A 2FHCA 5CC3A 4JQ2A 4PUEA 4JD4A 4C6KA 2G5WA 4XBSA 3MP5A 3BLPX 2P8CA 5DLCA 3PPCA 1XLGA 1R2TA 2PDYA 2WSRA 4NF7A 5CZJA 1LOLA 3HZ3A 4AWUA 3M47A 3DHUA 2JIEA 1W3JA 1YXDA 4HB7A 1H7WA 2ZUUA 1JJKA 3H70A 4FOJA 1AD1A 3P67A 2AQWA 3LSBA 4US5A 4LBSA 3KFTA 3D46A 1JDAA 4GVHA 4JFTA 1FWCC 1L6GA 1I4NA 4K8EA 2FTPA 4E2OA 3S6TA 3VZYA 4S23A 3VZZA 5M17A 1TV7A 3NZRA 1Q63A 3IPWA 3GZAA 1ZGDA 4AB4A 1VIZA 1QPOA 3VDAA 3LCIA 3N4EA 5C2CA 1QWGA 1C29A 2H8XA 5CLTA 5HINA 3CXOA 1TQXA 1YDNA 3OZYA 2ZTKA 3S6OA 1Y5WA 1SO6A 1EFZA 5TF0A 3LI1A 4J4KA 1JAKA 3QV8A 1JPKA 1WDSA 2OYMA 3MBDA 2C91A 1AW2A 4CVUA 1C3FA 1ZJIA 3MB9A 1OINA 3SGUA 1S5TA 2AL2B 3RLHA 4AZHA 3H2AA 3W53A 1L6FA 3GVGA 4PUKA 1GOWA 3V0TA 5H6HA 1LBMA 1UBPC 1UR1A 3L5AA 4MIMA 4BWLC 4MY1A 4D6GA 8A3HA 4D6DA 2X09A 4B5TA 2VFIA 2JF6A 2HROA 4G2DA 1E5JA 3HPXA 3CUJA 4YWSA 1OG6A 2FB3A 2D2HA 5EMUA 3FAXA 2BBFA 4I7UA 2AQOA 2DVXA 3TFXA 3T9PA 2GQ9A 4KWOA 2CXGA 3DZ1A 1MXSA 2ZRYA 2QT3A 3VGDA 1R85A 2VEKA 3ARXA 1XW8A 2AKMA 1UMYA 1DQXA 4PBGA 4MLRA 3SRHA 4LFYA 3RX4A 1G7UA 4G7EA 1XV8A 1XUZA 4QG6A 3LHYA 5FF2A 4IGHA 1FXPA 5DY2A 1DJGA 4XISA 4V15A 4XVDA 4LB3A 3MMDA 3ZSSA 1JNEA 4CD7A 2VTFA 4AD0A 2YBTA 2E0PA 3VINA 1U2YA 3KZPA 1NWUA 7TIMA 5FF7A 2ZRUA 1QOPA 2BVDA 1WAUA 3FA4A 3TLQA 5IOBA 4GGBA 4RXGA 4F0KA 3KWXA 1EYWA 2F61A 5AOUA 1MFUA 1J0IA 1UCWA 3LHTA 3DYMA 4R9XA 3ELFA 2TAAA 5I09A 2C0HA 2QYGA 3RXZA 4QFUA 1XSKA 3KUMA 2X2YA 2FZ9A 1EDGA 4IHCA 4QBXA 1MVYA 1T7LA 2BHZA 2E67A 4AW7A 2AGKA 1ECQA 5D9NA 1E6RA 4NUWA 4KWUA 2R82A 4Y2WA 3CQIA 5I5RA 3VIHA 2TRSA 2J6VA 4GD0A 3OG3A 3UXLA 3EWUA 3ARUA 1UD3A 1AMYA 3CYJA 3VM5A 1F2JA 2VRJA 2INEA 3TJLA 5A8OA 1E3XA 2PAJA 1M9HA 3NM3A 1XYFA 2PGFA 2WMFA 3R8HA 3E2SA 3LSCA 3MHFA 3BAWA 3LENA 3SW6A 3KX6A 3CPUA 3N17A 3RM8A 5HNTA 2Y8UA 4N9CA 2EG7A 2EXOA 2PODA 1SW3A 3EWWA 1VYPX 2E09A 3CHEA 3AMKA 4HHHA 3GC5A 4G5DA 4NAEA 2EPOA 3GH4A 2Y7FA 3PTQA 2PWDA 5B7YA 3GTFA 1JDFA 1OF8A 3CIVA 4GXPA 2DUXA 3BAIA 4IGMA 4NJKA 4CQCA 4CCDA 4O1CA 4X22A 3ZO9A 4HYWA 3E0LA 1PAMA 5RUBA 1KM4A 1ZAJA 3T7VA 2QHAA 3LHWA 3P5ZA 3JR2A 5C5YA 2X2GA 1DE6A 1DV7A 4NT0A 4DELA 1W8GA 3OIHA 2XIMA 4PB3A 4GZEA 1QI2A 2YB1A 4JHZA 3WQ8A 1P0KA 3IJQA 4OT7A 2V2DA 3WD1A 1J93A 3WQCA 5E5CA 1S5VA 3H4WA 1FWNA 4RX0A 2WVVB 5CJNA 3W7LA 4ENLA 2OELA 2NW0A 2TODA 4KGJA 3WDIA 2XZ7A 3R10A 3DU0A 1EWDA 4DUVA 1RCQA 2WNWA 4QSFA 3HMCA 1VFTA 3BCJA 4DBUA 1L2QA 4UBPC 5AB3A 2GWNA 