4FA3A

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with (r)-1-(naphthalen-2-ylsulfonyl)piperidine-3-carboxylic acid (86)
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
317
structure length
305
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3-(3,4-Dihydroisoquinolin-2(1H)-ylsulfonyl)benzoic acids; a New Class of Highly Potent and Selective Inhibitors of the Type 5 17-beta-hydroxysteroid Dehydrogenase AKR1C3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 114
structure length 305
sequence length 317
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4fa3A00
3V36A 1XGDA 2A79A 5DANA 1HW6A 3UYIA 2PDMA 2NVCA 2HVNA 4JTRA 2PDFA 2IKJA 3CAQA 3ONCA 4ZFCA 4XO6A 3V35A 4JTDA 3S3GA 5HNUA 2DV0A 3M64A 4XZMX 2HV5A 4GQ0A 1Z3NA 2R24A 4QX4A 2HDJA 4DBWA 3EAUA 1IHIA 4JTCA 4JQ1A 4XO7A 2PDNA 3F7JA 1PZ1A 4GABA 1Z8AA 2PDYA 2IPJA 3FJNA 4G5DA 3T42A 3UWEA 2PDPA 4JIIX 1YE4A 4ASTA 1FRBA 2PDWA 2PFHA 3B3DA 2F38A 4XK2A 3RX3A 1EL3A 4YVXA 1Q13A 4PRTA 2WZTA 3BUVA 2BGQA 3ONBA 3LENA 4DBSA 4GQGA 1QRQA 3MB9A 4GACA 2PDGA 1YE6A 4XAPA 3H7UA 3U2CA 1PWLA 4JQAA 2FZBA 4LAUA 5JH2A 1ADSA 4IJRA 1YNPA 1XJBA 3DOPA 3R7MA 2FZ8A 2WZMA 4PUWA 1S2AA 1AH3A 3EB3A 3EB4A 4XVEA 1AZ1A 3CV7A 1R38A 1X97A 4PUUA 3LZ5A 1AH4A 4LB3A 2PDJA 2BGSA 1Q5MA 1UR3M 3FX4A 3O0KA 4GA8A 3Q65A 4YS1A 2ACRA 3R94A 4ICCX 2HE8A 2PEVA 2IKIA 4Q3MA 3UZZA 5HA7A 3D3FA 3WG6A 2CLPA 1LWIA 2I17A 2ISFA 2IS7A 1AZ2A 2DUXA 2PF8A 1MRQA 1C9WA 1VP5A 2IQ0A 2ALRA 3WBYA 1AH0A 4JIHA 1MI3A 4FZIA 1MZRA 3GHSA 4WDXA 2R9RA 2HE5A 4H8NA 2IPWA 3UFYA 1PWMA 2DUZA 4IGSA 2PDLA 4YVPA 3O3RA 4JQ2A 3GHTA 1YNQA 1K8CA 4L1WA 4RPQA 3N2TA 4FAMA 4XZLX 1HQTA 2PDXA 4HMNA 2P5NA 4WDWA 2ACUA 3DN5A 4FA3A 3G5EA 3ERPA 1QWKA 3LN3A 2PDKA 3CAVA 4XZIA 3GHRA 1GVEA 4QR6A 4XZNX 4JIRA 4YU1A 5AZ0A 1XF0A 2NVDA 3M4HA 1SM9A 3R43A 2QXWA 4IJCA 3V0UA 3R8GA 3UZXA 3V0TA 3COTA 5AZ1A 1JEZA 3CASA 3LQLA 4DZ5A 3WBWA 1S1PA 1Z9AA 5LIWX 1X96A 3R6IA 2F2KA 1RY0A 1RALA 3H4GA 2INEA 1EF3A 4WEVX 1PZ0A 1J96A 3G1RA 3BV7A 4WRHA 1A80A 4Q7BA 3LZ3A 3NTYA 3WBXA 1Z89A 3R8HA 3H7RA 3KRBA 4HBKA 1ZUAX 5LIUX 3BURA 3LUTA 2ACQA 2VDGA 2INZA 3GHUA 4EXBA 2IPGA 3UG8A 3P2VA 2PD5A 3LD5A 3LQGA 2PDCA 4L1XA 2AGTA 3UGRA 1S2CA 4WDTA 4YVVA 1OG6A 4JTAA 4R9OA 5LIYX 3LEPA 4EXAA 3UP8A 4XVDA 1PYFA 2IPFA 2PD9A 4F40A 3Q67A 2PDIA 1EXBA 2PZNA 4PMJA 3LBOA 4JQ4A 1X98A 2IKHA 3VXGA 1RY8A 2BP1A 3R58A 2HEJA 1VBJA 4QBXA 3N6QA 2FZDA 1T40A 3RX4A 4JTQA 4H7CA 5C7HA 2HVOA 2J8TA 1EKOA 4NKCA 4QXIA 2ACSA 2FZ9A 1ZSXA 4FALA 3V0SA 3MC5A 4LBSA 1ZQ5A 4PR4A 2FGBA 1AFSA 4WGHA 4AUBA 4LAZA 4OTKA 5JH1A 3CV6A 2IKGA 4XZHA 3UZYA 5HNTA 1LQAA 2PDQA 2PDUA 1IEIA 3CMFA 3QKZA 4WDUA 3BCJA 4PRRA 3C3UA 4LB4A 5LIKX 1T41A 4GCAA 3RX2A 1ZGDA 2C91A 4I5XA 4JQ3A 5M2FX 1US0A 2IQDA 4LBRA 3WCZA 3LNMA 1S1RA 4GIEA 4MHBA 1M9HA 2FVLA 3UZWA 3GUGA 4DBUA 5LIXX 2PDBA 2I16A 3M0IA 2PDHA 5KETA
chains in the Genus database with same CATH superfamily
4UFLA 4HSHA 3A4XA 5MHBA 4O8RA 5A1AA 2PTDA 1HW6A 1XYLA 2VX6A 5A6BD 3P82A 1S39A 1W5QA 4IICA 2ONEA 4C6JA 2Q3OA 2FDSA 2A3HA 3MV01 5FSEC 2CKSA 1OSEA 1LG2A 1F8MA 1OC6A 2FFCA 2QCLA 1ITXA 4GQ0A 2A21A 3B4UA 3TYAA 3W7HA 2V3FA 1PX8A 3IRDA 5AHNA 1L6FA 1AA1B 1YW1A 3FEMA 4MWAB 3W2MA 3MDWA 4H6EA 1GG0A 1ODUA 1QW8A 2Y1HA 3APGA 3E0FA 4MSSA 3T4WA 3N4AA 4QP0A 2PGWA 4H9ZA 1QJWA 1NDYA 1ZENA 2XISA 3GWQA 1IV8A 3LOTA 2DT3A 1JCYA 4YCPA 3TN5A 4IIBA 3TN6A 3II1A 3UCDA 1UH4A 3LM7A 3BK0A 2BXZA 2PDWA 3NZGA 4J7RA 4RLIA 6REQB 2EO7A 2F38A 1IT8A 3BLKA 1D8CA 3RX3A 1KM5A 4HPGA 3AXIA 4D6EA 3CYVA 3CZKA 4GWEA 1V02A 2FDMA 3T0BA 1W1A1 3DG3A 1KC7A 2VI0A 2QS8A 4MJ2A 1E70M 3SGGA 4CNTA 4JQAA 4US6A 4OWGA 5GJMA 1XLGA 1MW3A 3IK4A 3PPHA 4U31A 1QPKA 1RCOB 1AH3A 5D32A 4CN6A 2CBIA 1K9EA 1NSJA 1QAPA 2XJ7A 3H21A 2F6XA 3ZLGA 2I57A 2JEPA 3E74A 3N9RA 3O0KA 2DSWA 5CZKA 1H60A 4HTYA 4ICCX 3NFUA 1R9XA 3OHMB 2GJRA 5D4YA 1D9EA 5CC5A 2WVVB 3JS3A 1YBQA 5HUPA 5BOFA 3FYPA 4NHVA 1OZMA 4E3VA 4WSHA 3FJ4A 3RLUA 3BC9A 1C9WA 2P53A 2CXEA 2ZUVA 3CUJA 4QRNA 4EVZA 2R6OA 3FXYA 3BGJA 1TFVA 3L0GA 4Z0SA 3VD4A 3T09A 3R0KA 4GK8A 3RU8X 4IQJA 5HNRA 2VYOA 2DGAA 5E6ZA 3CHVA 2R91A 4KIEA 3GVVA 4PMXA 4LV4A 5E0CA 2JFEX 3U48A 3CPGA 2PDXA 4EANA 1BGAA 3UJFA 1CT5A 3CT2A 4MDPA 3FA3A 2XIOA 3AWOA 3M0JA 4HK5A 2CWXA 3W7DA 4IG2B 4HTBA 3IPWA 3HQNA 4KEVA 1KCLA 4XZIA 1UR1A 4BK9A 2PGEA 2HMCA 1GWJA 2FLIA 3ZJ8A 4QCFA 3SI9A 3TX9A 5FCZA 5J5RA 3FY1A 2QXWA 2NUWA 5FF4A 1KTCA 4G2DA 5E1QA 5DFAA 3AZSA 1ICPA 3R8GA 4I9AA 3V0TA 2R8WA 3K4DA 1KRAC 3O06A 4S2BA 3WENA 2CZFA 1JNDA 3DFOA 3B0YA 5TIMA 4E3TA 2XM2A 4HQVA 4ZGYA 4A05A 1ADDA 5REQB 5BCAA 4CCDA 3KOFA 1SZNA 3GTXA 1X7IA 3G0SA 2Y8KA 4W8AA 5BXTA 3A4JA 4U4MA 3AI0A 1LG1A 3LLXA 1MYRA 3BSMA 3LRLA 2WMKA 3CWNA 3EWZA 3PVFA 1JI2A 1I1XA 1TJ0A 2YW3A 3ANVA 3OTRA 3KTXA 1XBYA 1OHLA 2A85A 4Q7BA 1Z89A 2BTMA 1BG9A 1YBQB 3SO7A 1ZUAX 5EFDA 2DZPA 1UA3A 3CM4A 2VDGA 2OU4A 4BS0A 1XSIA 3LD5A 3P3BA 4HZ7A 4AY8A 1PDYA 3TYEA 1Z69A 4N0RA 1W8GA 4YVVA 5CPSA 3TKFA 1ELSA 2XGIA 1LUCA 1PJ9A 4TTGA 3BMVA 3P0WA 3UCQA 4ML4A 3W7LA 2DVXA 1VEPA 1OX4A 4Y8FA 4JKLA 3NIYA 2GGIA 2BLEA 1CDGA 1E1CB 4CD6A 1E4IA 1JQVA 1TA3A 4JNMA 4TMCA 4AZIA 