4FA3A

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with (r)-1-(naphthalen-2-ylsulfonyl)piperidine-3-carboxylic acid (86)
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
317
structure length
305
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aldo-keto reductase family 1 member C3
publication title 3-(3,4-Dihydroisoquinolin-2(1H)-ylsulfonyl)benzoic acids; a New Class of Highly Potent and Selective Inhibitors of the Type 5 17-beta-hydroxysteroid Dehydrogenase AKR1C3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 114
structure length 305
sequence length 317
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4fa3A00
2PDPA 3RX2A 3ONCA 4MHBA 4JIHA 1PWMA 4JTAA 1YE6A 3RX3A 4YS1A 2PDMA 3R8GA 3UZZA 1QRQA 3WG6A 1ZSXA 2PDJA 3V0TA 4OTKA 3G1RA 2HVNA 4ZFCA 1Z3NA 2BGQA 1A80A 1J96A 4JIIX 3GUGA 2PDXA 4WDXA 3BUVA 4AUBA 3BV7A 2I17A 5C7HA 5LIUX 4XVEA 4XO7A 3N6QA 5LIYX 2ACUA 1IHIA 2HE5A 3H7RA 3Q67A 2PDWA 4PUUA 2PDCA 3UG8A 2ALRA 4QR6A 4XK2A 3EB3A 4H8NA 3V35A 4WDUA 1R38A 3GHUA 3CMFA 4DBUA 2IQDA 2P5NA 3CV6A 2CLPA 4XZHA 4DBSA 1PZ1A 3ONBA 1S2AA 3UWEA 3Q65A 1S1PA 4EXBA 1SM9A 2DUZA 4PRTA 2FZ8A 3R7MA 4XO6A 2NVDA 1C9WA 4WRHA 4XAPA 2PF8A 1JEZA 2ISFA 2F2KA 4GIEA 4DBWA 3FX4A 1OG6A 4XZIA 4HBKA 1GVEA 2FZDA 4XVDA 3D3FA 1XJBA 4DZ5A 1XF0A 5HA7A 3LENA 2PDHA 1Q13A 3LD5A 2FZBA 4JIRA 2FVLA 3WBXA 2PDUA 2IKJA 3KRBA 1AZ2A 1IEIA 4XZLX 4FALA 4RPQA 1QWKA 2FZ9A 3WCZA 4FAMA 4QBXA 3EB4A 1HQTA 4WEVX 3COTA 1MI3A 4GABA 2I16A 1UR3M 2IPJA 4GACA 4WDWA 1HW6A 1AFSA 1EF3A 2PFHA 4YU1A 4WGHA 4LAZA 4LAUA 4YVVA 2HDJA 1Z9AA 4JQ4A 3CAVA 4GQGA 3LEPA 4PR4A 1AH4A 1ZGDA 3C3UA 4Q7BA 2IPGA 3G5EA 4IJCA 2WZMA 4L1XA 3UZWA 2NVCA 3LNMA 3RX4A 2PDQA 1XGDA 2IPWA 3GHTA 1X97A 4H7CA 2R24A 2IPFA 3F7JA 5JH1A 4WDTA 3V36A 2IQ0A 3QKZA 5M2FX 3N2TA 3CASA 3WBWA 3S3GA 1AZ1A 3M4HA 5LIKX 2A79A 3LZ5A 4JQ3A 3BCJA 1T40A 4LB4A 3T42A 3B3DA 4FZIA 2PDLA 1T41A 2HE8A 1EKOA 1LQAA 3LQGA 2F38A 2WZTA 2PDYA 3GHSA 4R9OA 4QXIA 3UP8A 2HVOA 3MB9A 3VXGA 2PZNA 4YVXA 3DOPA 1K8CA 4JTDA 4PMJA 3R8HA 4JQAA 2IS7A 4F40A 5HNUA 2IKIA 4I5XA 1M9HA 4JTRA 1LWIA 4JQ1A 2DV0A 2PDBA 2HV5A 3R43A 2DUXA 2ACSA 1FRBA 5AZ1A 4LBRA 1PWLA 1US0A 3LZ3A 1YE4A 3DN5A 1ZQ5A 3H7UA 4ICCX 4NKCA 1RALA 3LBOA 4JTCA 2PD5A 4FA3A 4QX4A 2ACQA 3LN3A 3O0KA 4GCAA 2INEA 1PYFA 1RY0A 1PZ0A 1AH3A 1VP5A 2ACRA 2QXWA 4IJRA 3R58A 3M64A 4JQ2A 1EXBA 1MZRA 4LBSA 2C91A 2INZA 4EXAA 1S2CA 2PDFA 1X96A 1EL3A 2IKGA 1AH0A 2PDGA 3LQLA 2PEVA 3WBYA 5DANA 5AZ0A 3UGRA 3V0SA 1Q5MA 2IKHA 3R94A 5HNTA 5KETA 1MRQA 5LIXX 2BP1A 4GA8A 3ERPA 2J8TA 2FGBA 5JH2A 4YVPA 1Z89A 3UFYA 3R6IA 3FJNA 2PD9A 4Q3MA 1VBJA 1ZUAX 4HMNA 2PDNA 1YNPA 2BGSA 3CV7A 4XZMX 3UZYA 3P2VA 4ASTA 4LB3A 3H4GA 3BURA 2PDKA 1YNQA 4L1WA 4JTQA 4XZNX 4PUWA 3U2CA 3LUTA 2VDGA 5LIWX 1S1RA 3NTYA 3UYIA 1Z8AA 3UZXA 3GHRA 3O3RA 3M0IA 4IGSA 1RY8A 4PRRA 2AGTA 4GQ0A 2PDIA 1X98A 4G5DA 2HEJA 3MC5A 2R9RA 3CAQA 3EAUA 1ADSA 3V0UA
chains in the Genus database with same CATH superfamily