3WQEA 4CCEA 3H7UA 5J04A 3UW6A 3L68A 1Y5VA 1E0XA 4JHOA 1IWAA 4EPKA 3IARA 3QEZA 2QVHA 1OABA 4JX4A 4XSMA 2WWDA 3FEMA 5HJLA 3M46A 1V03A 3B0YA 5U7SA 2VMFA 3DFSA 2PWHA 4A4AA 4I7VA 2DH2A 2G97A 3O6DA 4GUJA 2PP0A 4WCJA 4YNGA 3GKAA 3MCMA 3A5VA 1FDYA 1V08A 1O1HA 3GDRA 1WKDA 2IUZA 4H9ZA 1QMLA 2D0FA 2HXTA 4Q33A 3H4XA 5FEWA 1VPQA 4PUJA 3VNZA 4MYAA 1R2SA 3CLWA 4YIWA 4A3YA 4HA4A 4I9AA 4E8CA 5JU6A 5E1QA 5CBJA 4I6KA 3OIXA 2RKXA 1EJ7L 1E0VA 1SJBA 2WNNA 2J7DA 5GNYA 3IAPA 3SN0A 5F4SA 2D1ZA 3B4UA 1QRQA 3UJRA 4DUXA 1TTJA 4B5SA 4YCOA 3AZSA 2CWXA 1PX8A 2HQAA 2XUCA 3LK6A 4IF2A 4QJ5B 5CGQA 2QDEA 4JHMA 1JPHA 4R7WA 1GKPA 2E9MA 2DORA 2VXNA 3B97A 3ZR4A 3XINA 2QR6A 1ADDA 2GFTA 1KR1A 1Q7ZA 4LBUA 2HVNA 5IBXC 3EDEA 3ANYA 4KCVA 3GDMA 3FYPA 4GQGA 5AECA 5CEWA 2PCQA 3GXPA 3ES7A 3W7JA 2MNRA 1OZMA 2A85A 4JOMA 1D2KA 3GXFA 4J3ZA 1O5QA 4GK8A 1EC7A 1DJWA 3HBLA 5DQPA 1GVEA 3WBYA 3ITCA 3IK2A 1ZS2A 3AIWA 2ZRXA 3O6YX 3W28A 4W84A 4ZA0A 3KVLA 2O56A 2V68A 2WV8A 4RNFA 3NJ3A 4AD3A 3DBNA 1MW1A 1AZ1A 2E6FA 2VR2A 3KBNA 4B4HA 3W24A 1ZCCA 3WIJA 2WLYA 2OOFA 1KRAC 2JKAA 2CXEA 3TW9A 4CN4A 2YL5A 3QW3A 3GW3A 1S46A 5I3JA 4X3ZA 1HJXA 4UR8A 3EEGA 1C90A 5FJIA 1JZ5A 5REQA 3E0VA 4JIHA 3MHGA 4U2YA 3ICJA 1RZMA 3ITLA 4UZUA 4HMNA 4C6IA 2WNZA 3R25A 3TUUA 1UJQA 1M53A 3BW3A 4J3XA 1BWLA 4ZQNA 3WFLA 4QRNA 4GHRA 4JQAA 2E4TA 3HGSA 1AZ2A 1UWQA 4Z2IA 4PUWA 3W1MA 1I2NA 2X0HA 3N73A 3FOKA 2QIIA 1YTKA 3SRDA 4WY0A 3LCLA 4RDWA 3P0XA 2X0YA 4P7OA 1NEYA 4HPJA 1JCNA 2XTKA 2FZNA 1IZKA 1VGAA 1YNQA 5I6SA 3UNTA 1FH8A 3AOFA 3ECQA 3N25A 3UR5A 1QPRA 2VYOA 1XYAA 3OEXA 4MJMA 1C7TA 4OECA 3VIOA 1SGJA 1ZZMA 1T6MA 3AXXA 1XLAA 2WKGA 1I0BA 1PUDA 3T4WA 5FJOA 2JEQA 2VCAA 3HGOA 2FPVA 5CBIA 5CG0A 1E4NA 1DJXA 5HULA 5IHSA 1WOBA 4M0XA 4J3UA 1LLZA 3LOTA 2PEVA 1BGGA 3WEZA 2I17A 1CGVA 2VUNA 1MFVA 3KBJA 5HMSA 4KFNA 1RLCL 1KXVA 1XS2A 1EH9A 3PY2A 4AY8A 2RJGA 3L0GA 3I4KA 4BK9A 5JQ9A 3E12A 1BRLB 5C7VA 3C0SA 2X40A 1LTDA 4A3HA 4A8NA 1HW6A 3TYAA 5CKSA 1XRVA 2BSLA 5I00A 2QCGA 2E1DA 3ONBA 1W91A 4QLKA 5C8BB 2OSXA 3PWAA 4LAOA 4YVXA 4B5UA 3OLGA 4QDPA 4AWEA 5SWUA 1RPXA 1VFFA 4O54A 3MANA 1XLJA 1AJ0A 1Z89A 3TN6A 1W9UA 2XIIA 3R43A 4P8VA 2ZBTA 5CPOA 3IUIA 1Q85A 2BASA 3W2KA 5MF5A 1W5NA 2CBUA 3VGHA 2ZCGA 2GYIA 3HQNA 3GHRA 4DHGA 2X16A 2CLFA 2CHOA 3L66A 3A24A 2QQ6A 3VOGA 1FFQA 3WH9A 4JX5A 2VM8A 1GW1A 1A5MC 1D3CA 4LEFA 3TU9A 3SCUA 1ME7A 4GXMA 4AX6A 