4M24A 3SCQA 5E5CA 1JYWA 5I3DA 2PWFA 2QV5A 2QGYA 3RX4A 1TELA 4JTQA 3LV6A 1Q85A 1TJ2A 2JIEA 4E38A 1XHGA 4CNSA 1ITQA 1JNEA 4IZGA 2HVOA 3C4UA 4JGDA 3LPGA 4NKCA 1HT6A 2ZZ2A 2NSXA 3FCPA 4ILSA 1C90A 4HMEA 1YTKA 3DFQA 4EPKA 2DIEA 2PS2A 3P84A 1PV8A 2QJHA 4JIQA 5K4XA 2ZXDA 2Q01A 3IIPA 3UZYA 1QOPA 4HZMA 5FJOA 4R7OA 3IIXA 3PNZA 1PIIA 2ESCA 4LEFA 1GOWA 4FF7A 3WF0A 3ICJA 3BCJA 4MKSA 3QFEA 1XBZA 4JCMA 3WDJA 4DF1A 2LLEA 9XIAA 4BQ2A 3TONA 4IMGA 4FMVA 3KDOA 5CPLA 2V81A 4MM1A 3VM7A 4Z08A 1E43A 2X2GA 3UPBA 2OZ8A 2DY3A 4GIEA 4O50A 4HIBA 2FMNA 2FVLA 4CD4A 4K1GA 1QFEA 3FAWA 2O9RA 5D03A 3QMRA 2F6UA 3IANA 2Z1SA 3CXOA 1YXCA 2QULA 2HPIA 3HQOA 2D3LA 3MUXA 4HU0A 1XG3A 2BG5A 3UYIA 3EWUA 4ZA0A 3KZSA 3STEA 2J66A 4MB5A 1FH7A 5FEXA 2IKJA 4XG1A 4ZFCA 1XV8A 3PK7A 1V6XA 4DVOA 3SRKA 1O12A 3SY8A 3GDKA 4GY0A 3V1HA 3BGGA 3N4EA 4ES4A 4CNNA 4ZCWA 1VPXA 1TRIA 2DSVA 3W88A 5FL1A 1WXYA 2XIJA 2XSBA 4M5PA 4MNMA 4IP7A 4AZCB 2QQ6A 4MMWA 3W1AA 1MFUA 3SUVA 1L6WA 1UZ4A 2H90A 4KWUA 1TX2A 1BRLA 1E0UA 5K9XA 1ZBCA 2OWXA 4X9YA 1FWNA 2EQDA 3BQ5A 3KTCA 3TUUA 3T42A 3UWEA 1WV2A 3CUFA 2J7CA 5I00A 3SSZA 3CEPA 1V0NA 4Q7IA 3DU0A 4I7WA 4QE5A 3U0HA 2P50A 3MV11 4G8TA 2AL2B 6CGTA 4B91A 1QDSA 2QDGA 3LDVA 3FHQA 1G4TA 3MB9A 4DO5A 2GUBA 3M7WA 2X41A 1F5ZA 1A5NC 2XWEA 4LAUA 1J10A 1RQHA 4CU6A 3L2MA 4K7VA 2OSXA 3MQTA 4Y9OA 5PTDA 1H09A 4XD3A 2QW5A 4JFVA 2O0TA 1H62A 3RCNA 2H8XA 4CU8A 2O55A 1IR1A 5CGTA 1R0MA 2XIBA 1BKHA 1ZAHA 5AYYA 3PBYA 2W27A 3LHUA 5EBUA 1CX9A 2A3EA 4IPPA 3OPSA 1BYAA 4UMBA 3KWSA 1FH9A 1F6YA 3WG6A 3OQ8A 1EDGA 4PYSA 4QROA 1DWHM 2DUXA 4UQDA 3BJTA 1YXDA 1W1VA 2CLIA 1PE1A 3S4TA 1EJTC 3M5YA 3AUJA 4FZIA 3WQOA 5DMLA 3KBJA 4R9XA 4K1WA 4PUDA 3LU2A 4DWDA 1E6QM 4A3YA 1W1B1 4JQ2A 3N13A 3GHTA 4LY4A 3NQ2A 3POHA 2YLAA 4JDYA 3DGRA 2R94A 4J3WA 4PEEA 4O4WA 1QI3A 3ARVA 3W1XA 4M82A 1MDLA 1CBGA 1QNRA 3GHRA 4AC7C 3T05A 4MKVA 1GK8A 4N6EA 4FLRA 2Z29A 1SQ7A 1GPWA 1XW8A 2QPXA 3R43A 1OD8A 1X39A 4GI9A 4IJCA 2B7NA 2X0HA 3KHDA 3LCHA 3APTA 4UQCA 3KS6A 4PMUA 3WIJA 4XAFA 3IAQA 5DMYA 1W9BM 3I3BA 2OCZA 1RQEA 2W6RA 1GVRA 1XUUA 2ZDRA 4ZQPA 2FGZA 4JN6A 1UWRA 4WOQA 4AH7A 3UR7A 2C6QA 3GK0A 3IJDA 3ZXWA 4I5RA 1W31A 3NVTA 1JCXA 4ML9A 5D2XA 5JUVA 3VX1A 1X7FA 2OZ0A 3QN3A 3IV8A 3B0UX 4QLLA 3FVMA 3IS4A 4E4FA 2VOTA 1UW9A 3DESA 3NTYA 3MKVA 2NWSA 4GYPC 4HBKA 5E9AA 1ZLPA 1AD4A 2X2YA 2AL2A 3VD5A 1KFBA 3CTLA 4Z2IA 2INZA 1QASA 1GKQA 2UWFA 1ICSA 1KBJA 4ZOCA 2AGTA 4UCGA 3W83A 4S3EA 4RV3A 1S2CA 3AYVA 3P14A 1DYSA 2WC7A 1D3HA 2WMIA 3B8TA 3B8UA 3UP8A 2NUYA 5AHFA 2PTXA 3WUGA 1XD1A 3VA8A 5EBAA 1XIIA 4E2BA 4YMZA 2JKAA 4U3CA 3CMJA 2CCRA 3T4CA 1U1UA 3VKBA 5F7UA 3N2MA 4F8XA 3DH7A 4AWTA 1XQKA 4UTHA 3GAYA 4E4PA 3G22A 2Y0FA 2BP1A 3TAKA 1B57A 2E9LA 1S5TA 5T8GA 5TF0A 5CPMA 1UBSA 3T2OA 4R88A 3W87A 1X8CA 3OVGA 3A21A 3IGSA 4RNIA 4E2VA 4RZ6A 3L7RA 2J8TA 3CTTA 5AVNA 2Z6JA 4Q6JA 3WX7A 3M0HA 3IGHX 1K8ZA 4LBSA 3BVJA 1QPQA 3L4VA 2REQB 4GFSA 3LS9A 1XRFA 4LAZA 3PUGA 5XIAA 1K9DA 4M19A 4UFJA 4MWAE 5FACA 4AD5A 2WB5A 2PU1A 3G6LA 2VL4A 1LORA 2Y2WA 1OD0A 1REQB 2V2HA 3DENA 4PMNA 1RH9A 3VKKA 1H50A 1PAMA 2CBUA 1XP3A 1VBGA 4JQ3A 3WDQA 3J7HA 1O7AA 2GFTA 2E25A 5REQA 1W1ZA 3LCLA 4QISA 1DQXA 3SUUA 3O2LA 1R3QA 4M0XA 2GGHA 1MUCA 3VIKA 4GYPA 3SW6A 5GNXA 3CT7A 2A79A 4BF5A 1EZ2A 5M1TA 1I2OA 4JBRA 4DNMA 3LXBA 2XH7A 3HPSA 2WQDA 4NZ4A 4ZFMA 4GZ7A 3WUBA 2NWRA 4FPSA 2I9EA 1RCQA 3S3GA 4LVAA 3AMGA 3M64A 3QGVA 3C6CA 1N7KA 2J25A 4IF2A 1XLJA 1B3VA 2EXOA 1UUOA 1OFOA 4IM4A 1YRRA 1ZAIA 3S1VA 1LQ2A 3EDFA 1M41A 4KEUA 1A5SA 4N9EA 4O17A 3AJ7A 5K7JA 1X1NA 4RL3A 4DJFC 1SPQA 1LBMA 4MPQA 5FL0A 3WQ6A 1NWTA 3KE0A 1QHOA 1ODZA 1ZZMA 2IPJA 1EF2A 1UOKA 3CL7A 4GX8A 4WF7A 1GVFA 3VC6A 3AMLA 4IPLA 4ZE4A 7CGTA 3TIMA 2OQHA 3R12A 3OIHA 2WZEA 1U5JA 4GZEA 1BXCA 3OOQA 2V5JA 3BSHA 4O14A 5D2WA 1W5MA 4RE0A 1E6NA 4O15A 1RV8A 3GG7A 4X9SA 5C0QA 1H1NA 3PJTA 1QW9A 1G6CA 5LYRA 2GSHA 1TUFA 1H7XA 3HB9A 1MWOA 4ACYA 1WQ5A 3W23A 5FJUA 4A3UA 4D1JA 2KX9A 2GSJA 1RK5A 2TPSA 1RP8A 3VO0A 2VRQA 5HJYA 1Q6CA 4QJ1A 4I7UA 3EEGA 1E15A 3PWAA 2WZMA 3DI1A 2B31A 3QJAA 3W84A 1J6PA 3QC3A 3E5BA 3W7NA 2JK2A 2NQLA 1C7TA 3CAKA 4HNTA 3CV7A 3S83A 5C2XA 3G1XA 3CHDA 2B0MA 4GXMA 1LF1A 1ALDA 3AS0A 1KR0A 5TAOA 4GIAA 5E0FA 2WW5A 2XN0A 4QDMA 3S1GA 3ITCA 1NH6A 4HMDA 1PL9A 4ACZB 4NZ1A 5KEZA 2V5DA 5I78A 3WEZA 1AZ2A 1IF2A 1TR1A 2C1IA 3P67A 2XTKA 1VP5A 5AFDA 4MAZA 1K8YA 3QQ0A 3ZJ7A 1KRMA 3REQA 2R9RA 1TVNA 1GHSA 2BHYA 1O4UA 1E4LA 2E5BA 3CNYA 1WZAA 4H7ZA 1R5YA 2CU0A 3WJWA 3PSVA 4HNOA 4WDWA 4LRTA 4KWSA 5F2LA 2ZZ5A 5HNNA 3CQHA 2J9ZA 4H2CA 1W37A 4PMZA 2QCHA 3EGJA 1KM4A 1OT1A 3PBMA 4CUCA 3V4BA 3LMZA 4JIRA 1T99A 5DBUA 4XBJA 2JBMA 1EEXA 4A3RA 2YB4A 3NO1A 5G2IA 5LSMA 1GQKA 3WBEA 1QI5A 1V6VA 3NCOA 4BHYA 1RY0A 2NQ9A 1TPDA 3MMTA 7ODCA 3AALA 1JYNA 3H4GA 3AMCA 4A2SA 5KZMA 1UR9A 1GT8A 5BOOA 2PE4A 3MP5A 2Q8XA 2VX7A 3SCOA 5FKYA 2J27A 1T8QA 2CETA 2NQZA 1OC5A 3HTWA 3I10A 4HA1A 3C61A 4DLFA 2PMQA 3WNOA 4TXEA 3QLLA 4YN5A 4PMDA 3R8HA 1SGJA 4LRSA 2FHFA 3PZTA 1Q66A 4H6QA 4A22A 1JULA 3GXNA 1OK6A 3T44A 4E8GA 2JF7A 1JF5A 1YTEA 1V6UA 2QHAA 3UGVA 2XVPA 2WVVA 5AYXA 3RLGA 2YA2A 3FJLA 4N42A 5BWAA 3UGRA 2YDRA 5ABTA 