1ONXA 4LUTA 1H5VA 1WO2A 1PUDA 5FL1A 2AAAA 1UD6A 1GG1A 3NQBA 2NZLA 4LY4A 4RXFA 4JGDA 4B15A 4O16A 1W1A1 3ARWA 2A3CA 3UZZA 1DJQA 2CBVA 4XB3A 5LHFA 3TE9A 1YADA 2OO0A 3GIQA 2FH6A 2X41A 5ABFB 4GBDA 1AJZA 6ENLA 2PURA 2EO7A 4QG8A 4AD3A 2CKSA 2WPBA 2G3NA 5G4EA 4F2UA 3PULA 4JIIX 2ZRVA 4S3EA 4ES4A 4AUBA 1V3IA 3OZOA 3NQDA 1VZWA 3PTQA 2VL4A 3VZYA 3C8FA 1M6JA 4MZYA 4DWDA 5I00A 3JS3A 4DI9A 3DHFA 3P6LA 4NNCA 1B57A 3GX9A 3M47A 5AFDA 1HVQA 1GOMA 2WYSA 3NCOA 4HK7A 1KTCA 3QV7A 4EVZA 2VOMA 3GWQA 2VYOA 3DFNA 1JDDA 4QNWA 4L80A 4XUGA 1NQ6A 1XIGA 4K36A 4KGJA 4ZZ9A 2OKOA 4P7QA 1TMHA 1IT7A 3WNLA 4A4AA 1B3YA 4GUIA 3MHGA 2E5DA 1NEYA 2ZX9A 4RNFA 4YWSA 5G1MA 5FD0A 2VEFA 1DV7A 2MNRA 3WDPP 5FESA 4X61A 4AEEA 3C0QA 2XGIA 5DBTA 3ABRA 3VOJA 3ITXA 2OQYA 1XF0A 4JIQA 2W9MA 1GHSA 3ARUA 4HP5A 1K6AA 4H1ZA 1BYCA 1WZKA 3GNRA 1VFMA 1WUFA 4L5ZA 1O12A 4Z1BA 3W0KA 2B7NA 2ZE3A 2A3AA 2PTWA 2G3JA 4QE4A 2PAJA 4ZXLA 4Q6JA 2ZQ0A 3WK0A 3VINA 7ENLA 2BOGX 1GQIA 2G5WA 1RQHA 4JX6A 4GNKB 3WJSA 3L5AA 1F8IA 3LCGA 4LUJA 1XPYA 1UR3M 1DXEA 2XM2A 1FOBA 4XZWA 1QXLA 3T05A 1RSCA 3FK4A 3WJWA 3M44A 3ARXA 1KC7A 1RZMA 5HJYA 2YGYA 1LG2A 4JEQA 4E2OA 1SO5A 3CAVA 2FHFA 1BFNA 4Q7BA 3EPOA 4PFMA 4Q33A 1IR2A 3NO1A 4JFUA 3L7RA 5DELA 2BOEX 2DUAA 3CV2A 2HK1A 3G22A 3BMVA 4WJ8A 1NJJA 4HGXA 1TPB1 5HINA 1VYPX 2HJPA 3I4KA 3CH9A 4LVGA 2NLYA 4OVXA 3T55A 5EMKA 3VM5A 4C7FA 4PCPA 5ABEA 2VZVA 2GK1B 4BKNA 1JUKA 1LF1A 1UC4A 1E4IA 2HE8A 4JS3A 2F9RA 3LG3A 3WKZA 4PEEA 3LQGA 3V3WA 5HATA 2HVOA 1L2UA 2E0PA 2REQB 1B4KA 3TMQA 2JFEX 3EPMA 1WKFA 4HNNA 3L4YA 2QUMA 3VVGA 4KIRA 1IXOA 5HNUA 4GJJA 4C6MA 3W9ZA 3W2UA 3KRSA 3BLKA 3PANA 5EMMA 4O8RA 4QDPA 1SYTA 2VX4A 1BXCA 2FIQA 3HF3A 4F3HA 2P53A 3AWNA 4UQ9A 1KM4A 2QULA 3CJPA 3OLDA 3DG7A 4JHZA 2ZICA 3WUGA 3GDBA 4D6GA 2NT1A 3UF9A 3NZPA 3TNBA 1OFBA 3LB0A 1R9XA 1AUSL 4E38A 3N2MA 4NKCA 1R3WA 5KZEA 1VHNA 2HK0A 1FVPA 1F61A 3LBOA 5IM51 3UXAA 3L0KA 4CD6A 3VMPA 3WLMA 4LH8A 1PZ0A 3KP1A 2J7BA 2QXWA 4IJRA 2HPIA 4DUXA 1MXSA 1TVPA 4QEEA 2IQTA 3TQ0A 3LCFA 3W38A 5EYWA 3V0SA 2NW0A 2FTPA 3APGA 3PTMA 4C6JA 1WOAA 1NM9A 4PMOA 2AQOA 2VMFA 5EMUA 1RVGA 4HKPA 3G18A 3O63A 3GU1A 4PSPA 4FI4A 3M0XA 4P7LA 4RKAA 4E2BA 1TJ1A 4ACZB 1W8GA 1YNPA 1ONRA 2VENA 4PCTA 5DFAA 3M0YA 3ZJ6A 5CBJA 1DQXA 4JICA 3MU7A 1OCJA 1ZBWA 5SWUA 4ZQMA 5CGTA 4ASTA 2XH4A 3KVMA 2C1IA 2PDKA 2DVXA 4PMVA 4IMGA 1ZS2A 1OX4B 3G8RA 3W1QA 4YMZA 3VIMA 1EGVA 4IQLA 1YKWA 3E2RA 2NX3A 3BGGA 2PI6A 3NR0A 3ZQ9A 3PS7A 3UYIA 3NL3A 3A3WA 1S2TA 1QI4A 1FKWA 1E1CA 2EPLX 1TB3A 3S9IA 4QLKA 3TEVA 4CNSA 1DXFA 4HJFA 2JBMA 3A4JA 3MPGA 3ES8A 3NPUA 3BAKA 1ISZA 1DJIA 3I6RA 5FCZA 4LSBA 4H2CA 3UNTA 4OOZA 4ZTXA 1PWMA 4E8CA 5JBDA 3VCRA 4A8NA 1KXTA 3CTLA 4O17A 1VBGA 3SN4A 2OXNA 3AHVA 3S5NA 4JX4A 4Q8VA 1GTEA 4J3VA 1BWVA 3T6CA 2HVNA 2ATMA 1CGYA 4JIEA 3VU2A 1OZQA 3GAYA 1Z3NA 4WHBA 4CN6A 1QBAA 1FKXA 1OABA 1SO3A 2BGQA 2AKZA 3BL3A 4CD4A 3VGEA 3ZIZA 3PHAA 1CPUA 2OYKA 2G4JA 3PPCA 1BXBA 2E5BA 3IK4A 2J6VA 1K7FA 1WDPA 1O5RA 1MXDA 1XLHA 3BK0A 2VM8A 2D2OA 2Y0FA 1J0IA 5FIPA 