4GUHA 2V3DA 1NFPA 1UKPA 4I7WA 1VJIA 1XR2A 2NLIA 1KGWA 1WE5A 4QE1A 1BF2A 5AZ1A 4UQBA 4IIGA 4RV8A 3QQWA 1KBIA 5H8UA 4OE7A 1WKEA 1GWJA 3M43A 4QEHA 3MKKA 3NXLA 4HVXA 4ONVA 1CZ1A 2ZYFA 2QAFA 4H9XA 2YZRA 1EHAA 3Q4DA 3STEA 3CWOX 3BG9A 2EG6A 3CHVA 4UUIA 3HB9A 3GIPA 4DYEA 3SRKA 3VD7A 1O5KA 3FCPA 3DAQA 3PFRA 2ZADA 1GOKA 4O11A 9RUBA 3KAOA 4BF9A 3NDZA 3W75A 4E3VA 1H7XA 4BEQA 1FWJC 3C86A 2NQ9A 2I1OA 5TAOA 5EFDA 3FS2A 2YR1A 1IXOA 1JYWA 2YXOA 5LXEA 4MWAD 2BXZA 1KRCC 8RUCA 2DZXA 3OGRA 2QMJA 3DG3A 2I9EA 3VFCA 5DEZA 4DJEC 1GZ1A 4LRTA 4J1OA 2XFFA 4WSHA 4FF7A 3VMNA 2IKJA 2P0OA 2FVLA 3KOYA 1UD2A 2BGNE 1D3HA 2GQAA 6A3HA 1IWBA 4JTHA 4ZMGA 1B3YA 1IZCA 3ZOAA 2QULA 3VE9A 4LYPA 4OBRA 4GGHA 2OGJA 4ECLA 2WSYA 3W81A 1ICQA 4PRTA 1NWSA 1SO5A 5CC7A 1HJWA 4UTHA 4MDPA 3OYXA 3A23A 2VENA 4LQ1A 4QAIA 4R5EA 3CC1A 2YL8A 4S3AA 1I2QA 3S4TA 4REQA 1GZGA 1H0IA 2WKJA 4ORIA 3E38A 3KZSA 2XFRA 1HO1A 3CO4A 4Z1AA 3E9AA 2OQHA 5I3FA 4W7WA 1LT7A 3G77A 4MDOA 4NYYA 1B2YA 4PEKA 3WL1A 3AS3A 4M5PA 5LIWX 4ROQA 2WMKA 3SJNA 1KXQA 2Q3RA 1UHVA 3T05A 4FF5A 4Q8WA 5BYWA 4PTDA 3NAVA 3E0WA 3WD2A 4LX4A 1M03A 4YYCA 5I0DA 1R3SA 2ABBA 3GNNA 4UTMA 1QDSA 2IKHA 4L4LA 3WCZA 2P50A 1VCFA 1GQIA 4FK9A 4UTJA 3UD6A 1JCYA 3PAJA 3VAVA 4M82A 1Q13A 1R3RA 3HGJA 4WUIA 3L67A 1QUMA 4YTRA 4H01A 4FX6M 3UGRA 4I5RA 3NQAA 3WNKA 3GY1A 1EIBA 1KCLA 4YTSA 4UTTA 3PUOA 2BXVA 2HS6A 3GG1A 1JDDA 1OD0A 1X6UA 1LJYA 3NPUA 1FP9A 2GVEA 4IJCA 2HBXA 4F3HA 4YWIA 2VX7A 3AIUA 3VOHA 3W7CA 3NYZA 4TVCA 3G6LA 3PSVA 4ZODA 1FVPA 5I79A 4X61A 3V5OA 4EK7A 3RF9A 1OGBA 2W0UA 4IG2B 1QO2A 3F4WA 2WSQA 3CLMA 3SR7A 1EYEA 4JTRA 3NOYA 1XIGA 4GJJA 2VFGA 3GXMA 4TIMA 3ZZ1A 2ZKMX 1US3A 2H9AA 4S2BA 1H50A 2A1YA 3FFSA 3P80A 3SQMA 1JCLA 3COTA 5C6MA 1SSDA 2R14A 2AAAA 1U1JA 1XBYA 2CHRA 1U1HA 1S2UA 4HYVA 2BX7A 2YW4A 2GSJA 5LA1A 2DP3A 2V5LA 3PPGA 4YCPA 2CLIA 4JYEA 3APYA 3A13A 2J13A 4PBFA 1SW0A 3TSMA 3J7HA 2CC0A 2DGAA 2VGGA 4Y9MA 4HPHA 3EXTA 4XZIA 4HJFA 2HPMA 2IW0A 4Q4PA 3O07A 4AZGA 4AEOA 2ZUTA 1MQRA 3WMCA 1PZ3A 2XIOA 2A21A 3R11A 2Z7KA 4LS0A 2BGSA 6TIMA 1Q45A 4GQRA 4H7CA 1UD8A 3CL8A 1V0MA 2WK2A 2FDMA 3BAKA 3UXIA 2XSBA 1G7VA 3C3UA 3VOIA 3NSXA 4LH8A 1EWEA 5DMMA 2R1NA 4WGXA 3ITXA 2VI0A 2Y8KA 5FEXA 3BMXA 3V3WA 3VKAA 2QUVA 1XCWA 1XHGA 4IPIA 1WBJA 3LA4A 3L5LA 3ME3A 1AH3A 4DWSB 2NX1A 3CGTA 3QH2A 4XWUA 1PX4A 1V6UA 2OEMA 3IRDA 6ENLA 3WF3A 2RAGA 1XYCA 1Q6EA 1W1PA 