3BLPX 5AYIA 2VVNA 3BAKA 1A53A 4IMCA 3T8QA 2G4JA 3RN6A 1GQNA 3WQEA 2YL5A 3T07A 1P0EA 5M3WA 1HJUA 1XR2A 5TQLA 3VXGA 1RY8A 3FDKA 3B9NA 2ZZ4A 3R58A 4ZO9A 5A6BA 3N6QA 1DWAM 2Y6ZA 3M46A 1DJHA 2V67A 3PZNA 1GQLA 1VLWA 4UQBA 3WLIA 1MQPA 5H1WA 4J2PA 3V75A 3ARUA 2XDFA 4D71A 2NT1A 3W73A 1V3KA 3BWWA 4ZQOA 5HPCA 4JEJA 5E0KA 3XISA 3BMXA 1DIEA 2Y85A 3DHPA 1SR9A 2KZHA 2ADAA 4KQNA 5CSSA 1N82A 2YXXA 4FSAA 3LI0A 2QDDA 4GUGA 1TPVA 2DFAA 2HBVA 1TJ1A 2QGHA 2EHHA 2XHYA 4LUSA 1UPPA 1OJXA 1ZBWA 2H8ZA 4Y8EA 3C3UA 2CHNA 2XWDA 4V28A 1X1OA 5LIKX 2CLOA 3SCVA 1F2JA 3KEHA 2YA0A 4X2PA 1Q8JA 4OZOA 1GEQA 3K4WA 4YCOA 5FF3A 4LNYA 1RBOB 3PF3A 3D46A 3TFCA 2ISVA 3L4TA 3GUGA 4TV5A 4KCUA 2WVTA 1XIEA 2Z1BA 4QAWA 2I16A 1NY1A 1T8XA 3M0VA 1MMFA 4CQCA 8A3HA 6TAAA 1BYCA 2NZLA 2YXGA 4QE1A 5DANA 1RJPA 5XIMA 1HO4A 3L2IA 3DYPA 2VWSA 3PJUA 5F2IA 1RLDA 1QCWA 2OO0A 2QUTA 3ECQA 3LBCA 1Q65A 4Q8TA 2V82A 3HJZA 4HHMA 4Z2JA 3FYYA 1ZJIA 1Z7AA 1VBHA 5FSDC 5I24A 2DW7A 3DGBA 1FWBC 2CLLA 4HOWA 4ZO7A 3K8MA 3RLVA 4DBWA 4Z1DA 1EGZA 4Q4OA 4P8XA 2CZVA 3GTFA 3PS7A 4L4LA 4XO7A 1RP9A 3W22A 3EKZA 3OVRA 1B3XA 1PZ1A 3T0CA 4OHQA 4N6FA 4R33A 2G4FA 1KBBA 1LRNA 3WH5A 4EWND 4P2VA 4I3GA 3MUAA 4JNZA 5I02A 3S2LA 1V77A 3HF3A 1IIGA 5CJ5A 4BZYA 3ME3A 2V2DA 3F03K 4WJ8A 4UBPC 4KMQA 4A3QA 1EL3A 1JRBA 3N12A 2PODA 4F0KA 1MEHA 3SRDA 2BGQA 3CH9A 3GDBA 4ALDA 4IIHA 1PTGA 4LANA 1KBIA 4KFPA 2DP3A 3OBAA 4LVGA 2R1PA 4XAPA 2X1SA 2VQUA 2A3BA 8XIAA 2VDHA 3GKAA 4H9VA 1E0XA 2WK2A 2WWDA 2GQAA 5U4NA 2GJXB 3E12A 3EB4A 2GDQA 1ISZA 3DKJA 4B5VA 3W00A 1J79A 4I90A 4ORIA 1K9TA 2A3LA 4Q8OA 1IEXA 3Q65A 3VOIA 2CLEA 1HUVA 4J3XA 4X60A 1ME7A 1SU5A 4FK9A 4MKNA 4Q4MA 2AGKA 1UD8A 1NOUA 3P7YA 4NNCA 3N04A 4C6LA 2CZEA 3WKZA 2VZUA 1BWVA 3CL6A 3MMUA 2OWWA 1W1YA 2WCAA 1MW1A 1XS2A 3GNDA 1N8WA 1W9PA 1AH0A 4JIHA 4Q4PA 3EX6A 1PB0A 4KFNA 3UA3A 4B3ZA 1O68A 1OGSA 1XYZA 4DX3A 2PLMA 2IPWA 4L6OA 4ENLA 3W1RA 1DE6A 3WK1A 3C0LA 3RJYA 4LY8A 4UTFA 3Q45A 1V5XA 1ISVA 1CXHA 3RYSA 5C9ZA 1XRSA 2XIMA 1EJ7L 3CQKA 4UOQA 3DERA 4AIBA 2R1MA 3N3MA 1J0IA 1UA7A 1JUEA 2D20A 4C65A 5CZJA 4LPCA 1EHAA 4XAYA 2OEJA 1JIBA 3L23A 1PXGA 5ECUA 1DXIA 3EWDA 4IGMA 5M17A 3LBMA 1XBVA 3UESA 1F07A 2VC5A 1YMYA 2D3NA 3UW6A 2GL5A 1Q8AA 5AZ1A 3I7QA 3WNNA 3N2BA 3WBWA 4I9TA 3EDEA 1W9VA 3WO8A 3NQBA 3PB2A 5FEWA 1V03A 3URBA 1R47A 2FIQA 1J11A 1YEYA 3NZ1A 4KFOA 3H2NA 1UHVA 3ZVIA 3ZR5A 2BZNA 2HISA 2YB1A 4QLJA 1TG7A 3EXRA 3WNLA 3BV7A 5KZEA 2RDWA 3F5LA 3G1VA 3W02A 1YKWA 1CXIA 1K6WA 2Y8VA 4LS2A 4ATWA 5DEZA 2VVSA 1QOQA 1WBJA 4GGBA 4GYKA 4YTRA 2VNCA 4AFYA 5JU6A 1SW3A 1JF6A 1E72M 3HPZA 1VF8A 3VIIA 1CEOA 1I2PA 1HZYA 2CBVA 3FN9A 2YL8A 4O28A 2VC9A 4KBXA 1VFUA 1PBGA 4XVDA 1R30A 5HJXA 2IPFA 1VBRA 4O52A 4KERA 5KTLA 3G6MA 5L9FA 1W1IE 5CPQA 4YTTA 3TW9A 3F4NA 1JPIA 1G01A 3IGXA 1GZ1A 4J1OA 2VDIA 4HU8A 1FP9A 4W7WA 3W53A 3NQ6A 1OFDA 4HNUA 1CZ1A 2EG8A 3APYA 3LNPA 1RD6A 2Z1KA 3WF4A 1VPYA 1OCJA 2NT0A 1E51A 4IUOA 3INPA 1EKOA 4DZIA 1EGMA 3FFSA 2VUYA 1I2RA 4O0KA 1XIFA 3W6YA 3WQPA 2QZRA 3MC5A 1WKEA 2BHZA 4UXDA 1JCJA 1XLHA 3SFKA 4FX7A 4L9XA 1D7KA 3NZQA 3O9NA 3GH4A 3ZLFA 4NYYA 1XWYA 3NA8A 5FA5A 1FKWA 5F4XA 5HNTA 5BMXA 4FHAA 3P80A 3NYZA 3AMKA 5A8PA 4BWLA 4DF2A 4FXRA 1UCWA 3N34A 1LRTA 1CECA 4XD6A 1BVNP 4LSBA 4JHMA 2C91A 2J7GA 2NQHA 4DUWA 1WAUA 4Z2HA 3WUFA 4A8NA 1H7OA 4GVGA 4G56A 1S1RA 2X0YA 4PB5A 1DOSA 4IPNB 4NYUA 1EO7A 1SO4A 5LIXX 5HMSA 3M0IA 3WQ4A 4Q4QA 4C1LA 2PDHA 3GVRA 5DXYA 2C71A 1AMKA 3V3WA 3F5JA 4M8UA 4P8WA 2CNCA 3LI1A 5ENLA 4N02A 1UMYA 3MI6A 2QMKA 5I3JA 4F79A 2F84A 3AFBA 4DJEA 3H7VA 3GC2A 1WZLA 3GR4A 4RCXA 3WLQA 1B3WA 5GJNA 1T0OA 1QWGA 4YWSA 2VFIA 3OG3A 3R11A 1YXYA 4HPJA 1IIHA 5FJJA 2PWDA 4TVCA 4IP5A 2W63A 5DCDA 4H41A 1JCLA 1CXLA 4J9JA 3TW7A 4LALA 3HMCA 2O92A 4AZBA 3UETA 3F4DA 1HP4A 2RKXA 1YADA 2CW6A 3MMDA 2GJNA 4WD0A 4E2DA 1U83A 1TWZA 5FJTA 1LDCA 4PULA 2YBUA 2YGYA 1JDCA 4OFCA 2PDYA 2ZZ6A 2W62A 2WKLA 1KV8A 2YX0A 1TCMA 4OOUA 3RIKA 5FF0A 4NXKA 3W07A 3HGRA 5E09A 4HU4A 1E0TA 3NQFA 3AS3A 4RDVA 2IUZA 3H22A 1UWUA 4PRTA 4CQDA 3UXIA 1OG0A 1Y8BA 4AD3A 2RGLA 4I7VA 3UJEA 3I6EA 2WHJA 2P1FA 2B4GA 2DZWA 1P7TA 1WAWA 3EMZA 3JW7A 3W0KA 5HK4A 3L66A 1R9ZA 3RR4A 4ZSTA 1CWYA 5A8MA 2FZBA 1SZGA 4OECA 3NQ7A 3N3TA 2QR6A 3OQEA 1SVDA 3W28A 5FF7A 1J0JA 1K7XA 1W5OA 1E4MM 3VOJA 4BI5A 3W7GA 4O1EA 3UCCA 2OFJA 1BTCA 1JDAA 3LSCA 1WCGA 4GQBA 1MUMA 1OADA 2PDJA 3C2RA 1LT8A 4OV4A 1CGUA 3G24A 1KM0A 3ABXA 2DZUA 2H3DA 3HPXA 2WJEA 3DCPA 3WN6A 4GZIA 1BVWA 1LTDA 4FNPA 3UVIA 3E2VA 4Q3MA 2VD8A 1FH8A 5HA7A 3D3FA 3NQDA 4B5UA 5HPOA 3A6OA 3VIJA 3EEZA 1UKSA 1WXJA 2WVSA 4Q4SA 2ZZ1A 2RJHA 5C9XA 2F7FA 2RH9A 3WBYA 1A0EA 2E5CA 2W5FA 3ITVA 4REQA 2HS8A 3MJMA 2HE5A 3CGTA 3RO6A 2DW6A 2VZTA 4TOQA 2PDLA 4L4PA 2A3AA 4O0QA 5CKSA 1FDYA 3UY7A 1N8FA 3DDMA 4QGCA 3IJLA 3TQPA 4LH8A 4RPQA 4JFUA 3LGEA 1B4EA 4XZLX 3PM6A 1AJZA 3NXFA 4LUTA 1GNXA 4LS1A 5AC8A 3E3HA 4RE2A 1QT1A 1SSDA 3CQIA 2OOFA 4FA3A 2WM1A 4GCXA 2A6NA 2PDKA 4HNNA 1L6GA 3PC0A 2A3CA 1KXVA 4P7OA 1VFFA 2PB1A 1AJ0A 3PBWA 2OT0A 3MZ2A 2RDXA 4LNCA 3AIBA 3VGBA 1J5TA 1JUBA 3PN8A 1J6OA 3QHOA 2QCDB 4WSKA 3OW1A 1SM9A 1O1ZA 4AMAA 1W1PA 3OA3A 1FCVA 3TTSA 1BQGA 3ATYA 