2QJMA 1GG0A 2XIJA 4AZ7A 4M29A 3HMCA 4PE8A 2J24A 5TQLA 1Z42A 4UTTC 1KBLA 3UG8A 3GKFA 1HGWA 1O66A 1F3TA 4CEUC 1FCVA 4HK5A 1SFTA 2P76A 3GR8A 4HK6A 4O1CA 4J28A 4G1NA 4V1YA 1BF6A 4H9XA 5L6UA 1K1DA 3BG3A 1J6OA 3KHDA 4C65A 4K39A 1CWYA 1A5BA 2F84A 1R3SA 4D1IA 4E3VA 1E6QM 1Q6FA 3G1HA 1SM9A 2J6XA 1GONA 4OECA 4XO6A 1C9WA 3UWZA 2PU0A 1KV8A 2F2KA 5CBBA 1ADDA 3FYYA 2NUWA 1X1OA 3CZGA 3AYVA 4UFKA 3BARA 2C71A 4ZB0A 4HA3A 4TVCA 3CUFA 2ZVIA 1U5HA 3SSZA 5F7UA 4A2SA 4B5NA 4F0KA 5E5CA 4ERGA 1XIDA 3EDFA 1XLAA 3HO8A 5C9WA 4ALDA 3HU7A 1AZ2A 1IEIA 1KTNA 2Z1BA 4ORMA 4S2CA 2ZX6A 2UBPC 1EOMA 2QJGA 2VCCA 1QCWA 2EGZA 4I3GA 1QNVA 3I10A 5H8PA 1TTJA 4BWLC 1EX5A 2Q3OA 2TAAA 3VDAA 3QTGA 1J8VA 4QG9A 5K9DA 4U2YA 4TTUA 1PX4A 3WH7A 5MF5A 4OUEA 2BOFX 2YXXA 3KBNA 3S1GA 4O0ZA 5CAKA 3ZR4A 1FXPA 5D9PA 3WFLA 3OYXA 5BOFA 3C2EA 3GHTA 1H1ZA 1WDWA 4I6KA 4OWGA 1BAGA 4IGHA 1H0IA 3KWXA 1B0IA 4PCNA 3WO8A 4HU3A 4HT3A 1TTPA 2QUNA 3NQGA 3DC0A 4IFKB 3OQEA 1MDRA 3BCJA 1KCKA 3CU2A 4L9XA 4LB4A 5BXSA 4GI9A 2JE8A 1PCWA 5DXXA 1T41A 4UFHA 1B3OA 4RXGA 1J9YA 3BXWA 3TZFA 2PTZA 4R9OA 1I45A 3P60A 3PWIA 2W67A 3GZ3A 4Q4PA 1QO5A 4LPCA 2GDVA 1ZCOA 1U5VA 4JTFA 3UJSA 1WAUA 1SPQA 5C9ZA 2PBOA 5F2IA 3QM3A 4I5XA 1XD0A 3PZTA 3M0LA 4JTRA 2DSUA 2X1UA 1LWIA 4NI3A 1W91A 3AI0A 3VCCA 2W63A 4DUWA 1M7OA 1M68A 5AECA 4Z0JA 1PWLA 1LZOA 4MDPA 3IIOA 4GFIA 1PZ3A 5DX7A 4N4PA 1RUSA 1PBGA 3NJ3A 2OT0A 1NIUA 1IR1A 4GYPA 4WQ6A 9RUBA 1XLDA 3KOWA 3QPYA 1CB2A 4H7ZA 4UNKA 4C7DA 1W31A 1KFEA 4UR9A 1IEXA 5EPDA 3RR1A 5GNXA 1J2WA 2CEQA 2OEMA 2FZMA 1JUEA 2WNWA 4UTJA 4Y7EA 3WNMA 1IQ8A 1EDGA 2Y85A 3RN6A 3C52A 3DI1A 2PDGA 4MGGA 1GOIA 3MMWA 3UWUA 2XIOA 3REQA 3MCOA 4GG9A 3TQKA 1PKMA 2XFYA 1GUVA 2VR5A 3NVTA 1JGMA 3AIEA 3QGAC 3EMCA 1F3XA 3N2XA 1UWQA 5HQEA 5H1WA 2DZWA 2V3EA 1RPKA 3BG5A 4BI6A 2VTFA 1NARA 1EFZA 7TIMA 3GTIA 3GKAA 2FJKA 3U7VA 4FIQA 2GK1A 4JDYA 3W7IA 1OVDA 3CHEA 1UWUA 3TN3A 3OLGA 1R87A 1E6ZA 3USZA 4OBRA 3BURA 4RUBA 1FHLA 1W5MA 2QVHA 2X2YA 4BEQA 4DLMA 2QCGA 5IXEA 3HQ1A 3R8RA 4ACYA 1ZNNA 4DBEA 1K03A 4MY9A 1DIKA 4Q8TA 4LYKA 1SFJA 4XTDA 2JIEA 2GSHA 2XGZA 4PRRA 2VUNA 5I23A 1XLGA 3MC5A 3VTRA 1ONEA 3N13A 1VS1A 3MUIA 1XLBA 4NJKA 4L65A 4QGCA 3VMOA 3L0NA 4IMCA 3QV6A 2PLKA 3D6NA 3ZOAA 1XIIA 4N02A 4HA4A 4IH3A 1P7TA 3R8GA 4W84A 5KSWA 3RF9A 1BSIA 2V5KA 3R10A 4QDWA 3T2QA 4AZIA 4GI4A 1ZSXA 3DIPA 1F4AA 1IGSA 4JTEA 3P8IA 4A8LA 4KS0A 1E0UA 4X22A 1V6WA 2VCBA 5BU6A 3NL2A 2OOGA 4JD4A 3RO6A 1EIBA 1J96A 5HPOA 1HO4A 2PDXA 2X1RA 2CBIA 4O1AA 3URQA 1VFHA 4XV0A 3BV7A 3QYQA 3NPWA 1D8CA 5HUOA 2WSYA 4UTFA 1Q3NA 3EOOA 3GU2A 1IHIA 3TYDA 4R9XA 2HE5A 2VGFA 2VRQA 3UCCA 1G69A 1K8ZA 4ACZA 4PL2A 2BVWA 1WYIA 2RDUA 4H8NA 2W92A 2CWNA 3NZGA 1F9CA 5DY2A 5C2XA 4IX0A 1E0VA 3EWBX 1U1HA 1W1ZA 3TJXA 3RLGA 2V63A 1YXDA 4PZVA 3VAVA 3FS2A 4R53A 1R8LA 4AY7A 3WQ5A 2X42A 3WQEA 4MWAC 1E55A 3TXVA 1GOOA 5HJLA 1DWAM 3QQ0A 3LGDA 2NUYA 4S3CA 1US3A 1VFTA 2YX0A 4HHLA 5FF4A 3TAOA 4KPLA 1SO4A 4LAKA 1Q8AA 3QHNA 4DBWA 4CCDA 2HTMA 1FWWA 1XCXA 4GJIA 1EYEA 4DZ5A 