1MW0A 1W54A 4ICCX 3W87A 3QV9A 5FJJA 4IIFA 4Q8UA 3HGRA 1ZP4A 2O9TA 5M1TA 1PWMA 4CNTA 3ZIZA 3BAXA 3MI2A 3CB3A 3W7IA 2FMNA 2WVSA 3SY5A 5CC5A 1PDYA 1F3WA 1L8NA 3CIXA 3KOWA 1M6JA 1XIJA 3PP7A 3W02A 1DXIA 3T2QA 3WLIA 3UZJA 3IACA 5B7ZA 1ZBCA 3IJ8A 1GEHA 3A21A 1HN1A 4NJHA 1BQCA 4PC8A 3LZ5A 3ONCA 2E40A 3A3HA 4Q8OA 4F79A 4BWLA 3QKEA 1JFHA 3A4AA 3NEVA 4H6KA 3UG3A 1F7BA 3G1XA 1JULA 3THAA 2PDWA 1J0KA 3RHGA 2HRWA 4I9MA 1UWAA 1GVQA 1RPKA 1XCXA 2Z26A 1TV8A 3QY6A 5A6KA 3AIEA 4W8LA 3BGGA 3RRAA 1RK6A 1JI1A 5BXPA 3QKZA 3H55A 4XAFA 1XIFA 3WBAA 2HBVA 2XN2A 3KCLA 3CUXA 5HWNA 1R7AA 4KRZA 1OFPA 1P0BA 3BG5A 2R6OA 5HA7A 3AXKA 1FWHC 2PDFA 2YJQA 4S3GA 4MZ8A 1NDWA 3RCMA 4P8WA 4HOZA 3GFXA 1AH0A 1JRCA 3WX7A 1PEZA 1K4HA 1HGYA 2YCIX 2BXYA 3SCTA 3P93A 1PVNA 1PDZA 3DERA 3AO0A 1YE4A 1YBQA 4A21A 1GYLA 2RFGA 4CQDA 2QCMA 3UEQA 3R5EA 4ZR8A 3B0PA 4JTKA 1SO4A 1CYGA 3EB3A 2ZE0A 4WJXA 1C8VA 3OO2A 1TZ7A 3C0JA 1KCKA 3FGCB 4NP7A 2CFFA 3UWYA 3MW7A 1ONWA 3P14A 3EA3A 1K8YA 3CTTA 4XZLX 4MB4A 4PEEA 4C6BA 2VOTA 4UMAA 1OVDA 2XN1A 1UD6A 2HDJA 3TTQA 4NNBA 2C6QA 2JE8A 3HN3A 2GWGA 2HWGA 1R6WA 4IXHA 4M56A 4HP5A 2OSWA 2IMRA 1RP8A 1MRQA 3OYZA 2V82A 2WO5A 4CD4A 4UTLA 4O0QA 4L64A 3LPOA 4O14A 4ZQRA 1GW9A 2QF7A 3UESA 2NLYA 3G3DA 1EX5A 1R9XA 2UWFA 1PWLA 3MO7A 2GJNA 3FJNA 5DMLA 4ZO8A 1G01A 4AAJA 5IM51 4OVXA 4HNVA 4PBEA 3G22A 1R87A 3S9ZA 3LBOA 1SO3A 4A8IA 9CGTA 3MMTA 3TJ4A 2PGWA 2CZEA 2W5FA 1X7FA 2B81A 1P0EA 2GK1B 4GMEA 5DBUA 1OX5A 3H2OA 5D33A 1J2BA 5FJTA 4DF2A 2IXVA 2A2IA 4LAKA 4B2DD 2WJDA 5FESA 5DCDA 3EAUA 3U2ZA 4L56A 4XKYA 1N55A 3GNPA 4RDZA 3HIJA 3RN6A 4UXDA 3NPXA 3W7OA 1FWBC 4AD1A 1GOIA 2QJIA 4P7NA 3L0KA 2ZZ3A 5CPLA 1BVZA 3UGVA 3DKJA 2XIQA 3B9NA 4LUSA 3LZ3A 2WMHA 1EUNA 2F6UA 2BVWA 2ACRA 1QK2A 3TC6A 3Q2DA 3TQVA 4HPXA 2Y85A 2X05A 1L6SA 3O3RA 3M0YA 2GGJA 4GINA 1XH0A 2OT1A 2X1RA 4AMAA 3TH6A 1GVSA 3B0XA 2BWGA 4M1BA 5EY5A 2VFFA 2TSYA 3NQGA 2REQB 2OJPA 1B1YA 1JD7A 3UBPC 3ZYZA 3G1HA 2UV8G 2WB5A 4F8XA 1MW3A 4FNRA 2VJXA 4XV0A 5DX7A 4URIA 3MKVA 4L65A 2D3NA 4NIRA 4WJEA 1EHNA 4LC6A 2NUWA 1X7IA 1VEPA 4I5XA 4PE8A 2ZWZA 1R9YA 1ZRQA 3TW7A 3K13A 3B04A 4M81A 4N2YA 1S1PA 2HK1A 4E8DA 3KDNA 1L9WA 4BHYA 1W5QA 3W1LA 3MP4A 4ZFCA 3W7PA 4TR9A 4AUBA 1XSJA 4WK9A 1J9YA 1EDQA 4IP7A 3RGTA 2W91A 5CAKA 1G9HA 1DWHM 3A47A 1XC6A 3N6QA 1XLDA 1V0KA 3ARZA 4BA0A 1MUCA 2DUAA 1KRBC 5AYXA 4ZXLA 1Z8AA 3WD0A 4DB7A 4DVOA 