4QG9A 4NRSA 1KBLA 3KL5A 4ZTXA 3KVKA 3TFXA 3ABRA 2FVKA 3EB2A 4X0NA 1OT2A 5DRCA 3VABA 3ZT7A 3WJSA 4RX0A 4RUBA 2YZ5A 1UD4A 2X30A 4P8UA 4J3ZA 3FKRA 1JQXA 3GR8A 3AMDA 3SCSA 4WRHA 1S2VA 4S2CA 3CZJA 4OT7A 1W8SA 5U7SA 1DKWA 1QNPA 4NZ5A 1UZDA 1VHNA 3UZ5A 3WBXA 2OMAA 3MA8A 5LGZA 4D6FA 4JTGA 5C7VA 2ALDA 4ZOAA 5CGQA 3MYPA 3W1LA 1L2QA 2QCEA 1JZ3A 4IPIA 3LCFA 1WKYA 5KZDA 3DHDA 2PDCA 1P7TB 4DWSD 5C5YA 5EU9A 1HIZA 1PHWA 1CENA 4IOTA 5I7GA 4JKKA 1F3EA 2HWGA 1BFNA 1WOBA 1BHGA 1KWKA 2BNJA 1HJVA 4EPBC 1XDJA 1JVNA 5G4EA 2XVLA 4JX6A 1TTPA 1IZKA 1X1ZA 3ZS4A 2AQOA 3KTSA 2CZ5A 2IKHA 3MT1A 3KFTA 1TSIA 1F8IA 1U30A 1RZMA 2QF7A 2XFFA 4G9PA 3WQ8A 3DEQA 1F61A 2DSUA 4LFYA 2XIIA 4QEEA 5C7HA 3M6YA 2C16A 1EIXA 3NM3A 5CC6A 1MQRA 1FWJC 3BSGA 1QTWA 1ME8A 3CO8A 1M53A 4X22A 1I2QA 2FGBA 3AAMA 2ZCGA 4UUIA 5DMMA 4BR1A 5I03A 2Z1XA 1EJUC 3R8RA 4HMCA 3UJ2A 2RFGA 4M7TA 5I07A 4UNLA 4REQB 4DELA 4PCNA 4JTUA 3A4AA 2YYTA 4IIFA 5C6MA 1DP0A 1C9DA 1JGIA 2XU2A 4I8YA 1LJYA 1ONWA 2WMFA 3RUBL 3THCA 3O6DA 2Z0IA 3GXTA 4JTJA 5BU6A 3FDGA 1NFGA 2NLYA 1NJJA 4ROPA 1ZL1A 4GXPA 3MHFA 1S2TA 4WY0B 3TR9A 1XLEA 4ADTA 4RZ5A 3E38A 2EPNA 1JXJA 3KP0A 3M0LA 2NW0A 5GJPA 4IFOA 1FWTA 2XFRA 5D02A 3UYCA 3V36A 3U2EA 4UR9A 4RE3A 2OSYA 1IGSA 4PCPA 5BRBA 1Q2RA 1HF6A 4FIRA 1IXQA 4GKLA 4LVDA 3FHAA 2WVUA 2B7QA 5F2MA 2HVNA 3S1UA 4UTJA 2O9OA 3CAQA 2POZA 1CPUA 2EJ1A 3R10A 1KBKA 1TQJA 2XIQA 1R85A 3EBVA 3FOKA 4XTIA 3SQSA 3WNKA 4AHQA 2DVUA 2X7VA 4QX4A 2OG9A 1XKYA 3NDOA 2W9MA 1J18A 1KRCC 5T26A 3AYSA 2WMIB 4WZHA 1OINA 4JQ1A 3BZGA 3LPOA 3KOZA 1HVQA 3OP2A 3M5ZA 2RJGA 1D2KA 5DELA 4JICA 3E0WA 4CVUA 3KCOA 2EG6A 2VC7A 1W3HA 3NQEA 2V8ZA 1EA0A 3GNXA 3YPIA 1SYTA 5D09A 1RJQA 3B3DA 4XK2A 2WO5A 1GJUA 4S1FA 3S5NA 4RDZA 4R34A 3TJ4A 2XSXA 2E5DA 3MUY1 1DBTA 3U7VA 4O54A 3VNIA 3G0UA 2VR2A 4LQ1A 2C3ZA 3LERA 4F9JA 3ABSA 1CGVA 2JGQA 3ITOA 5JH2A 1QNVA 4AVFA 5LNSA 3DZ1A 3ARQA 1GGOA 1GUVA 1XM3A 1WPCA 2XH2A 4G7EA 2VFEA 4FOJA 4FOKA 2DT1A 4DB7A 4C7FA 1B90A 1ISWA 1P6WA 4J2MA 2FZNA 4O1FA 1IEQA 4D2JA 4L6DA 2QYGA 4HZ8A 1UR3M 1EH9A 3QZEA 3JZEA 3QQ1A 1R2SA 1J01A 4NIRA 1M1BA 1TIMA 4Q8VA 3UT0A 4K3ZA 4QJ5B 1RHCA 3VDAA 2VXNA 2P8CA 3LRKA 1AQ0A 1E0VA 2Q71A 4ZQCA 1CNVA 3DI0A 5FJIA 3JVAA 3H2AA 2E68A 1LLZA 4DM1A 4DYJA 3ITXA 4GE8A 1DPMA 4H8NA 5C70A 5HATA 3AUOA 2DUZA 1I60A 2W91A 4MJ4A 5AHEA 2D24A 3SUTA 3WQCA 5A6JA 2WANA 1EBGA 4FAMA 3GVWA 1S5MA 3L4XA 4H9YA 4YIWA 3LLFA 2PGFA 3A12A 2V0TA 1Y7VA 4MY9A 3OLIA 3E9AA 3C3NA 3N9KA 3SN1A 4Y9MA 2WLYA 1XC6A 4MUZA 3NQGA 4GUIA 2QDHA 4XZNX 1FHDA 4HA4A 3TK7A 3HN3A 1WZKA 4KWOA 2P88A 4AD4A 4IG2A 1W91A 4CKQA 1Z6KA 1GTEA 1QI4A 3DFTA 1RPXA 4AZ7A 4AEFA 1NF7A 3KW3A 1UD3A 1HJSA 4DWSA 4XAZA 3K30A 2W67A 3FA5A 3FJ6A 2BWGA 2H9AB 3PJWA 4HA0A 5G4HC 5KMYA 3N29A 3QFWA 2ON3A 4HU3A 1X6UA 1EF3A 3QC0A 4LYRA 1OC7A 2J13A 2YSWA 2B7OA 1QI2A 5I3GA 2J62A 2BVTA 2HVMA 3LZ3A 3GVQA 1KD0A 3AIUA 3RR1A 3LHZA 4K8GA 1H3GA 2ZICA 3WF1A 3QOKA 2W4XA 2ZDSA 5LIUX 3QZ6A 4MWAA 2ACQA 3CIVA 1PYMA 4MNLA 4EXBA 4H01A 3S1WA 2E7FA 1W9XA 4FLSA 1H1YA 4JTAA 4R9OA 5LIYX 3G8RA 5CXPA 2ABBA 1JZ5A 4O8AA 3IJ9A 3DFSA 1O5QA 1C8XA 5D9MA 1KKOA 5EA9A 3H2MA 4C6BA 1A5AA 1E4NA 1QVBA 3QRHA 2ZRZA 5KSWA 3RPTA 3MHGA 5L6UA 3C2OA 5CAHA 3O05A 3NO3A 1PEZA 3T8LA 2TRSA 4OOZA 3BJFA 1I75A 1KFJA 4A3HA 4B2DD 2DIKA 2GDVA 4HT3A 1IYXA 3CHFA 1SUXA 2ZADA 4IFRA 2FVMA 4PZVA 5LXXA 1PIGA 1R8LA 3W1NA 4PTWA 4IH3A 1OZQA 2J8FA 4V33A 3P8JA 4EOUA 4WIWA 2BV9A 5A5WA 1FWFC 1Y0EA 1PZ2A 4KIRA 1YX1A 1SMDA 4UQEA 1OWQA 2YZRA 1N2VA 4AUBA 5CPTA 4MYXA 4MTVA 4IL2A 1VLIA 3CLWA 4C1NB 1TO3A 1J5SA 3NM1A 1LQAA 4UQ9A 1B9BA 3KCLA 1LQ0A 3DHUA 3CMFA 4PC8A 5HXMA 4A8IA 3SJNA 4ZOEA 5I09A 2X7WA 2E67A 3CB3A 2V3GA 3QQWA 1EC7A 2V6AA 4GCAA 3WDPP 1E9LA 5CBJA 3THQA 3R13A 1HKJA 1C29A 2VFDA 3PZGA 4WGXA 4GYJA 3QTGA 4LVBA 3PWGA 3AU6A 5LNUA 1ZFJA 1H7WA 1FVPA 1EP2A 3ZT5A 3C0SA 1KXHA 2PDBA 4FNRA 5G1TA 1KXTA 1HKIA 5IRPA 5AB3A 1W2PA 3AOFA 1KB3A 3ES7A 3VD9A 3VDCA 5G1YA 5CSUA 3NQ8A 2TODA 1HG3A 5AC4A 2VWTA 3JZUA 3EA3A 1KW1A 2NVCA 1DV7A 1KCZA 1TPH1 3O15A 4JTRA 3EWBX 1XISA 3ARSA 1ENUA 3CUXA 1R46A 1XIBA 1I45A 1M7XA 1W3NA 4AZCA 1HL2A 4CNUA 4PUNA 3RMJA 4D8ZA 4O13A 5HDRA 4PBEA 3VOFA 1NVMA 4P61A 3VKDA 4LF2A 3EAUA 1IHIA 5GNZA 1Q2SA 3ARRA 1TR9A 2E1WA 3EWWA 2WKJA 7ENLA 1XSKA 1Q6FA 4NNBA 3GU2A 3M16A 3WF3A 1LT7A 1ESWA 1RR2A 4JIIX 1TVLA 3W76A 4HNCA 4NP7A 4WHBA 4ASTA 3DIPA 1KFLA 4XUGA 3W7MA 1GYLA 2PFHA 1TX0A 1GOOA 4HPNA 4IIEA 5HANA 4RV8A 3IACA 3K4AA 5IOBA 4C1NA 1EOMA 1XYAA 4JIPA 3P8IA 3S1XA 4PFMA 1VRDA 7XIMA 2PURA 2VURA 3VIMA 1QW7A 2ZA3A 2V5KA 2GVGA 3W26A 4UFMA 3ZSTA 1B30A 1HNYA 1JG9A 2HS6A 1FWCC 1THFD 2E6AA 3A64A 2OZTA 3WLHA 1GJPA 3T81A 4DO7A 9XIMA 3LHVA 3L67A 2QPUA 4W88A 1QK2A 1V7YA 3ENLA 3WL1A 2YFNA 1B9ZA 3UEQA 4NL1A 1NDVA 4FI4A 2PP3A 5CC7A 5EGRA 3PBVA 4LB3A 1E9YB 4TR9A 1M7PA 4S3DA 2ACRA 2YA1A 8CGTA 5MKGA 1E55A 2C0HA 2PEVA 3RRXA 5BRQA 2VZSA 1DXFA 3KOXA 1V6YA 4OBTA 1DHKA 4ATDA 2G3NA 2Z2AA 2J9XA 3L9CA 4WQ6A 1NFPA 3GW0A 1UP0A 2QUNA 6XIAA 4NJGA 3VCNA 1AQMA 4JYFA 4MNKA 3LV5A 2VRKA 1AL7A 1EA9C 2OELA 1W32A 4YTSA 3W7JA 3E2RA 3NOYA 4GO9A 1QPRA 5BXRA 1WKDA 4IGSA 4M80A 3A23A 4U3AA 2NQ5A 3ZMRA 