2WQDA 2PDHA 3MKVA 1XQLA 4IGNA 2CERA 4DYEA 2V9DA 3NQVA 3GTFA 1JF5A 3C61A 2CKRA 2FVLA 2YXGA 4DO5A 9XIMA 3GO2A 2QCDB 1V3MA 3WBXA 2PDUA 1ALDA 2CHOA 1UW9A 3ARYA 4RPQA 1RV8A 2FZ9A 4KFPA 4FAMA 6REQB 4QBXA 5MKGB 3TTEA 1JAEA 1TX0A 2VRJA 4O1DA 3NZQA 3PBGA 4RZ6A 3WDQA 4O53A 2FJUB 3OW1A 4Z2HA 1XSKA 4H6KA 2ZADA 3WQFA 2HDJA 3LERA 1E1EA 4F9DA 1VFUA 4PR4A 3QZAA 3QTPA 4TU1A 4H9TA 1O95A 1KFJA 3UZWA 2NVCA 3RX4A 2W6RA 2EG7A 1A5NC 4H7CA 2EEXA 1O4UA 3FYPA 1NTHA 1TRIA 2VEMA 1JD9A 1JQVA 2P10A 2IQ0A 1M1BA 1K9FA 1PIFA 3G0SA 5BNKA 1Q6OA 1FWRA 4D6IA 3JR2A 3TYCA 1HG3A 2HRWA 5FKYA 3QPZA 2FGZA 1ZBKA 4U28A 1G0CA 3FKKA 3SFKA 1EKOA 1Q8JA 3TW9A 1GWJA 2QMJA 3DU0A 4DI8A 2PZNA 3W84A 5I24A 1UWTA 1EEPA 3B8TA 4A3QA 3OA5A 3QY6A 3K8LA 5JBEA 4NJJA 3R8HA 3DEQA 3KBMA 2XN0A 2Z7KA 2ABAA 2EG8A 3QHMA 4WLCA 4ADUA 4U3AA 2WSQA 3GD6A 4LVFA 1UUQA 2XVKA 1X6UA 4BA0A 4V1XA 2J7GA 2ACSA 4GWEA 4B92A 3NEVA 5DLCA 3M5VA 1YPFA 4MADA 1A5OC 3QYSA 4I9AA 4ONVA 4XTIA 2WJEA 4IIEA 2Q8ZA 3DN5A 1MDLA 3TJIA 2O4MA 1T99A 2DQWA 1O5XA 5AHMA 3WN6A 1DWHM 2D2GA 2PD5A 4QX4A 4BQ3A 2GPTA 1GCYA 4ZL1A 1FDZA 4Z2IA 2FHCA 3PUOA 4DAIA 1W1TA 3QLLA 4E2DA 4MNKA 3W2MA 2G37A 2WCSA 3MCNA 3C2YA 3GDLA 3WBEA 1VFLA 1W5NA 4RZ5A 2J74A 1S2CA 2YYTA 4KCVA 1JZ2A 1QI3A 4L9ZA 2WHJA 3SADA 1KRCC 3XISA 5KMYA 2ZC8A 1P5BA 3OVRA 1Q5MA 2YB1A 2D0GA 4D9PA 2VDHA 3S1UA 1ITXA 4ZQCA 3O7UA 3GTHA 2OSXA 4Q6XA 4F4RA 2CCRA 3DGBA 4ZQRA 3C0LA 1FHVA 5T8GA 3DENA 1S38A 3WLLA 1M53A 4QFUA 3H23A 7REQA 4K68A 2HCVA 4IXXA 2O55A 4CN1A 3U5YA 2JGYA 1OFRA 4A22A 3EXTA 1CB7B 3WJXA 3USBA 3MJYA 1EGMA 3R4IA 5BROA 3TU9A 5CGMA 1VFFA 4H3DA 1C91A 2DH3A 1W37A 1ZPTA 1FWNA 4MJ2A 4L1WA 1J5SA 4NJIA 3ZM8A 3URBA 1V7AA 5D33A 3A5VA 2DY3A 2DIEA 5HMDA 4AZCA 2YCIX 1R0MA 3O6AA 2PF0A 2WMIA 1UCWA 1BF2A 1OYAA 4DJDD 4ZSUA 2C1HA 3OZPA 3WK2A 2A0NA 3AYTA 3LTPA 4IIDA 3MHUA 3T7VA 2W66A 3MUY1 4WSHA 3EAUA 1NAL1 2ZX5A 1GGOA 3LLXA 2P0IA 2VGGA 4W93A 4H2HA 1PSCA 3LHYA 1EXPA 3A22A 4IISA 1MW0A 1PKNA 4FOUA 1DJGA 4LS2A 3OVPA 2D1ZA 3W1MA 4F9JA 4J3XA 1MW3A 1NOUA 3HFYA 4K37A 1ELSA 2OMAA 4AHOA 4BK9A 2QLYA 1KKRA 3MCMA 3HPAA 1GQKA 2BV9A 1HKIA 3OGSA 4EK7A 2H3DA 1XC4A 3MBDA 4Z2LA 1LQ0A 1TREA 3RRXA 1H0GA 3AMCA 2TMDA 3QR1A 1XPGA 3WMCA 5C7HA 3RXZA 3N4EA 1AL8A 4XVEA 4XO7A 5AN7A 3STFA 2DZBA 3N6HA 1M03A 1Q65A 1G4TA 4Q8UA 2X40A 4J3UA 3WLNA 2QPSA 1KCZA 4WKFA 1H49A 3P82A 5A2CA 3WLKX 3TTOA 1V6YA 3IIVA 4HOWA 2XVNA 1WXJA 3VX1A 5AC7A 1FBAA 3EB3A 4DPQA 3VIGA 1Q2SA 3MTWA 3CMFA 3QZEA 2Z1KA 4Z2JA 2RDTA 3CL8A 1J0HA 3E12A 1TV5A 3GC4A 1PHWA 1ZJAA 1UA7A 1L6SA 4ZQOA 1W54A 4J3WA 5DCBA 4C90A 1OX6A 3PJUA 3VI2A 3H2AA 3W26A 3ONBA 5E6ZA 3J7HA 5FJPA 4X2PA 3U7BA 5EB8A 5TNVA 2OVLA 2FZ8A 4TVDA 1TVNA 2ISFA 4G9PA 1C7TA 4I9MA 3URNA 3WSUA 1NWRA 5K4ZA 5DXYA 1TE1A 1YRRA 3UG4A 3LXBA 5FA5A 4IPJA 1TRDA 1FFRA 4HPGA 1AODA 1ZAJA 3KL5A 1UZ1A 4BY3A 2UWFA 1WZAA 1EJRC 3O2LA 1FX6A 1TPFA 1T5AA 2WZHA 1UMLA 3R89A 4WEVX 1JPIA 1SQ7A 3AMGA 1GVQA 1DBTA 2WOQA 3PTDA 2Y70A 2I16A 2R91A 1JNEA 4Y6GA 4GACA 1W5PA 3ARVA 2XIBA 1J01A 1B3VA 