1M7XA 5ECUA 2QGYA 3HA1A 1XH2A 3HPFA 1PZ0A 2UBPC 4XAPA 3AYRA 4FOKA 1VRDA 5LHEA 3HURA 2OFJA 3DHFA 2EPMX 2VCCA 2BHYA 3BTNA 4DZ5A 4MM1A 4AD4A 4IQEA 2Z1WA 1TRIA 3KEHA 3E49A 1VCGA 3SY1A 3IUDA 2BVTA 3BAYA 3LTSA 4DYJA 1M1BA 3LV5A 4OBTA 5IBXA 3TQPA 4OJYA 4B9ZA 5HQLA 2FVMA 1BYDA 3CBWA 4GUIA 3W7GA 1D8WA 5AHNA 3IJIA 1TJ1A 1EJVC 2A0NA 3UWQA 1FHLA 5G1TA 1UH3A 2XJ7A 6XIAA 3LY0A 2GDVA 1R5YA 1THFD 2PD5A 2ATMA 2TMDA 3IVUA 1OC7A 4UFMA 4L1XA 1XLLA 1NDZA 2ZOXA 1E3ZA 1SSGA 1I0DA 1UR8A 4JN8A 2R1PA 4R33A 4F48A 3QHOA 3TTEA 4IFRA 4JR5A 1V93A 2PD9A 2WPGA 2FTWA 4IMEA 4RPPA 1UPPA 3GDKA 5XIMA 3AMGA 2VHLA 3GM8A 1UZ4A 3ID7A 4RZ6A 4UB9A 4YMZA 3WLPA 4HZMA 2FHFA 1YHTA 2PRHA 4W7UA 1KR0A 3MZ2A 4PRWA 4FB7A 4D6IA 1FOBA 3E3HA 4LYKA 1RBAA 5I02A 3WK2A 5HQEA 3M1ZA 4LCQA 4MPKA 3P2VA 3URNA 3WF2A 4BQ3A 3LCWA 4LF1A 1XIIA 3SI9A 4DIAA 1TUXA 1SZEA 3W84A 2QDGA 1YDVA 1N8FA 1OFOA 4XBJA 1NAL1 3KTSA 2PU0A 3LV6A 3NSNA 2FH8A 3NA8A 2J8GA 2E6DA 1QPKA 3A9BA 3G0SA 3URQA 3GNOA 4DUWA 3UYCA 3R13A 1TR9A 1ZHAA 1KLYA 1NP2A 5A2BA 1R3QA 1W1B1 2G41A 1R46A 1JRBA 1J18A 3LPFA 3GAYA 3OVQA 5C55A 2ZX9A 4H2CA 4NVTA 2A7NA 1N7KA 2Y24A 2DT0A 3SIZA 4MKSA 4XD3A 3QMRA 1CB2A 2PURA 2GJRA 4NHVA 3TNOA 1V3MA 2QCCA 3LNMA 1R8LA 1ZU8A 4X0VA 5D8ZA 3GWQA 4LANA 5GNZA 5BMXA 1RK5A 3P6LA 1W9XA 3D47A 4JTJA 3SQLA 1H62A 3ZJKA 2V8ZA 4NJJA 1Z44A 2DDXA 1Q2RA 1JXKA 4LVGA 1KFLA 3GRIA 4JTLA 1VF8A 3UJSA 3THQA 1XIHA 4Q6XA 1Q6QA 2PLKA 1DHKA 3W71A 1OBAA 2GGEA 4J3TA 2B7PA 1TELA 2DSUA 2WC4A 1TCMA 3PZIA 4C6QA 1IEWA 3I10A 1B9BA 1KFKA 3TJXA 2OSYA 3NIYA 1VJZA 1L6WA 2XGZA 1UD4A 2CW6A 1FWFC 3OZMA 1JF6A 1AG1O 5E0KA 3G0XA 3EEZA 2A3EA 3SSZA 5KTLA 2A4AA 4JKMA 4HGXA 1K9DA 3OLEA 1G4EA 4Y8EA 4E6MA 4DJDD 3V36A 4MKNA 4N6EA 3UU0A 1XDLA 1WDPA 3GXTA 4MNJA 1UOKA 4IPLA 3TK7A 1Q7QA 2CZ5A 3F1QA 4HHLA 3PZUA 1LDCA 4FAMA 1EA0A 4IFKB 1ZY9A 1Q6LA 4FALA 4AWSA 2V0TA 1W1VA 1XBZA 4S38A 3U57A 3D6NA 4JTAA 3VNJA 4NNAA 1JG9A 2OWWA 1VHCA 4GUFA 3G1AA 2CEQA 2PI6A 1JYXA 2ZZ7A 1BG4A 3GFYA 1AQHA 1SZNA 3CS2A 3W23A 4LAUA 4QX4A 2EPNA 3C5QA 1OK4A 1FRBA 3MCNA 1KV8A 4PUNA 5I3GA 4ZFMA 2CLLA 1JCTA 5I07A 1DJQA 2PDBA 3FJ4A 2PPGA 2XFYA 2OWXA 4RE4A 4EF9A 3QXBA 2VEFA 4HKPA 4DO7A 1EC9A 3KVMA 3WJSA 1Q8AA 3R12A 1E72M 3OP2A 1KM2A 2A6LA 4ES4A 4FLQA 2DZVA 3CMGA 2D2OA 4MUPA 7TAAA 1AW5A 3ALGA 3RR4A 5A6AA 3TFCA 1SJDA 1A50A 1HTIA 4IIDA 1NFGA 3V7PA 1JYNA 1OWQA 1VFMA 2DZWA 3PTMA 2ACUA 