3V16A 2HCVA 4TMBA 1FOBA 1FY6A 3B4YA 3WQDA 1K8CA 4L1WA 4I6KA 4I8DA 2G50A 5CSRA 5A3HA 3PPCA 4FNTA 3C2EA 5FAGA 4WKHA 4M51A 4XSMA 3IWPA 3O6CA 3CWHA 2HROA 4RNHA 3Q94A 1XG4A 4J3SA 4H4IA 3VNDA 1GVEA 1M7OA 4Q8PA 3WJYA 1P6BA 3NEHA 1VEMA 3WH7A 3BLDA 1UMLA 3A4WA 3A3XA 2YDQA 1MDRA 1SO5A 1VAHA 3CQJA 4XTDA 4IP4A 3V7PA 3NPUA 4JS3A 3H2CA 1UR8A 4PMVA 3PY2A 2ABAA 4OGZA 4FX6M 5LIWX 2V9DA 4AWEA 4XWUA 2F2KA 2EF9A 4JTHA 1RALA 1TWDA 1AG1O 1RPKA 3AHTA 1S2UA 3S5SA 1A50A 7A3HA 3C2FA 4KT2A 4NRRA 3FAXA 4PL1A 4HNLA 3WFLA 4LGXA 3L5AA 3GSMA 5B80A 4NZFA 1JFXA 4ICNA 3GC4A 2Z24A 5T91A 1SZRA 1V3JA 3VDBA 2WOQA 3A9BA 4FXFA 2XUCA 1F4HA 3VINA 3F4CA 2F8QA 3HFYA 5TD4A 3RMEA 2IW0A 3R89A 1R6WA 1F76A 4HPXA 2FB3A 2R82A 1DIDA 2OB3A 3SQLA 4GJIA 4YPJA 3IV3A 1VFTA 3THDA 6XIMA 3C56A 4QHRA 2AL1A 3GTIA 4EXAA 3QPYA 3UG3A 1OABA 3H8AA 4GVIA 4AZ5A 4CD8A 3U4AA 3T1GA 3NR0A 5CPNA 3B8VA 2I7GA 2ZX6A 3G3MA 4EAYA 2ZZ7A 1DJXA 4PUJA 3OZPA 3LGGA 1HJWA 4JQ4A 1L8NA 3R0DA 4RDYA 1G67A 3WQVA 1PKMA 4IL0A 2UBPC 4XV0A 4XD5A 4DJED 2O4MA 4LAKA 3EDDA 1OFAA 3R5EA 1XYBA 4CLMA 3RLHA 3PUEA 5C55A 2ZTKA 4OBSA 4H7VA 4C91A 2VCAA 3WBAA 2ZX5A 3HGOA 3QXBA 3SN0A 4NF7A 2FZ9A 4S23A 3XINA 5HWMA 1NU5A 3UXKA 4ERGA 1EFZA 3W72A 2PLCA 1BKSA 1Y5WA 5JH1A 1ONEA 1AMYA 1DWFM 2OX4A 1OFPA 3VX0A 2AAMA 1ZS2A 1XRTA 3UXAA 2JE8A 3UWWA 4AX6A 2XYLA 3GH5A 1Q3NA 4WOZA 3B9OA 2P0IA 1JYXA 3C0QA 3STPA 2OOGA 3MO4A 1L0PA 3W1MA 1ZP4A 4TVUA 1P0KA 1VFLA 2BY3A 4RZ4A 5A8QA 3P61A 1EJRC 3AC0A 4Z42C 4FLQA 2OPJA 2GGGA 5I5RA 3T08A 3WMCA 2EAWA 3PBGA 2QAPA 4LWWA 1G4PA 3SCTA 2Y7DA 2VR4A 3M1ZA 3CUHA 4MFEA 3TV8A 2GZXA 2ZA1A 1TV4A 1UR2A 3PP7A 4IWWA 1VYRA 1EPXA 4NZCA 5I3KA 1TPEA 3L2LA 1XQLA 3H55A 3RPDA 2OYKA 5A2AA 2V2CA 4XZMX 2UY3A 4DZAA 4D8LA 4WCJA 1OX4B 3MJYA 1U1HA 4RXFA 5A95A 3BQ6A 2RAGA 4WY0F 4NUWA 4GJJA 4H1ZA 3NSMA 3DBPA 1SZFA 5JBEA 3HQ1A 4L5ZA 2ZWYA 4J3VA 2GLKA 4UTWC 1LP6A 4ZQMA 1O5RA 3B8IA 1W17A 4MLJA 3ZR4A 3S2MA 3FSTA 1K9FA 4YYCA 5LZLA 4P8VA 3CL8A 4DRSA 3IUIA 1FRBA 1FTXA 2VEMA 1TZ9A 4E8CA 3NSNA 1ME9A 4IXXA 3CUZA 1O94A 4DYEA 3ZLHA 4OV9A 3QM3A 3CZGA 2WZTA 1OFRA 4TO8A 4D8AA 2WPBA 4WKAA 4DBSA 2QVHA 3VK5A 1QUMA 5H6HA 3PG9A 3EDKA 1E5NA 3O6AA 1E1FA 4FNUA 1BEUA 4LCRA 3MANA 5LNVA 2ASHA 4JR5A 4FNQA 2FZMA 1ISXA 1Z42A 2VT0A 4XBSA 2AOSA 2G3JA 2J8GA 4PTNA 3H70A 3GAKA 1NOWA 5HAOA 3A47A 1T6MA 4H9TA 4O1DA 1GOXA 4BFAA 1PDZA 3W6LA 5JXQA 1XIJA 4Y6GA 1FFRA 4OVXA 2OO6A 4DUOA 4W85A 3TTEA 4YS1A 2GVEA 2J6XA 3HOJA 9RUBA 1TV8A 3ID7A 2ZYFA 2VRJA 2IKIA 1S2WA 2EG7A 6TIMA 4OIFA 3NPVA 2EPKX 4PEKA 1DQWA 1F6PA 1JDEA 2I17A 4RE4A 4S38A 2OR2A 1TWWA 1EOKA 3VOCA 4IQEA 4LTSA 4DM2A 1PTDA 1XX1A 1WYIA 1XLAA 4EXQA 5A6MA 3TJXA 1UZ1A 4PUMA 3VD3A 3G1FA 4C5ZA 2YCLB 2GK1A 3F4VA 1GCYA 1GPFA 3G77A 4JYEA 3KOYA 3EKLA 4AEEA 5IXEA 2ZRUA 2ZUUA 1I4NA 3G1DA 5D9OA 3SCUA 4L7ZA 5DRIA 2IXUA 2WSRA 2E28A 3GB6A 3GVGA 4WX2A 4MB4A 4CD7A 4XKYB 5AZ0A 2P3EA 2ZE3A 1WDWA 3CH0A 3TP4A 2QIIA 3F1QA 3ZT6A 5G4WA 1E71M 2NV9A 3HBLA 4W5ZA 4EK7A 1NOFA 1P5BA 1WDRA 3WMLA 1UC5A 4W8BA 4XZ9A 3VUSA 1EUNA 4JFTA 2QCDA 1AK5A 5C9RA 1GW1A 1UOZA 3F4WA 4W89A 3T0AA 4NAEB 2PUZA 1KFCA 1B0IA 3MPGA 3KBSA 1K3UA 5D37A 2J24A 2C15A 2J4GA 1Q7MA 4UTTC 4BI7A 2OGJA 1EDTA 5DO8A 1K70A 4U2ZA 1Z44A 3AS2A 4DJEC 1W3KA 1J96A 2Q8ZA 4MNJA 2BHUA 3G1RA 4KCVA 4F0SA 3GNPA 1XH2A 2DH2A 4L4OA 2WBKA 1UIPA 1KTBA 4J4KA 3SR7A 1OCBA 5BZAA 3WDRA 4MZ1A 3TNOA 3E96A 4QDPA 3VOGA 2PI6A 4OUEA 4S3BA 3VFLA 3UG8A 4QQ3A 3K8LA 5CBIA 4R7WA 1JD7A 5ABFA 4L1XA 3KS5A 3TH6A 4AD0A 1MZHA 1OG6A 4WDTA 5GPRA 3GIPA 3S9YA 4GNJA 2W3ZA 3IJ7A 4LJ3A 4NZJA 1YYAA 1DQUA 1NQKA 1M5WA 4X63A 4FEZA 3VPLA 4S3GA 4IXHA 1ECEA 2DH3A 4G1KA 3TTYA 2B7PA 3EA1A 2VX4A 4QTGA 2V68A 1MFVA 3BLOA 2FZDA 1OFBA 4GC3A 1H61A 1YPXA 3AJXA 2FPTA 4IX2A 2EBNA 3HPFA 3ZWSA 3L4WA 2HK0A 1EUAA 3K2GA 6PTDA 1KQZA 2W0UA 2ACSA 2ZRWA 2J7DA 4UFKA 3QY8A 5T9BG 3IIOA 1AFSA 1UWIA 4HJWA 4ZE5A 1CIUA 5C9WA 2OEKA 4ZEPA 4POCA 1M3UA 5E70A 3QY7A 3TQVA 2UZ9A 4H8VA 1ZU8A 4O57A 3UG5A 1H5YA 3W2LA 4GVFA 1JCNA 1K03A 2VGGA 4WXZA 2YW4A 1YTDA 3Q37A 4RZBA 2PTYA 1T41A 3RX2A 2C7FA 4GY7A 3MUZ1 3ANYA 3PPFA 3LPFA 3WCZA 3CUGA 1M03A 1UP3A 3QR1A 4AC1X 1LBFA 2WZIA 5CZ0A 3E2QA 1CCWB 1UC4A 4HP5A 3MKKA 3OIXA 2WMJA 3S2JA 2O9TA 1A5UA 1E5JA 4D1IA 2OQYA 1Q63A 1EQCA 3W27A 1DTNA 2OLHA 4U5IA 2CITA 4Q4KA 3EKGA 1AW2A 2NQJA 2FTYA 2QEZA 3L68A 4EE9A 3I68A 4Q22A 2HPMA 2YL6A 3B05A 4ZSUA 2QMJA 4PSRA 3V35A 4B5TA 5J5DA 3KVLA 2O7SA 4GI8A 4KEZA 3H2OA 1W3IA 5DMNA 4ZO6A 2XPKA 1E6ZA 1I2NA 3G1AA 1GVYA 2D0HA 3SDOA 4JTEA 3KDNA 5I77A 1D7FA 1VBUA 3S5ZA 4MF4A 3HG2A 3FW6A 4RPPA 3M6DA 3GXFA 1QO5A 3OEXA 1OYBA 2WM0A 4YTQA 2CWNA 1JAEA 3OGSA 2CYGA 3T6CA 3E0IA 1C7SA 5I6SA 2Y4SA 4R85A 1UKQA 1A4LA 3TLLA 3TYDA 3MUCA 4A35A 1UG6A 4UB9A 3N2XA 1JDFA 3UD6A 2AQWA 5IDZA 2NSOA 1HX0A 5FJRA 5BMWA 2PGRA 4CEXC 4ERIA 1A5CA 3TSDA 4S3CA 1V93A 3GH7A 4TX9A 3VMPA 4H9UA 4LEQA 5H8UA 1XLIA 2PDGA 4IGHA 1MUWA 4GO8A 2ZIDA 1PUDA 3GKFA 3DX5A 2V5LA 3CV1A 4IJRA 1YNPA 4HKPA 5C9UA 1GZGA 3TN4A 3W81A 1H51A 1CW2A 5AY7A 2ZRYA 3BAWA 3NNTA 4O11A 3PAJA 4KF1A 4JN8A 1XPYA 3PB0A 4AHPA 5I2UA 1AZ1A 3TDFA 3THUA 1MNSA 1UR0A 5CZSA 5LHEA 1IZCA 1XUZA 2PAJA 4HYRA 3CB8A 4GYFA 