4HOXA 4Q22A 3O9NA 4DBDA 3C2RA 5BRBA 5EBAA 5LNVA 1ZGDA 4O4VA 1SSDA 3WELA 2ZC1A 2YBUA 1LWHA 1XKJA 4B2DD 1QVBA 2J77A 4C1NA 2Y8KA 4LCSA 1QTWA 4LF2A 3LDVA 3GNOA 2ZTKA 2A5HA 1CXLA 3U2OA 3WZ0E 4WDTA 1MUMA 1Z6KA 1CDGA 4HYRA 2R1NA 2XPKA 2Y7FA 3QV9A 3APYA 4UFIA 3GXDA 3NQ2A 4LS0A 2VX6A 1F5ZA 2Z1SA 3VZXA 2WJZA 5M3WA 4ATDA 3W02A 3PZMA 4J1OA 5AYBA 4QE1A 4WY0A 2OZTA 2WZTA 2PDYA 1R9ZA 3GC5A 3GHSA 2FDMA 5I6SA 3EX1A 1FWSA 4ZBCA 2E1WA 4UTIA 4KF1A 3JW7A 4R88A 1E6SM 4PB3A 4KWSA 1L9WA 2D2HA 1FWEC 4HNOA 2B31A 3HG5A 3QW3A 4KCTA 1W3TA 2FVMA 3B4YA 1V6TA 3P93A 2YDSA 2Y4SA 4XQ6A 1H51A 2PC4A 1D3HA 4FLOA 1WB0A 4AB4A 2PDBA 2J79A 3CXOA 4PMYA 3EX6A 2DUXA 3E96A 3KZSA 3W74A 4ZOCA 1V6VA 4PUEA 2QT3A 3VIHA 2NX9A 3RRAA 1NWTA 3S2NA 4MVAA 2AOSA 1ZP3A 5I3IA 5CPLA 2IMRA 3BAXA 1OSEA 4NX0A 2DORA 1HKVA 4F48A 4RE0A 4JTCA 1GJPA 4JX5A 4Y9PA 1GVSA 5MKGA 3BW3A 4J3TA 2J27A 1PYFA 4CNOA 1I60A 1SR0A 2H3BA 4ZE4A 1IIGA 1AG1O 1DORA 2JIWA 3CPRA 4KCWA 3H21A 5A6SA 1MZRA 4GYPC 2D20A 1W1B1 3TN4A 4PMQA 3LMZA 2J4GA 4QNEA 3UR7A 1X96A 5A1AA 4HYWA 3N4FA 3WQCA 4PA8A 4Z17A 2Y2WA 1V0NA 4D6JA 5D38A 1NDVA 4IG2B 1TPEA 2DZXA 1L2QA 4UZSA 1B3XA 2INFA 3WLJA 1YBQB 1RLDA 4NQ1A 3RU8X 3T09A 5CZ0A 2PDNA 2QGYA 2FMNA 3FVMA 2HQAA 4LT9A 4EPBC 3NSXA 3FKRA 4LUSA 1ZJBA 3GVRA 4QAIA 1PL9A 1QU4A 2F6XA 2AKMA 3S83A 3EMZA 3PF3A 4M6VA 3SCPA 3VK5A 1RD5A 3NSNA 3WL0A 3NG3A 4FNUA 2GGHA 3R0UA 4NVTA 3MP3A 3A23A 3EX2A 3GH7A 3H6OA 4DO6A 3GSMA 2P3EA 3GNDA 3UA4A 2WNQA 3PK7A 3WK1A 1YTEA 5G5IA 1WE5A 4HNCA 1X98A 1MNSA 3ES7A 4XISA 1ADSA 3G24A 3DFTA 3C5QA 3V1HA 4F79A 3PUDA 1GOXA 1JL8A 2PDPA 4Q4SA 5HMFA 4MHBA 1E1FA 1PIGA 1A5SA 4JIHA 4GXWA 3HGSA 3GQYA 1H50A 4LAMA 1JXKA 4MJMA 4XKYB 3S47A 1E72M 4I6VA 3CQIA 3H2MA 4W87A 4D8ZA 2PU1A 4MAZA 3VD7A 2C0AA 1QMLA 3IK2A 2E77A 3W81A 2E1DA 1GK8A 4YTSA 2P50A 2RFGA 2EBNA 4TUFA 3WLQA 5IBXC 4FOKA 4F0RA 1UZDA 2CZFA 3B40A 2EPHA 3CUIA 4QTGA 3T8QA 2A3BA 2HROA 1LWJA 1E6NA 3T4WA 5FL0A 3H53A 1XGEA 1H3GA 3LHZA 1TQXA 5D37A 2VWSA 4NAEB 4PUKA 4Q7IA 3NGFA 2OZ0A 1ENUA 1UWAA 3LRMA 3Q67A 3UEQA 1QFEA 1ODZA 2PB1A 4PTXA 3IVUA 3V5CA 1UKQA 4DO7A 3UD6A 1UOZA 3PFMA 1YDNA 3WUFA 4O1BA 1X1NA 2YR1A 3T0AA 4UTLA 3N04A 3U4AA 4HTBA 1PZ1A 1S2AA 1WPCA 1VLIA 1I1WA 2VD8A 2YJQA 4RDYA 3W7CA 4M1RA 3WQ8A 5XIMA 1AW2A 4INFA 5EBUA 4LV4A 4M7SA 1L0PA 3CZKA 4QS6A 4XZIA 4J3SA 2CLLA 4XVDA 1XL9A 3GNPA 1XJBA 2P0OA 1RAKA 2V3GA 5HA7A 5I06A 1XINA 3E2VA 4QS5A 3AIQA 1H5YA 1BRLA 1Q6GA 4TVUA 4KT2A 2NWRA 2GZXA 4DELA 4LF1A 1UPPA 3FDKA 1PX3A 2IKJA 2H9AA 1G94A 3WF4A 1FP8A 2IXVA 3QBUA 2F61A 4PB4A 3HMJG 2RGLA 3PR2A 4FALA 2MANA 3NFUA 3CUHA 3N29A 4K38A 4D1JA 4KEMA 5K2ZA 4B4FA 3G1FA 1S3TC 5A6BA 3KBWA 1MEWA 3K4WA 4NRSA 4WDWA 4IWWA 4LC8A 4Q8PA 3QMSA 1QOQA 4YU1A 4OIFA 4HA0A 4IPLA 3RNDA 1VFOA 5DCEA 4F2BA 1GOKA 4Y9OA 5RUBA 5FJJA 3WMBA 3DFYA 5A8PA 3AZSA 5DMLA 2AAMA 2OODA 4B5TA 3QXBA 5GJMA 2B7QA 3HGRA 5LNSA 1B90A 1I75A 5IDIA 1E5NA 1U1JA 3MUZ1 4M8UA 5CCZA 3E2QA 3C56A 2Q3RA 3ARPA 3ID7A 3LU2A 1B2YA 1XIBA 2I9UA 3V18A 1HL2A 4IPIA 4MY8A 2E25A 