1XLFA 2QPXA 3RRXA 3LXAA 4C5ZA 1A3XA 1K8CA 1KFBA 4W4QA 3AIQA 3G8RA 3AS0A 4RW5A 5F1UA 1A0EA 1F74A 3W27A 1LL6A 4DJEA 7XIMA 5FAGA 3DENA 5TD4A 1E1CA 1FWDC 1UR9A 1QWKA 5A6MA 2VGFA 1OC6A 3GR8A 3BJFA 3VKDA 1YNYA 3L0NA 4QQUA 4PMDA 2FKPA 3PBMA 1WZKA 1Z3NA 1GG0A 1J6OA 1VEOA 1IHIA 2P8BA 3B3DA 4HCLA 3IJ9A 4WSJA 1NF0A 2Y7EA 5HQMA 4L4PA 2P3EA 1S5MA 5G4HC 1W17A 2D69A 4AXNA 4MNMA 4PODA 1QW9A 4C1KA 4Y9OA 3TC7A 4IFOA 3WLTA 2BGQA 5C71A 2GOKA 1DVJA 3S9IA 2QPUA 1HG3A 4EWND 3C6CA 5A94A 1QO5A 4EAMA 4P2VA 3N4AA 3BQ5A 3FKRA 3UWUA 4AHPA 3NZGA 1VPYA 2EKGA 3R89A 2BP1A 2HE8A 1PKYA 2O7SA 1IT0A 1OFAA 3IIVA 2OGYA 3AROA 2Q6ZA 3PUEA 3UXAA 1SVDA 3O9NA 4YHGA 2A79A 3SADA 5HXMA 3CAWA 3WLQA 1VP5A 3CV2A 4CVWA 1CT5A 3DKLA 4U28A 5AY7A 4K38A 2WHLA 5CZKA 3LEPA 1WP6A 3ZVHA 3RM9A 4TTGA 4JS3A 3PZMA 2XFWA 2VRKA 2BY1A 1UASA 4D6EA 2C19A 1FH9A 1YQ2A 3L9CA 4PA8A 2F8QA 1REQB 3A5FA 5JMUA 1KXHA 3RITA 1WXYA 3AU6A 4Y9NA 1V8EA 3NL3A 3QHMA 3U2EA 2Z25A 4O4WA 4U2ZA 3BW2A 3C8FA 1EP1A 4GZJA 1WA3A 1MO0A 2BOFX 2YDRA 3WDJA 5CJ5A 3FHQA 2NQJA 3PTKA 3G8EA 3H53A 4RJEA 1WUEA 4CNNA 1VCVA 2V6AA 4HT3A 3WEOA 2VZSA 1CGUA 4CD6A 5HWMA 4EIVA 1LQ0A 3UZZA 2D20A 2CLHA 1HGWA 2QMKA 1MRAA 3C2VA 2VURA 1CLKA 3RCNA 2HV5A 1Y8BA 2ZUVA 1TZZA 1WPCA 1ZBWA 3LERA 1UZHA 1X1NA 1P1XA 3MY9A 3FSUA 4G1NA 5IRPA 3ATYA 2RGLA 3L2MA 1VH7A 3QVQA 2Z7GA 4M1RA 2C14A 2HVMA 2XISA 4GI8A 3UETA 3SCNA 3QY7A 2J75A 5HPCA 4Q7BA 1G4TA 3IRSA 5CQ1A 1XIDA 4PYSA 2J9ZA 5K4ZA 2QJGA 2ZDRA 3QGVA 3RU8X 3VK5A 1F8MA 1C7SA 1HKIA 1UUMA 1KM1A 3UZXA 3AUJA 3IEBA 1JGIA 1VFLA 4DPPA 4LUIA 2IPWA 3BVJA 4LUYA 5HMDA 3QHNA 4C1NB 2VWTA 4BCEA 3V5CA 1CGWA 1DEDA 4J7RA 1DWGM 3A3WA 2WC3A 5LNWA 1TWDA 1A5CA 3WSUA 2PTZA 4LEQA 3BO9A 4TX8A 4Y90A 3OOQA 4MNLA 1F05A 3GDBA 2OOGA 4HJWA 1WXJA 1KTNA 3UR2A 3WDQA 1AD4A 4DO5A 3OHIA 4R27A 2E77A 4AMCA 1RA0A 2YLAA 3MVTA 4TU1A 3KS5A 1ZTVA 1CX9A 1FWEC 4W5UA 1FDZA 1XP3A 4LUTA 2Y89A 1F07A 2VL4A 3FNDA 3VCNA 1MDRA 4M51A 3GXDA 1QJWA 4XZ9A 4GOAA 3EYPA 3H7RA 1GORA 3EOSA 3I68A 3RLUA 4L4OA 3DG6A 3NO3A 1D7KA 3GH7A 3TYZA 2BG5A 3QSRA 4POCA 3W72A 1YIXA 4FEZA 3Q94A 1E15A 1KNWA 3UCQA 4MWAE 1NQKA 4XG1A 5D4YA 2CBIA 4GI4A 5DY3A 2J8FA 2MANA 1J10A 3TXVA 3D0CA 3M7WA 1TO3A 2DIJA 5EA9A 3W1XA 2NQHA 2NUXA 4JNYA 3S5SA 4QROA 1LF1A 1H09A 4H7ZA 4KGLA 1KGUA 1F8IA 3WLJA 1Y65A 2E28A 3QZ6A 3NWRA 3UJ2A 3N2MA 2IPJA 3CUFA 1JQVA 1Q4WA 3RLVA 4GUGA 3U9IA 1RUSA 