4WK9A 4N2YA 5LA2A 2ATMA 1TCDA 2GJPA 4R7JA 4YLWA 4JY8A 1C93A 3N6HA 1TA3B 1CXEA 1A3XA 3RRAA 1Q4NX 3GS6A 4WXYA 4L9ZA 2G0WA 1V3LA 2WXDM 5CEWA 3PBUA 4DY1A 2EPHA 4Y96A 4N4QA 1O6IA 4EPDC 2FB2A 3JRKA 5K4ZA 1GVOA 4L6HA 4ICMA 5HUOA 1KFKA 2BVWA 4L64A 3C0JA 2WNQA 3RM4A 1ITUA 5TBOA 2ZWZA 3L65A 1X6NA 3TSBA 1R3TA 3FIGA 2D2JA 2QCNA 2YKKA 2VR5A 3VC5A 5EY5A 5HWJA 1HXJA 4O0ZA 4M81A 1H7NA 1UBPC 1XDLA 4YHGA 4HMNA 3BW4A 3DN5A 1ML1A 4UR8A 2ZKMX 2NX3A 3CIXA 4KWVA 4R5EA 1JPKA 3GM8A 4J5NA 2J6VA 3S5OA 3WLLA 3OLGA 4BI6A 3PR2A 3VNMA 4QIUA 1REQA 3LGDA 3L4YA 2CBJA 2J88A 1F3TA 3VDGA 4L1GA 1IGWA 4JEQA 2F2HA 1WBHA 4F9DA 3ZIZA 1QBAA 4A8RA 1JEZA 5JQ9A 1LM1A 4GOAA 4YHEA 2X1RA 1CYGA 5D8WA 2CFFA 5A8GA 4ZQRA 3T9PA 1V79A 4O16A 4QE4A 1KKRA 3VYLA 3TE9A 3WD2A 5AHLA 1EWDA 4WEVX 3RU6A 3IVTA 3UJRA 4Q8MA 2JKEA 1LZOA 4U28A 4CN4A 4PCFA 4LV9A 2PC8A 3F2DA 5CQ1A 4Y90A 1V3IA 5DT5A 3DHFA 1DJIA 2EKCA 4ZR8A 2XH4A 3E2SA 4JHOA 2ZC1A 4EPEC 1NARA 3NQVA 2D73A 4NILA 1MSSA 1C91A 1UR4A 3IUDA 2PC4A 4AIUA 3KRSA 4FR6A 3A3WA 4QS6A 1FWRA 2ZX8A 1QPOA 1OFQA 1P0NA 3REQB 1H5VA 4F40A 3G1HA 1CI1A 3RHGA 3ALGA 1EXBA 2R14A 3MSYA 3GO2A 4AU0A 1LROA 2DEPA 2XSAA 4E8DA 1GQIA 2C1GA 3GFXA 4JL2A 1NELA 3UA4A 2PRLA 3PTQA 2FJKA 3CS2A 4V1YA 1DIKA 2QKFA 2PLKA 2QCGA 1TKKA 1PIFA 4UTTA 5H2ZA 1W56A 3VNZA 4C6EA 2DZVA 5AVHA 3ATZA 1DL3A 3WEOA 4AAJA 1JD9A 3GC5A 1FWWA 4UOJA 2QVNA 5CZTA 3NZRA 1PSCA 3WUEA 3LY0A 5BNKA 2QUUA 1Q6RA 1C92A 7REQA 3S6OA 1OVDA 2PDQA 2FQIA 4JFWA 1UKTA 3KAOA 3R25A 3QV9A 4DYKA 4AMCA 2WMHA 3BOLA 3NOEA 4ZL1A 4M6PA 3GE7A 3PUOA 3U5YA 1PS9A 4JL1A 4W86A 4B5XA 1UD2A 3B9EA 5I3FA 1TTIA 1EP1A 1P43A 4BF9A 2I1OA 2IQTA 1U22A 3OG2A 3G8EA 2GK1B 3OBKA 4K6AA 1P1MA 3UZWA 3NG3A 4MB3A 4JHZA 4DBUA 3UQNA 4W87A 2UY4A 4X61A 3AYRA 4I9MA 4XKMA 2F6KA 5LGXA 2GJXA 1JPDX 2O7QA 5HWNA 4UIOA 1G4EA 2X40A 5J8LA 2V38A 2VGBA 5EL1A 2PDMA 2DZBA 2A2IA 4A8LA 3P74A 3W1UA 3NDZA 4LF1A 4JTDA 4D6JA 5CC3A 3SUSA 4F2BA 1W5NA 3TC6A 1R2RA 4LUIA 4JN7A 3PZQA 2OYLA 3O07A 1MW2A 1U5HA 3VDHA 3DBNA 4IMDA 1GVIA 4XBKA 3AU2A 3G0XA 1YDNA 4M56A 2CESA 4CCEA 1VCFA 1FHVA 3H54A 2D2OA 4R3UA 3KBMA 3LHYA 4B90A 3QPZA 2I5GA 4O18A 3OBEA 5DBTA 1PTAA 2VM8A 3H2FA 4B92A 1S5WA 1LBLA 1IT0A 3LLDA 4TX6A 3WLPA 3FEQA 4F2UA 1EQPA 1EXPA 4FS9A 1UASA 1OQFA 3SZ8A 3B8SA 4ERAA 4BF7A 3SAZA 4DZHA 4F48A 3HGJA 1EZWA 2A1YA 3O1NA 4JXCA 4EF8A 3GNRA 1YE6A 1JR1A 5BWFA 1B54A 5FOOA 3S46A 3KBVA 3OHIA 3TU9A 4BQ4A 1WOAA 4UMCA 1RVKA 5JIPA 1KM1A 4Z1YA 4UTWA 1B3OA 2ATSA 1QATA 4HOZA 4C6MA 2J79A 3V5CA 1O66A 1JRCA 1OCNA 3BMWA 4C6OA 3N1AA 5HQEA 3VGGA 4C6IA 5E6YA 1DJNA 3UWZA 1J0HA 1M7JA 1VFOA 4WKFA 5IM51 3DFNA 4QG8A 3MCMA 4AF0A 1MRQA 3AO0A 3EMCA 4M1BA 1R7OA 1MZRA 3GHSA 1FWHC 2Y5JA 1A3HA 4WDXA 5D2TA 4UTKA 3RM9A 3BGAA 3DECA 1H2JA 3MP4A 2BFGA 4RW5A 3TA9A 1EJVC 2ZXAA 4C6DA 4E4UA 3QPEA 2A5HA 1JDDA 2I5IA 2QUMA 3ARXA 4ADUA 4JTLA 1MQQA 4DEFA 3S6DA 5GNYA 2DUAA 5IFPA 1P1XA 1O95A 3IRSA 5CSYA 3TWBA 3S8HA 3LN3A 1HJXA 3RK8A 4UQAA 3LMYA 2FPYA 3K5XA 4WSJA 4KGLA 5HQMA 2NXGA 1XF0A 4B4HA 2O4QA 4DJFA 2ZUNA 5T9CE 1NAL1 3ARZA 3M4HA 3WYZA 2ANUA 2JF6A 1E6RA 1VS1A 1RAKA 3STFA 3UZXA 3NPXA 2PWGA 3UPMA 1BXBA 2Y7GA 3MI3A 1L9WA 1UQZA 5JMUA 3MBDA 4MB1A 1TPB1 2E8YA 1EEPA 3W1TA 1XH1A 4GIYA 4ZB2A 2VEPA 1I1WA 1VFSA 3I3EA 5AOUA 3TMQA 1CLKA 1OEPA 4J27A 2V63A 1U5VA 1LOSA 3TC3A 1A80A 2PWHA 4E6MA 3KX6A 2ISDA 3BAJA 3V5OA 1OF8A 1PKYA 2G8ZA 3W01A 3ZVHA 3NGJA 1W5PA 3P5YA 5F4WA 1OCQA 1YPIA 1VFHA 4QQUA 4NNAA 3EOEA 2HXTA 2WYSA 1DWIM 3OJGA 4RNFA 1J93A 5LHFA 3BJSA 4AX7A 2P0OA 2Y63A 4AIOA 3DG6A 5EMLA 5KINA 2X05A 3VILA 2I5QA 3BCFA 3UPWA 3GBEA 4NJIA 2WHLA 4BCEA 4R27A 3B0VC 4XZWA 1KXQA 1H0GA 3SJ3A 1C3FA 1V6TA 1F3XA 5A8OA 4QBXA 4PCTA 3U3HA 4BEQA 1JJKA 1MW0A 3I7SA 2XVNA 2WNZA 1QNSA 3OODA 2W61A 2HXUA 1TB3A 4W4QA 5BRPA 5A69A 3BE7A 1AW5A 5C71A 5I3IA 2ZVIA 4X0VA 1ECQA 4ZB5A 4NAFB 1AQHA 4XKYA 3PFMA 2OZ3A 4QXIA 2X1TA 1SO6A 3DKLA 4MIMA 3VIOA 1EHNA 1B4KA 1VEOA 1QNQA 1CGXA 2QCCA 4O1CA 1U33A 4GKTA 1KGUA 4A21A 4XZHA 3H12A 4PODA 1XGEA 3WJXA 3AWNA 4PUEA 2Z6IA 3WFZA 4FXJA 1P0BA 2C18A 2CLFA 2TSYA 1JPMA 3L5MA 2VX5A 1UWTA 2FPVA 4Z2LA 1V02E 1W6TA 2FYMA 1TV7A 1OFEA 2P8BA 4OU1A 2P3ZA 3AHXA 4ACZA 3RAOA 1ZGDA 4MOZA 2J47A 3HA1A 3CZLA 3WD0A 4IMEA 3WSUA 4OJYA 3EMQA 4YXGA 4GY1A 3ITLA 3BLEA 2GQ9A 2E6YA 1SFTA 2GUUA 2OSWA 3D0CA 4W93A 3ITTA 3VKAA 4HGXA 1EO5A 1XGDA 3KZPA 3EX3A 4N4PA 4DI9A 2HZGA 2QF8A 4PE8A 1KLYA 1KGXA 1FDJA 2GWNA 5CH9A 4PH6A 2PDFA 4CVWA 1RCXB 2OLAA 5C2GA 5ECVA 4Y9AA 3IIZA 2J7FA 3BW3A 2E40A 1SZEA 1XYCA 4PB4A 1G7UA 4JTKA 4ATLA 1A4MA 2HDJA 1UWQA 3RCMA 3EWXA 1JZ4A 1V0KA 2C8NA 1C8YA 5HR6A 3TYZA 3MSRA 1SJBA 2D0FA 3QOMA 4C7GA 3F7JA 1NDZA 4H83A 4A29A 4UMAA 1VD6A 1TPWA 3P81A 1SJCA 2V5CA 2J77A 4IGNA 4UR7A 3RXZA 4QG6A 4GZJA 1YQ2A 4FF5A 1EC9A 1H1ZA 1W3JA 4IPJA 5ABHA 1DJWA 1F05A 3EOLA 4Q8NA 7PTDA 5EMUA 1W3TA 1KFWA 2DT2A 3VCRA 3M44A 4MAVA 1EJSC 4HSOA 1VB9A 3BUVA 3LENA 1HP5A 5J04A 4EKJA 4K7YA 2HJPA 2AKMA 4MZ8A 2CLKA 3O7UA 3PJXA 4XZBA 3LM3A 3EXSA 1AL8A 1A3WA 3RITA 1LUCB 3D47A 1PWLA 3HIJA 1XLKA 3GX9A 1Z32X 3WLJA 3NXLA 5BYWA 5D30A 1XJBA 3I6RA 1OF6A 3HG4A 3ITGA 4PB3A 4PRWA 5HULA 3BAIA 4W84A 4CQ9A 2DORA 4K39A 