2GWNA 1SJBA 3VOIA 2PLJA 3K1DA 4DJEA 4P5UA 3LNPA 1XUZA 1LG1A 1T40A 2ISVA 5CC7A 4GD0A 4K3ZA 3W00A 1Q7ZA 5GNZA 4I90A 3MVIA 2QR6A 5BMXA 4LQ1A 4HSHA 3BOFA 4N9DA 3ANYA 1O7AA 3DECA 4RE2A 2CLFA 3I6TA 1K8CA 3TYAA 5C71A 1E0TA 1DOSA 1LL7A 1R3YA 1AK5A 4NY2A 3T0TA 3IJ9A 2AMGA 2V2DA 1M9HA 5LZLA 1DJXA 2D24A 3PPHA 3RYSA 1FCUA 4US5D 2YXOA 4HYVA 2OEJA 3MW7A 4MLJA 1ICQA 3GXFA 2PRMA 1SR9A 4LGXA 5D09A 3L21A 1DJYA 3CB3A 3MMDA 3B0XA 3BC9A 1J0YA 4N9EA 4KCUA 4UTMA 2Z24A 3BZJA 2VQTA 2TSYA 3LBCA 3GK0A 1DQWA 3UW6A 3KDOA 1QPRA 1EIXA 5LNWA 4J9JA 2B81A 7ODCA 1EBHA 1B3WA 2XVPA 3TOYA 4E4FA 1NF7A 3LCLA 3FN9A 2WVVB 2POZA 3CWOX 5CGQA 3T0BA 2VC5A 1DIOA 4MWAD 1GORA 2PEVA 3UGRA 4D6HA 3MZ2A 2FPTA 1LRNA 4HB7A 2I5IA 1W9BM 3SCQA 1TUFA 3BWWA 3AC0A 3LCXA 2CZDA 3KVLA 3I3DA 3DI0A 1YW1A 5FSEC 1ZJHA 3D3AA 3PSWA 3SRKA 4GY0A 1UUMA 1OX5A 3ITTA 4CCEA 4NIRA 2BNJA 3SQLA 4L6DA 3RK8A 1A5LC 3SJNA 3SCWA 4P7OA 5F1UA 4IQEA 2PD9A 2PC8A 3DC8A 3PZIA 5DEZA 4ZOBA 3IIXA 4KWVA 3UZYA 4GZIA 1V03A 1JPDX 3AIWA 2FZNA 2YLAA 1MMFA 1S5TA 1UYQA 4JTQA 2QJHA 2WB5A 3O0FA 1QT1A 2C19A 4ECLA 3BLIA 1H61A 3O6DA 3S0CA 1CLKA 3GXMA 3QMTA 3FOKA 5CG7A 1GJWA 3FDGA 2ISWA 4FIRA 1IIHA 4O4WA 1EZ2A 4X0VA 1PO9A 4QSFA 1AJ2A 3FGCB 1E73M 1GPWA 3VIJA 4Q4QA 3PWAA 2GWGA 1W56A 4Z2KA 1AQMA 4DX3A 1WA3A 2Q8LA 3ZMRA 3BAYA 1B9ZA 2ZUVA 2XHYA 1R46A 3ABQA 1V3KA 3T07A 1ZHAA 4NAFB 3LYEA 2PP3A 1CX9A 3K46A 3OGVA 4JTAA 1R3RA 3W7PA 4QROA 4Y8FA 4Q7NA 4DJDA 3ENLA 1BGAA 5BXPA 1F4HA 2DSKA 4YL2A 2WAGA 4E3TA 1W9XA 2QGHA 3BV4A 1H7OA 4HD5A 4N0RA 2ZUSA 1HKWA 3DHDA 2RKXA 1CXHA 2E09A 2CETA 1Q2RA 1KRAC 2FVKA 3AXKA 5J5DA 1UC5A 3SY8A 3GUGA 3MVTA 4U33A 1EP1A 1NVMA 3W72A 4RZBA 1C8YA 3KTXA 1MFVA 3EEGA 1JPHA 2BY1A 4CEXC 5KZ6A 5DT5A 4RW5A 5DMNA 4MZ8A 1C9DA 3BLFA 3RM9A 2UY2A 4E4PA 3S1WA 3A3XA 2JALA 1A49A 2FGLA 1YBQA 2NQHA 1ECQA 5E70A 3GE7A 4P7NA 1J93A 5DMMA 4Z42C 2DIJA 4R7WA 1KKOA 3V35A 1EJTC 1G4EA 3A9BA 5E0KA 4JFSA 1L6GA 3WBAA 2ZX7A 3HN3A 4OOUA 1L6FA 2AL2B 4I5RA 2Y5SA 3P74A 4G56A 4HMDA 1FH7A 2JKEA 2J9YA 2GGIA 2YL9A 2ISSA 4EXBA 3W7JA 1JVNA 2GGJA 1PDYA 4PRTA 3IJIA 3GM8A 4Y9AA 1SGJA 4WRHA 2GGEA 1OD0A 4EWJA 4M7TA 4QRNA 1EP2A 3WLSA 1OFOA 2J9XA 2QCEA 1XG4A 4QIUA 1OIMA 5GVJA 4LXFA 3KRUA 4GO9A 2WZIA 4PMDA 1MEHA 4AY8A 1P6CA 2CPUA 4I7WA 3ARZA 1Q63A 3EWUA 4X63A 1XG3A 3LHWA 1XLKA 4DUVA 4Z1CA 4OV4A 3C8NA 2B7OA 5GPRA 3IRDA 3RCMA 1HQTA 4FP1A 4X2RA 3ZJKA 4ZE5A 1FWIC 4XKYA 1UP3A 3QPEA 1F3WA 1GVRA 1GW9A 3DBNA 3JZEA 5M17A 1D7KA 3GS6A 4DAFA 5BCAA 4UQBA 3RMEA 1J11A 1QOPA 3B9OA 4GK8A 3E3HA 4M1BA 2VJXA 4P8WA 4JQ4A 4QJ4B 3LEPA 3CL6A 2Z2AA 1JRBA 3MA8A 8XIAA 1M3UA 2IPGA 4UIOA 2R1PA 1TV8A 3SR7A 1OGBA 2O7SA 4XAGA 3LCWA 3F4CA 1B1YA 3ITVA 1J0JA 1KXVA 4LRSA 1HF6A 3FEQA 1LTDA 1W5QA 3W1TA 4UTKA 4AISA 1PCKA 5XINA 3LZ5A 4J7RA 8TIMA 2JK2A 4JTIA 2EPOA 2C79A 2DVTA 2Q6ZA 4MWAB 4S38A 1WCGA 1RK5A 3NQ6A 2XSBA 2ZRXA 2VWTA 4HPJA 3PAOA 4AAJA 4AHQA 1XYAA 3MSRA 3DXIA 3FCPA 3XINA 5I79A 2Z00A 4JTJA 5DF0A 1W17A 5TBOA 4KRUA 5AC4A 4A05A 1JRCA 2E5CA 1EPXA 1TVLA 4QQ3A 3WH9A 