4F2UA 1PTGA 4I9JA 1TPH1 4XSLA 3WDPP 4AH7A 3GYCA 2NVAA 4FNSA 3W01A 4D8ZA 5F2GA 5M2FX 1PKLA 3NR0A 1Q2SA 3NDYA 5D03A 1UIOA 4XAYA 1C93A 3REQA 3SUSA 2CYGA 4NZFA 3AIBA 3W73A 4UTUA 4KERA 4OFCA 4HBKA 2PDXA 3MI3A 1E6QM 2XWDA 1VEMA 3RO6A 3CTLA 4NI3A 4OQVA 1JCMP 4BI6A 1HP5A 3EX2A 4NASA 3UXKA 3QFWA 2DPEA 3TMLA 4W86A 1OYBA 1EQPA 1BXBA 3I65A 1XPYA 2EEXA 3BLLA 3HPZA 1E1FA 3JW7A 3W26A 1Q5MA 4X63A 1B57A 2RHGA 1CGTA 3W25A 2D2JA 3QOMA 4DUOA 1P6WA 2Z0IA 4OIFA 4K1GA 4NAFA 2OEKA 4GE8A 2VKZG 1QASA 4F9JA 2HEJA 2KX9A 4M7SA 2H3BA 1UD5A 1LRTA 1LZOA 1YPFA 4HMDA 1Q65A 2VGIA 1B4EA 2V69A 3B05A 1L6YA 4PSPA 1H7OA 3DI0A 4JGDA 3OODA 2Z2BA 3WDHA 5JH1A 4QJ3B 3LS9A 1O5XA 4UR9A 1YEYA 4D1IA 4ORMA 3ABSA 3TTSA 1NM9A 1H1NA 2CLMA 2PDJA 5C9UA 2W61A 4KIRA 3TIMA 3R8RA 2GQ3A 4GQQA 1GPFA 5FL0A 4ZENA 1MUWA 2EQDA 2GUUA 4ML4A 4REQB 5J5RA 1WNOA 3UZWA 2DW7A 1PTAA 1ZJBA 2GVJA 1KM3A 4H8UA 4AEFA 4H04A 2HPIA 4XO6A 4WIWA 5HJYA 4Q4QA 3NGFA 1QW7A 4M6PA 1JIBA 3SCVA 4ZQOA 4LCRA 1A0DA 4LVBA 1ONXA 3LBCA 1TA3B 2UZ9A 2JEPA 2J7CA 4HA3A 3LGGA 2QPSA 1BYCA 4O12A 4DWSC 1P7TB 2RJHA 4E4FA 1FUYA 3V0UA 2VT0A 1E71M 1CXHA 4W8AA 2BVYA 4GYJA 2CNCA 4UFJA 3MUCA 1JR1A 1KWGA 3L23A 4WKFA 3IWPA 4C6OA 3E2QA 3JU2A 2DQXA 2ODOA 4AXKA 3DIPA 4XB3A 3W7QA 2HSAA 1QNQA 4FO4A 3EMQA 1ITXA 3O6AA 1H51A 4Q8NA 4UQAA 3TP4A 4BQ4A 4TUFA 2ZXAA 2A7PA 4YTTA 2I5GA 4JZ5A 5LIUX 1H5YA 4LW7A 2JIWA 1K02A 1S3TC 3W7RA 3MZNA 1MEWA 3BLDA 4WKAA 4GYPC 3UCDA 3LD5A 5CPTA 3WQ4A 1V7AA 2AL2A 3ZXWA 4PCNA 2YA2A 3CUIA 4DO6A 2OO0A 3E2RA 2NSXA 1P5BA 1QT1A 4NZJA 3APGA 4FOUA 1PXGA 2G37A 1UR4A 3AHYA 3DECA 2E1WA 1LROA 4NSBA 2OX4A 1TZ9A 3WQ5A 4CQAA 1XFCA 1TE1A 3NL2A 3Q37A 3T2OA 4UTKA 3VGEA 3BJSA 2PZNA 5EB8A 2QKFA 3HFYA 3R79A 3LCXA 2WZHA 2J77A 3DFPA 1SR0A 3O06A 3BAJA 3BWWA 3VCCA 3CYVA 3B8IA 3H2EA 1J79A 4IJRA 2ZUNA 1RQEA 2HE5A 3RYSA 1GOQA 4IUGA 2C15A 3DBPA 2BNJA 5LKYA 3CHDA 2C3ZA 4FXFA 3OLIA 3BLKA 3STFA 1B4KA 1F4HA 4FXJA 3WF4A 3ZVIA 4RNIA 1J11A 2XPKA 2FYMA 1OCBA 3NO1A 1LWJA 1NOWA 3A64A 1IEIA 4RKAA 4I3GA 1XBVA 3RM4A 3FY1A 1E6PA 3S5OA 3VIKA 3OA5A 4O19A 4JFWA 2DZSA 5K7JA 1UR0A 1CCWB 3IIXA 3EZ4A 2ICSA 5C0QA 3N18A 1HL9A 3H24A 3VI2A 3CIWA 3PTDA 1OC5A 4EANA 1K03A 3QGAC 3T07A 4GIEA 4TXEA 1UB3A 4H19A 1AL7A 3O1NA 3AJ7A 3SCPA 2JK2A 3TONA 2G3MA 4WJ8A 3UWZA 3PFMA 3OJGA 1K3UA 3WUEA 1KFCA 3ZWTA 4CD8A 3EPMA 3QYSA 1OFDA 4O1EA 2Y5EA 1YPIA 1TKKA 2XWEA 4AWTA 1LBLA 