4NT0A 4PUUA 4KCTA 2GYIA 4HCDA 4JTIA 3KVMA 3JU2A 4EWJA 4JTFA 3R79A 4XX6A 4IJBA 3GDTA 4PFHA 4LUYA 4J35A 2Z25A 4IT1A 3QR3A 2IS7A 3WDHA 4DJFD 1VGAA 3Q58A 2PF8A 1TV2A 1QPNA 1YLVA 2VZVA 4M3PA 1TPFA 3SURA 4F2TA 4DI8A 4AXKA 1MI3A 1GZJA 3KHJA 4B5NA 5C54A 2R1KA 1I8JA 1NWRA 3ZSSA 3S42A 3MTWA 4DBDA 4UWMA 4FLOA 3KL0A 4MUPA 5HJLA 1OBAA 2DZTA 1TREA 3DXIA 3TYUA 4BQ3A 3PZVA 3MY9A 1ZCCA 4AB4A 4PTMA 3MHUA 2P5NA 3S6TA 3W7EA 2PSNA 5CGMA 1NWUA 1EC8A 3NL6A 1E73M 4HHPA 4A2RA 5XINA 1JCTA 2G97A 3FYOA 1ZNNA 3HG3A 1JUKA 4D6DA 4JY9A 5I23A 2D69A 3MCOA 4Q8UA 1BG4A 2OXNA 3E0LA 2ZVRA 2C13A 3M0XA 1GW9A 2WPGA 2JGYA 5FI8A 5B7YA 3V0UA 3M0YA 4DUVA 4GGHA 3L0KA 4DZ5A 3WD4A 3NAVA 2DDXA 3GG8A 1BD0A 2ZXQA 5ABGA 1FCQA 1XH0A 3TZFA 3STCA 3GR7A 1A5BA 3IAPA 3HU7A 1KR1A 1M65A 2AMGA 2BY2A 8RUCA 3HGSA 1EJXC 3H4XA 1MXGA 2GDUA 1VHCA 4L56A 2OJPA 3KRBA 1Q45A 3FLUA 3RFAA 5D05A 3AIWA 1B3ZA 4QCEA 3MSDA 4S3AA 1DIOA 4RR4A 3TAOA 1PCWA 2DQXA 1SFLA 2IPGA 1H0IA 4RW3A 4MYAA 1FP8A 4P7RA 1V6WA 3SBFA 3TYCA 1E0WA 1ITCA 2W79A 4K68A 3W2NA 1WB0A 3B06A 3KP1A 3FVDA 4HYVA 4DPQA 2OGYA 3WF2A 1TMQA 4KEMA 3WLNA 2BOFX 3CHEA 3LBOA 2Z1VA 1LYXA 2E9BA 2HK1A 3W7QA 3A3HA 1NQ6A 4DPPA 3OGVA 4I9JA 4BQ5A 4CU7A 3BAXA 2CC0A 2J7HA 3DYMA 1H4PA 4NAFA 4Z17A 2ZQ0A 3EXTA 4J3TA 1XIMA 4MLRA 2GJLA 1VCVA 2YFOA 1YPFA 1DWJM 1L6YA 4FR1A 1IXOA 4E5TA 2PU0A 2YOCA 3GIQA 1UD6A 4IQDA 3ABOA 4DJDD 1UQYA 3DC0A 1ZQ5A 4PR4A 3RG6A 2E0PA 1GYNA 2VOMA 3OVQA 1NF0A 3HJEA 4J28A 3VMNA 4Q4RA 5FEPA 3HPAA 2F61A 3UBPC 2J7EA 3GRIA 1IT7A 1J4EA 1WDDA 2SFPA 1V0LA 4O1BA 4JAWA 2DZSA 3QYQA 1EPVA 2XFWA 3ZQ9A 1DTUA 5FAJA 1XCXA 3NPWA 1I0DA 2WKGA 3TCSA 4DLMA 3GLCA 3OZMA 1J0YA 3AQUA 2IQDA 4AD2A 4J40A 1XDMA 4N9DA 4JKMA 3LNMA 4B16A 3CV2A 3UVAA 3CLMA 1GOQA 4GC4A 2EPLX 3BOXA 1K02A 2XM1A 3H23A 4G1NA 4TTUA 3NL5A 5BU9A 3UERA 2CKRA 1BF6A 1P4CA 4ZB0A 2Y89A 3QV7A 3SGUA 2INFA 1JFHA 3TZNA 5G2HA 3NUKA 3BO9A 5LA1A 4V15A 3U2ZA 4O10A 2PCQA 3SN4A 4PTVA 2VEFA 1TZ7A 1XI3A 4S3KA 2CZDA 3R4IA 2A6LA 1XD0A 2GWGA 3WLOA 2Y5EA 4QS5A 3M0ZA 1SFJA 2DV0A 1BQCA 4HB7A 4K8EA 4LYPA 1FX6A 3TLQA 5E93A 4HN4A 4QSFA 1Z3NA 2RDUA 3WLKX 3AIEA 1R3YA 3PZUA 1SO3A 1Y5VA 1VRXA 5RUBA 4QEHA 3O0FA 3T2PA 2QNEA 4HN8A 4UTMA 4YWIA 1BAGA 4Z2GA 3DFYA 1ONRA 5KITA 3SADA 1GJWA 1KM6A 3LA4A 2C0AA 2CLHA 2PDPA 1DVJA 3MI2A 6A3HA 5CG7A 4PA8A 4US5A 2J75A 5ABEA 4XSLA 3ZYZA 3GZ3A 3W70A 1JAKA 2NLIA 4HA3A 1GOIA 4DF0A 4QAIA 2FTWA 3ONBA 3DAQA 3T0DA 4LOCA 6REQA 1CXKA 1EP3A 2V5BA 1A49A 3UR8A 4TX8A 2PCEA 2ICSA 3M7SA 3PUDA 1QI0A 4LYKA 2QLYA 1ZAJA 5DCBA 2UV8G 3P0XA 4NU7A 1FWIC 1LRQA 1QHZA 1GOMA 3D5HA 1UB3A 1GKPA 2VFHA 4Z2KA 3CHCA 4UFHA 3ZZ1A 2XN1A 1LWJA 4PUWA 2NX1A 1J2BA 2BXYA 1HGYA 3EPOA 3BTNA 1POJA 4XVEA 2Z26A 3BG3A 2C19A 3UWYA 3GTHA 1GONA 2OWCA 3V1PA 3OGRA 2YXOA 3MU7A 3L0NA 4PL2A 4M29A 3GY1A 1DJQA 4NJJA 3CU2A 5MF5A 4PN2A 3ELFA 3FSUA 3U9IA 5A6TC 3SEPA 3L4UA 1YDYA 3E6EA 2GPTA 2G3MA 4GD0A 3CPRA 1R7AA 3PTMA 1WKFA 4LC6A 4C6QA 1M04A 2DT0A 1TJPA 4KETA 4L65A 2PTZA 1V8EA 3OU8A 1OGBA 3P93A 2NXHA 3IJIA 3TCEA 1Y5XA 3TQ0A 2QJMA 3F2BA 2DVTA 2YBVA 5EFFA 2VO5A 4FO4A 3B97A 2D23A 2D2HA 1SJDA 1US2A 3EOUA 3GDRA 4FNSA 1DJZA 3MKCA 1O5XA 3O3RA 4JX5A 2WBGA 2ZA2A 4V27A 1V7AA 4MZYA 4E2OA 1GVQA 3O63A 3VVGA 2ACUA 3NDYA 2O56A 4DXKA 2C79A 3S47A 1QWKA 3LSBA 2JKPA 3QSRA 3GQYA 2NXIA 4YU1A 2QCFA 2BY1A 3CAWA 3LCGA 2BSLA 4H8HA 3GG1A 3M5XA 2G5WA 4RKAA 4X3ZA 3LTSA 1OIFA 2DJXA 3LQLA 1D3CA 4F0RA 2VZOA 1FCBA 3T2QA 1BSIA 2TAAA 1WXZA 2MNRA 1IQ8A 5HQLA 2B81A 1BLIA 1TV3A 3T0TA 4JX4A 1HJQA 3VI2A 3N2OA 2INEA 2WV8A 3POCA 4Y7EA 1ZJBA 3BLLA 1GQJA 1IWBA 5C8BB 3MSGA 1KWGA 4H6RA 3PZIA 1WZMA 1FXPA 1KCXA 3QW3A 3DC8A 3SUWA 3WDIA 1XLBA 3AZTA 1N55A 3KCJA 5GVJA 1GG1A 1KLZA 1CGTA 3N25A 3VMOA 2PA6A 3MMWA 1FCUA 4HHHA 3AIQA 1Q6DA 2WQPA 2PD5A 3LQGA 3WNPA 1XPGA 3WNMA 4WJEA 2A7RA 4G7EB 3W2UA 4AXNA 3ANUA 5IHRA 1I9CB 2BXVA 4JTTA 3QV8A 1XIGA 5EKYA 4UOZA 4MFDA 4PGLA 1XINA 3OYXA 5BXSA 2PWEA 4GUJA 3MZNA 1IZJA 2R1NA 3PHAA 3QF0A 3GBDA 1X98A 3PNUA 3W75A 1V0MA 4PCSA 3VUPA 4CN1A 5F1VA 2XG9A 3PZ9A 2DSZA 1VBJA 3GXIA 4S39A 3ALFA 2MUCA 4D6GA 2YLLA 1FWGC 1T40A 3E0VA 5IFTA 1VJIA 3IJ6A 3ZO9A 4MADA 3V5FA 3U57A 4H7CA 3M0MA 5DCEA 3CWOX 4XIAA 2WWCA 1WP6A 3QSTA 4CNPA 2CIPA 4AG0A 3D3AA 4MPKA 1O5KA 3OLEA 4WVXA 4XAGA 4C7DA 2QV4A 3SCWA 1XFBA 4AIEA 3WFAA 4MVAA 3NO5A 3L4ZA 2FMOA 1XXXA 2IKGA 5CPOA 1VH7A 1VFMA 4IX0A 1TTJA 2PDUA 3VNKA 2YCLA 3CBWA 4PUKA 2CXGA 5DT7A 1R9YA 2XVGA 2Q3RA 3MP3A 4M1RA 3T7VA 1XL9A 4W7VA 3VGFA 4YNGA 1DJGA 1RK6A 4R53A 4JDBA 1ZP3A 2XH0A 3LG3A 4W5UA 4ADSA 3AIVA 4KH2A 4LBRA 1HL9A 4Q6XA 4AWSA 2WJZA 4H8UA 1X38A 3L21A 4TVDA 2XGZA 4MWAC 4S3FA 3A22A 5KETA 1B3YA 3QVQA 3TWAA 3NSXA 5DXXA 1KRBC 3FGCA 2BODX 3SGZA 3RPMA 2E9MA 1OX6A 2NVAA 3USZA 3VGHA 4P7NA 3N4FA 4GMEA 4CQ8A 5DQPA 4NI8A 5AC5A 1ZJAA 1TRDA 2FH6A 1HN1A 2DPEA 2XZ7A 4I5UA 4DXVA 4JNYA 4XO6A 4AWUA 2CERA 3UXDA 5HNUA 4DXXA 1JYVA 3RILA 4KCWA 1C8VA 3P62A 4DWSC 4URIA 3K8KA 2KAUC 3O6YX 3VNYA 1UKOA 3ZVHB 1ZBKA 3ITYA 1S3TC 2WJDA 4JTCA 4WR3A 4OUIA 2X1UA 5JBDA 5A6KA 2GVLA 2OX1A 3DFPA 4PSPA 1WNOA 1JL8A 2Q02A 3FJNA 4AEOA 1TYGA 3UNTA 3G1SA 1XLCA 5H8MA 4AQLA 4L9YA 3N9SA 3K46A 1I0BA 1A5MC 