1E40A 1HKMA 3NQEA 1E70M 4Y9NA 3GW3A 3W87A 4I5UA 2JGQA 1O1HA 1P43A 1LROA 1N8FA 2IUZA 4NSBA 3VGFA 3M1ZA 3TYZA 4TV6A 1US0A 3KE0A 3DZ1A 1TFVA 1VRDA 4JFTA 1H7RA 4D6CA 4DQWA 3FJLA 3DFHA 4ICCX 4IICA 4C6LA 3P14A 1V3LA 4ZGYA 2VP8A 3KBVA 1XC6A 3NQ7A 3LGEA 3D47A 1KM1A 1BVWA 1JDEA 3MDWA 3CB8A 2J8FA 1IWBA 3HM7A 3R58A 4UUIA 1KCXA 4RDZA 2BZNA 4C60A 3L4WA 2PSNA 2XYLA 5G2HA 2INZA 3O1NA 3EGJA 4YHGA 4UTTA 3O6CA 1MXGA 3N9KA 3LQLA 2GVGA 2EJ1A 2CYGA 2QS8A 4KEUA 2JEPA 3XIMA 3PG8A 4EWND 3S2LA 4OGZA 5HWJA 4H9MA 3AOFA 3EDDA 4C91A 4NNAA 2C7FA 1Y5VA 2D0HA 4KRZA 1RJRA 3U57A 3N15A 3GLCA 2ZUTA 4LBUA 3U9IA 5EMJA 4LS1A 1GW1A 1ZALA 5LXXA 1PE1A 4M5PA 3SCTA 5IHRA 4LVDA 1WDRA 2OX1A 3CV7A 1HP4A 2G96A 1BHGA 2GSJA 3VNYA 2QPXA 3EOUA 2VEKA 4AVNA 2W61A 3PPGA 5C54A 1SW0A 1JYWA 4NXSA 3U2CA 3RU6A 1J79A 3GG0A 5JU6A 1X6NA 1W3JA 1W1YA 2A4AA 1L6YA 3LMYA 1TG7A 4G1KA 1BEUA 3NM3A 5BOEA 2YL8A 5FEZA 3AISA 4AD4A 3G1YA 4G5DA 2L5HA 3KCOA 3K8MA 2YL6A 1ONWA 4MMWA 1VHCA 2J7DA 3SGUA 3ME3A 1EP3A 4UFJA 1H41A 4S3JA 1S39A 3TFXA 4BWLA 1GVYA 3WMLA 1VJSA 3RJXA 4GVHA 1KLZA 1TCDA 1EJ7L 3VDBA 2JEQA 2FH8A 1JCXA 3A47A 4WKAA 4GUGA 4H4IA 3QR3A 1CLXA 3D0CA 3AS3A 3W07A 5LA0A 2WVVA 4GCXA 4MB4A 4O1FA 3C4UA 3LOTA 3FJ4A 2YLLA 2C8NA 2W5FA 5CPTA 2I17A 2JQXA 5CAHA 4H6EA 5C0QA 2A3LA 3GVGA 1THFD 3MO4A 1CGUA 1XHGA 4AX6A 2VXNA 4HZ6A 3OJGA 2Y5EA 2WBKA 2PDCA 3D46A 1SO6A 1A5CA 3GG7A 7PTDA 2DGAA 1W3IA 4XK2A 3WDIA 2KAUC 2GVYA 2E3ZA 4IP4A 4Z1AA 1ZU8A 5AHNA 1XISA 1REQA 4PEKA 5TD4A 3WF3A 2PUZA 3L4VA 4O0QA 1U22A 3VPLA 3V16A 1ZENA 1JGIA 3MWCA 4GYFA 4R5EA 1HZYA 4UXDA 3Q94A 4GQRA 5I3HA 4CD7A 4KWOA 3CUGA 3T2OA 5CJ5A 4DLFA 1NP2A 1WXZA 3FV9A 5CPSA 1CIUA 1KWKA 1CT5A 2HBXA 1SUXA 5HULA 1TWDA 3S5ZA 5DT7A 5I5RA 1I1XA 3FGCA 3TNOA 3M0VA 1KM2A 3W1LA 4B3KA 3G1SA 1E1CB 3ALFA 1S2WA 1OFAA 2ZUUA 2OTDA 5FF3A 1X8CA 1IT0A 3MYPA 3UZJA 4TV5A 1IE7C 3LV5A 1QWKA 3WQDA 4DVOA 2X7VA 1HP5A 5HUPA 1OC6A 1VRXA 1FWAC 4GABA 5H8UA 3IV3A 2NXIA 1U83A 1MQRA 3RGTA 1IV8A 2VC9A 5AHFA 5A2BA 1X6LA 4GIRA 1RJQA 1AFSA 2YB4A 1BG4A 3ABOA 2CLIA 1EJSC 1QATA 4LAZA 4YVVA 2YCEA 5F4SA 4AWEA 4GQGA 1QI5A 3TDFA 4BQ2A 1NFPA 2GDUA 4DM2A 2CBJA 3QOMA 4AZ5A 4JY9A 4LUYA 3LHTA 1E0XA 1QHZA 1O5QA 1ML1A 3L5MA 4A29A 3CQ0A 4QJ1A 3KOFA 3NNTA 3E1F1 3MHFA 4D6EA 1US2A 1IZKA 3K8KA 4FEZA 3V36A 3ZJ7A 4GVGA 1NDWA 4NILA 1CGWA 4WVXA 1AZ1A 3WJYA 1NWSA 1BQCA 4RLIA 3KM8A 4HMCA 4C6QA 3WLIA 3IJ7A 1RPXA 3EEZA 5H8MA 3UQNA 3RJYA 2VKZG 4FXRA 1V3HA 3NO3A 1XXXA 1PZ2A 4JDBA 3UJRA 3WF0A 4O15A 2AL2A 3QF0A 3SBFA 3SIZA 3N4AA 1H62A 4K8GA 1O68A 3W88A 4DJEC 5LKYA 1W2PA 4W7WA 1GZ1A 1CBGA 3LXCA 4CU8A 4W8LA 5E9XA 4XSLA 3VGHA 4W9TA 4MJZA 4GO8A 3SCOA 1HJSA 1P0NA 3UCDA 1IZCA 3WMSA 1UHVA 1UA3A 3L4UA 3QHOA 4XAFA 3L4TA 3VKKA 3W22A 5CC5A 1QI2A 3A12A 1YE4A 3N2BA 4IFRA 4E5TA 2Y61A 2ZRUA 3HQPA 3KVJA 3VNDA 1AQHA 1UKOA 2XU2A 2ACQA 3FFSA 4F66A 4N7QA 4US5A 2OO6A 3IIZA 2BGNE 3BTNA 1H4PA 1XH2A 3GB6A 2RJGA 4NZJA 3PBMA 2HS8A 4M51A 1BVNP 4OZOA 1NOWA 2PCQA 5I3JA 1K70A 2WK2A 3FAWA 4CNUA 4IZGA 4X0NA 3WBYA 