5FA5A 4EKJA 2HJPA 1EX1A 1UKSA 4E2BA 1QAPA 3EGJA 2QCDB 4F2BA 4LBRA 1XL9A 5CZTA 2QJHA 5I78A 3FYYA 2WM1A 5I03A 4GFSA 1G5AA 1TIWA 3AHTA 4JFUA 3DXIA 4ML9A 2BOEX 3GNDA 4NRSA 3W74A 3THDA 4B3LA 5AZ0A 4HOWA 1AW1A 1MSSA 1E9IA 3DC8A 2ZRZA 1J0JA 1N8WA 4JAWA 1E9ZB 1LL4A 4FLSA 4ZTYA 4GLEA 3THUA 4LGXA 1EOKA 1NIUA 3BARA 5G1YA 4IPNB 1Q6OA 4B9YA 1DE5A 1EPXA 4CQ8A 4N4PA 3RAOA 1GJPA 1R3VA 3BSHA 4Z2LA 2XU2A 3WUGA 4JQ3A 2BOGX 8XIAA 1GVFA 1YPXA 5D2YA 3TQ0A 4W9TA 1AJ2A 1S2CA 1DIEA 2ISDA 4HMEA 3QC3A 4JCLA 5BXSA 3CWNA 5H1WA 3S9YA 3VNKA 4P61A 1A5OC 2V30A 2WVVA 4DZHA 1K9TA 4LT9A 2ISWA 2XSAA 3V1HA 2OO6A 1CXEA 5HR6A 4A29A 2HNEA 3WQWA 2VEGA 1EJRC 3NGJA 4RL3A 3ARRA 4XK2A 2DV0A 4WQ6A 4AYSA 2E8ZA 1RQBA 1H61A 4JQ1A 3G1FA 3M5VA 1X8CA 4U4MA 5BOOA 1SFLA 1ZALA 1X38A 2NV1A 1BFNA 4PMRA 4K6AA 3U2OA 1B5TA 3TOYA 4AZ6A 3UG4A 2G3IA 3W7DA 2HVOA 3ZT6A 3ABXA 1A5UA 4DJDC 1BSLA 3OTRA 3G6MA 4X9SA 2H6RA 1HXJA 1CXKA 4ZQPA 3TTOA 4H4IA 1OCNA 3BCFA 3SDOA 4PTXA 2CLOA 1T99A 1W3TA 3QV6A 3W07A 2G8ZA 1RVGA 3BK0A 2NXHA 1A5AA 5KZEA 1OADA 3M0MA 4KEVA 4PL2A 4JTIA 2O0TA 3JS3A 4HNCA 5AKQA 4FA3A 4FPSA 2QUUA 1XLCA 4ACYA 1W32A 2DQWA 2C1IA 5KZMA 1ISWA 3VZXA 1K7FA 5FD0A 3W1AA 5BRBA 1DJIA 5LGXA 1JYVA 5HATA 5D05A 2D23A 5F2MA 1ADSA 3W1QA 3U0HA 5CG7A 1OQFA 4IP4A 3BGJA 3G0UA 3TNBA 2IKGA 3MWCA 1UZDA 2JKEA 4DM2A 3ZT7A 1CNVA 1XYBA 3GDTA 4AYGA 4NZ5A 1PL9A 5D04C 2V5JA 2O9PA 4UFKA 4JY8A 4B5WA 2WVUA 4DZAA 3KCOA 1UWRA 2BY3A 4UWMA 1TWSA 3WH8A 4DRSA 3CUGA 3WMBA 4IGSA 3INPA 4V27A 2WQPA 5FCZA 1RD6A 1W8SA 1A0CA 4UNLA 5LHFA 3KOFA 3S83A 3DC0A 4BZYA 4PUDA 3FDKA 3S0CA 2QEZA 4LSBA 2PDMA 3WLSA 4DEFA 3WFZA 2H3DA 4K2SA 3XIMA 4D8LA 5LIYX 2AAMA 3W6MA 1RAKA 5BNKA 3GTIA 4WF7A 4BF7A 3MP3A 4H9UA 1OEPA 1UQZA 4H9MA 2FJUB 3TJIA 3F2CA 5KITA 1TTQA 2XM1A 4G1KA 3QR1A 1K8ZA 1XD0A 2WBGA 1QPNA 4GBUA 4TX9A 3W1RA 1XDJA 3M41A 3A6OA 3ERPA 1IEQA 2PP1A 3LHUA 4GIRA 5FOOA 2C16A 2XINA 1ONRA 1M68A 3IV3A 4F0LA 3TN3A 2WMIB 3SQSA 3TSDA 3PHAA 1JPMA 4E38A 1FA2A 5CXPA 4HU3A 2X42A 4TO8A 3OG2A 4QEEA 3TYEA 1QNRA 3MV11 1IIHA 1EP2A 1W56A 2NVCA 3IUHA 1V3IA 1KWKA 4Z17A 4R53A 2J7BA 2NQ5A 3VD9A 1BD0A 2BB0A 4CCCA 5FF4A 1QATA 1XLKA 3W38A 1NDYA 1EBGA 5LSMA 3ZQ9A 2E9BA 4JNZA 5GJNA 3QY8A 1X96A 4A2RA 2XGIA 4HZ7A 2E25A 4DZIA 3GNXA 2OTDA 3W2UA 5BRPA 3N3MA 2YCKX 4TVDA 1UA7A 1PS9A 3HG2A 1FX6A 2ZZ5A 3BUVA 5TNVA 1OFRA 4FP1A 2W66A 3V75A 2DSVA 1WQ5A 4J2MA 4PCTA