3MCNA 1IE7C 1HKKA 2VC6A 1UPMB 1WUEA 4M6VA 3BLIA 2BOGX 3CJPA 4YVXA 3T55A 1Q13A 4UNIA 3W7IA 4DBEA 3KM8A 4JD4A 5CJNA 4GQGA 4GUHA 4EIVA 2ODOA 3BDKA 3LB0A 1W3LA 1LLOA 2ZX9A 4UTIA 4RK8A 4DAFA 1G5AA 4JOMA 1TE1A 3URAA 4C6FA 2YIHA 4LUJA 1WDSA 3W82A 1HO1A 3BG9A 7REQB 1CLXA 3G2GA 1OB0A 1TMHA 2FZ8A 1W9DM 4K36A 1TJRA 1XICA 2QJNA 3M0KA 4BEUA 5K9CA 3EPMA 1WDPA 5EPDA 3TVAA 3VFCA 1X97A 1UUQA 3OVPA 3F2CA 1HTIA 1LCOA 3CZEA 1Q5MA 1XGZA 4OQVA 3WK2A 3VKCA 1BVZA 1Q6GA 2X16A 1E1CA 4S3JA 2HNHA 4IQLA 2HE8A 1AW1A 3W7CA 1FWEC 1H7PA 1XSJA 1G4SA 2BBFA 3WL0A 2CLPA 3WQWA 1KCKA 5BOEA 1DJYA 3QHMA 5CLWA 1BWKA 2WC4A 2ZC8A 2Z28A 3N2CA 4EP8C 1FWAC 3TOYA 2ALRA 4PMYA 3CQ0A 1VR6A 1WA3A 4A4AA 3AXMA 3CK5A 3UFYA 4LBUA 3GDLA 4DAIA 3NQMA 3VU2A 4YVPA 1IWPA 5GQBA 3VIPA 4ZBCA 1YDVA 2VCBA 3PPGA 3N2TA 1LOQA 3TTOA 1BSLA 3WLTA 4CGTA 1GHRA 1V3HA 4KS0A 1M6JA 5EB8A 2VHLA 3NURA 3EWYA 2CHOA 3G5EA 3ERPA 4H04A 5AHIA 5KZ6A 4F0HA 4LAMA 1E40A 1F4AA 1Q4WA 4HSNA 3W37A 1SW0A 5D33A 4BWLC 4B5SA 3TMLA 2H6RA 1G9HA 4D6HA 3H2EA 4EAMA 5HR7A 5DLCA 4EF9A 3EDJA 2HSAA 2D22A 1FUYA 2PRHA 1YHTA 4LXFA 1X96A 4W8LA 4QM1A 3R6IA 5H8PA 3HG5A 4QNWA 4F66A 4JZ5A 5BXPA 1UJPA 4ZVJA 4AW7A 3LK6A 3IEBA 5A6LA 1NEYA 3CO4A 3IGUA 2Y70A 4W7UA 4ZXOA 2FGLA 3PG8A 1B31A 3OZYA 2ZUMA 3HM7A 2IXVA 3RCYA 2PF0A 3H7RA 1RXOB 2WHKA 1E6XM 2FKPA 3BURA 1XCFA 3LUTA 3W1PA 4K8HA 3GHUA 4PTDA 3P2VA 1ADOA 2E3ZA 5LA0A 2WZHA 1E9IA 1PKNA 3LEPA 4MGGA 3WH9A 4EACA 2EKGA 3PANA 3MDUA 1S38A 1FBAA 1XIDA 3I65A 3N14A 3KBNA 3TJIA 2EPMX 1IXPA 2XZ9A 2PDIA 4GINA 1C8QA 2PZNA 1TE6A 1POKA 4L61A 3RJXA 3TC7A 3W3OA 3CEUA 4KKXA 3EX4A 2CLMA 1J2WA 1ZBVA 2HEJA 2HNEA 7TAAA 3UZJA 5SWUA 3GFYA 3N18A 3AICA 3W7OA 4MJMA 2YDSA 2A0NA 3B40A 3BZJA 3Q2DA 1GTHA 2BDQA 3U5UA 4B2DA 2ZUSA 3CYJA 4Y9PA 3U4FA 5LKYA 2ZX7A 1TMLA 3V0SA 3W74A 4D9PA 3IVSA 2NUXA 3XIMA 3TXZA 3EX2A 1JCMP 2VCCA 1MNZA 4F3HA 2QUVA 3CV6A 3E1F1 1E6SM 4IFKB 1CB2A 1NP0A 3U6WA 1RVGA 3GD6A 4PRRA 2E6FA 4LB4A 5AN7A 3P60A 2BMBA 1WUFA 1TIWA 1K7FA 2Z2BA 2VEKA 4N9BA 3W4RA 1QHPA 3AXXA 4DWSB 4UNKA 1M9HA 5BROA 1RUSA 3HFTA 4RJEA 2WCGA 1TV5A 3HV9A 1J9YA 1FKXA 3USBA 1Q7QA 2L5HA 4OBRA 3MWCA 3PULA 3QHNA 2DZAA 2ZTJA 4NSBA 3GXMA 1V4YA 3NQCA 2GVYA 2Y88A 1VCGA 4HPHA 4C5YA 3FS2A 1R3WA 2VUNA 2X09A 3BXWA 5A8NA 3VE7A 3KUMA 4XD4A 4JYDA 1DHPA 5DN1A 2GSEA 1IXNA 1LL4A 4GX9A 4C60A 1J0KA 1VYSX 4DO6A 3JUGA 2NV1A 4IMFA 4GFIA 1S5VA 4AVOA 5K2ZA 2R24A 2OTDA 3KWXA 3TR2A 2PWVA 4AF0B 4LT9A 2HRWA 3ZJKA 3FXGA 3PWIA 3EOSA 4GPNA 3E49A 2HBXA 4OKDA 1QO2A 4H00A 3B04A 1R87A 3SB0A 3WLMA 3T40A 1LL7A 2E77A 1CB7B 3BLFA 3NVDA 2VMFA 4GABA 1Z8AA 1Q6OA 3HV8A 4G5DA 3A5FA 1ZY9A 1ZCOA 1KTNA 2YCEA 3AIRA 4D72A 1PPIA 2WSQA 1Q6LA 3AROA 1PKLA 3K1GA 1B1YA 2ISWA 3A9IA 4IFKA 1EX1A 3H24A 3T78A 1PO9A 3VTRA 2GGJA 1BYBA 1VJZA 4LUTB 3EWCA 3VNLA 3K13A 1QK0A 3QGAC 4FOUA 4ROQA 1KO0A 3LRMA 3LCIA 1RD5A 2VFGA 3AHYA 3SY5A 5ABFB 2Q6ZA 4UZUA 3I7RA 3R7MA 2D2GA 4AISA 1O1HA 3BV4A 2G41A 3VIHA 4GNKB 1LOLA 1V51A 2QDEA 3TQKA 3PTKA 1PCKA 2NV2A 4ZXLA 1W0MA 3SIMA 6ENLA 2BGSA 3M9YA 2G95A 3FX4A 4GA8A 4LCSA 3R94A 3ARYA 4Q7NA 3WH8A 1BF2A 2Q8LA 3S0CA 1VYPX 3TA6A 4BJHA 2YCIX 1EGVA 3IARA 3KXQA 4AHOA 1J0ZA 4H2HA 1LWIA 4X2RA 1CTNA 4HCHA 1IWAA 1FA2A 1RJRA 2DZXA 2REQA 4ZTYA 1V08A 2Y61A 1ZPTA 3QTPA 3NGFA 3K1DA 3WEMA 1Z41A 4O12A 4O53A 5HINA 2E09A 4E0CA 4W9TA 3IVUA 1B2YA 4TU1A 2WLZA 1YNQA 5D38A 2Z1WA 3H6OA 1XLMA 3LCWA 4Q33A 2H9AA 4Y2WA 1LL6A 3BANA 2F9RA 3VIGA 1JZ6A 3NZPA 4AY7A 4F0MA 1ICQA 4AZGA 3CAVA 1UH3A 5I3HA 1WX0A 3VD7A 3EX1A 2POTA 2WMGA 2AQVA 3WQ5A 4AYGA 4FB7A 1VZWA 3QLDA 3R0UA 2PP1A 4NI3A 3W1QA 4J3UA 1MXDA 4O1AA 2UY5A 4DIAA 3U7BA 2O9PA 4NJKA 5A2CA 4U5KA 4C6CA 4P7QA 4B3KA 2BGNE 1XLLA 3IK2A 4GUFA 4WLCA 2VEGA 1A0CA 1UH2A 3PZMA 4HCLA 3MO7A 3WY1A 4ZO8A 1UD5A 1OX5A 2A7PA 5D8ZA 3C8NA 2Z7GA 5G1MA 1O60A 4FIQA 4U2YA 4ZOBA 2OLSA 5AHMA 2FTPA 3QY6A 4IMAA 1ISYA 1RQBA 3GNOA 3N11A 3VZYA 3VE9A 2QJGA 4GNVA 5HMEA 4NASA 1IR2A 3WJZA 5CG0A 2G3FA 5FD0A 3KVJA 2YPIA 2RGMA 1NDWA 4LW7A 1NWSA 3PSWA 5D04C 3W2JA 1KV5A 3MYOA 5DX7A 1DEDA 4DQWA 4IIDA 4N9CA 2X42A 4FP1A 4KWWA 1GKRA 4MDOA 3R1ZA 2JEQA 4HNVA 2D1ZA 1Q7ZA 2WHMA 3SECA 2ZUTA 1GOKA 5K3VA 3WQFA 3SIZA 1EYEA 3ZJ6A 3G3DA 2VD9A 2MANA 1A47A 3Q67A 3TXVA 1TWSA 4V1XA 3VKJA 4K2SA 1EX5A 7TIMA 1ZTVA 3UR2A 1ZB5A 4LU0A 3S5YA 3W7KA 2VFFA 1K8XA 1R86A 3GU1A 3NYDA 1LLWA 1VJSA 1ZJHA 2H3BA 4H6KA 4GQQA 3UNDA 1RLCL 5AYZA 1W1TA 3B0PA 4MG4A 6ALDA 3IJ8A 4GXWA 4KW2A 1ZSXA 2XVKA 1XBXA 3MUIA 4QFUA 3G1YA 3UWUA 3CMGA 5IHSA 1JXKA 4OE7A 3FNDA 1IEIA 4GH1A 4PBGA 3UWQA 1AODA 2PTWA 1F6KA 4RDWA 1TPC1 1WO2A 1PZ3A 3PTDA 2WSYA 3R2GA 1VC4A 4D6IA 3TYBA 4I5XA 2XINA 5HMFA 4O19A 4ZENA 4US5D 4JIEA 4U33A 4RNJA 3KLLA 4GBDA 3GFZA 2Z2UA 2GOKA 2NX9A 3N73A 3IUHA 1S46A 1VIWA 1F74A 4H19A 4DJDC 4TUFA 2BASA 1BTMA 2WNWA 3W7PA 3W7RA 3AS1A 5AC6A 3ARWA 3RF9A 4KPLA 3TOPA 3AHVA 4PTXA 3AZRA 3JR2A 4AZHA 1EJWC 2J7BA 2VEIA 1ZHAA 4DUXA 3LTYA 4KRUA 3CC1A 2OT1A 4GISA 1H11A 3ARPA 5A2BA 4UTLA 2V3DA 4H3DA 4GHRA 3RO8A 1L2UA 3WLRA 2QPSA 4IUGA 1YIXA 5G2WA 2QJIA 2Z7KA 4LAOA 3OA5A 3MW7A 2PPGA 3THAA 3LPPA 3NL2A 3I6TA 3WLSA 2VENA 1PX4A 1X8FA 3B03A 3BAYA 2YBTA 1HKWA 3LYEA 3QKEA