1GTHA 3SUUA 1BYDA 4W86A 5FF2A 1MW1A 5KETA 3DHPA 1E5JA 3QRHA 3SY1A 4E4UA 4N2YA 2FMOA 4JY8A 1CW2A 3KBSA 2X0YA 2G41A 4DNMA 3N11A 4NASA 1TPWA 4A8RA 3MV01 1JD7A 2BVDA 3PUEA 2ZOXA 4AHPA 3W7EA 1A50A 4MWAA 2QJNA 1MFUA 1R3VA 3WDJA 3FA3A 4OE7A 4C1LA 4TOQA 4MIMA 1R3TA 3ATYA 2HNHA 2OZ3A 1UROA 2ZIDA 2Y62A 1KFWA 3BOLA 1I2RA 3VD4A 2YDRA 4GVIA 4JN8A 4CKQA 3B8WA 3AIBA 3AIUA 3VILA 3LI0A 1VBUA 1F8MA 1JUBA 3IPWA 1L8PA 3M9YA 1P0KA 4B5SA 2NQ9A 2J9ZA 4PTDA 3H2CA 1E51A 4AZGA 3NPVA 2GSEA 3OIHA 3W7NA 3BLOA 4WKHA 1Y5WA 2NSXA 1FCBA 3FXGA 4S1FA 3B97A 1UJPA 1A5UA 5M5DA 3GVWA 3E0FA 4GISA 2VD9A 3CZLA 1OFPA 1FHDA 4R3UA 4X60A 3TCEA 2OQHA 3BH4A 1WAWA 4AH7A 1EHAA 1XP3A 3B9NA 1C29A 1JCNA 3GIYA 4JKMA 3PP7A 2VHLA 1UD4A 2GGGA 1J10A 4L61A 3WG6A 1S46A 1IEVA 4O28A 1LJYA 3CUXA 2F2HA 2QMKA 4LYRA 3ZT7A 1HNYA 4KMQA 2QYGA 1HKJA 3QMRA 3M6YA 5BU9A 3WF1A 2KZHA 3CIXA 1FWDC 1OYCA 4GINA 4YHEA 3GZAA 2R14A 2VFIA 1A80A 4GY1A 5F2MA 3MUCA 1XRTA 3UXKA 4J27A 4MJ4A 4DJDC 1KBJA 2D3NA 2OYMA 5HNRA 4WDXA 3GRIA 4FXJA 2G97A 2VFHA 5A6KA 4H9YA 3AHZA 4AYGA 4GYKA 2ZDRA 2PODA 3WNKA 3VD3A 4IMDA 1GNXA 1Q6EA 2OQLA 1LOLA 4H9UA 3OGRA 3REQB 2Z7GA 4CLMA 3N34A 1KBIA 2FTYA 4W7UA 2OEKA 3PBVA 1JULA 1U30A 3TQVA 3W7GA 3CUZA 4HSNA 3VKJA 1PAMA 4GNVA 3TYBA 3P62A 4IL0A 1R38A 4L4OA 2QKFA 4U5IA 1PHQA 2EPNA 3EWCA 3E5BA 4HZ7A 5G4WA 3UPMA 4GC4A 3M7SA 2UY5A 1OFDA 5C9RA 1LUCB 4MB1A 3UWQA 2MUCA 3BAIA 3L5LA 2YBTA 5IFTA 3CH0A 4URIA 3IJQA 3UXLA 3EXSA 3H22A 5AYXA 3F2BA 1D8WA 1IWAA 4BF7A 2DUZA 1A0EA 4NHVA 2NVDA 2O7QA 2XFRA 2RAGA 5A8MA 3I6EA 4BHYA 3AUOA 3LM7A 3NM1A 1WKEA 3WY1A 3QY7A 5ECUA 1F3EA 4A3RA 1AVAA 3OP2A 4IUGA 2XTKA 2NV1A 2VVSA 5G1YA 1DJWA 3O15A 2DP3A 3EMQA 4ATWA 5D02A 3SW6A 3M7WA 4S3FA 3I7RA 4IOTA 4ZOAA 4F0HA 1F6PA 1J5TA 2XSAA 4AIBA 1FFQA 1LCOA 1XYCA 2WW5A 1V02A 2SFPA 3WH5A 1P7TB 2Y1HA 1R30A 3TYUA 1LQ2A 4L4LA 2XIMA 1XIHA 5I02A 4GLEA 4LALA 3ZFHA 2CLKA 2VZUA 1OHLA 2C13A 5DRIA 4XAYA 4M82A 4AD0A 1Z9AA 1GZGA 4DJFA 1EEXA 3MKKA 2C1GA 1K9DA 3SDOA 3TLQA 4AW7A 1FA2A 1T6MA 2WC3A 2IPWA 1VIWA 3ZZ1A 4UR8A 2VFEA 2VT0A 2QIWA 4A35A 3PZNA 3GDTA 3CASA 4S3BA 1FWJC 3BSGA 3HJEA 3SECA 2YA0A 4JQ3A 1XM3A 4GZJA 3F4WA 1K9EA 1CI1A 1PDZA 5JVLA 2PDLA 3I3EA 5EMLA 3SCSA 2WM1A 1LQAA 1J18A 4Z1YA 3STPA 3CHVA 5FOOA 2DT0A 3T40A 1UD5A 3VNMA 3A5FA 2XN2A 4IFOA 4X9YA 2DQXA 4F2TA 1HJWA 4DZIA 3ELFA 4WJXA 4QJ5B 2WO5A 7XIMA 2B4GA 3OOQA 4F40A 4GX9A 1HJUA 3SM0A 2A1YA 3ITYA 4O54A 4XBJA 5FEWA 4BEUA 3KX6A 1W9PA 3POHA 2BDQA 2ON3A 2DV0A 1Y65A 2E28A 2WV8A 3GVQA 1R2TA 3GC2A 3E0LA 5D9OA 4IL2A 2CLEA 2PGRA 2V30A 1ISVA 5LSMA 1E6RA 3L67A 1Q6CA 5F1VA 5FJIA 5I3DA 5A5WA 5IRPA 1A0CA 1ZY9A 1TV3A 3RHGA 3T9PA 3TZNA 1TMQA 4CUCA 3VKDA 2ZXDA 4V15A 4M0XA 5DQPA 3SN1A 3CAKA 4G8TA 4JKLA 5GQBA 1A53A 5BWFA 1E3ZA 1XYLA 1EJVC 4L6OA 1MO0A 3FHAA 1SZNA 4I9JA 7CGTA 4H01A 3VIIA 3SCRA 4IMAA 1LRTA 4GXPA 1G5AA 4PMNA 3HG4A 3WD3A 1LT8A 3W7HA 4NT0A 4GZEA 2ZZ1A 4LFYA 5A95A 2IKHA 1OC5A 1P0EA 3MI2A 2G8ZA 1MRQA 3TLLA 2BBFA 5HMSA 3K2GA 1IXQA 3PBYA 3W76A 4YYCA 2G3IA 3S1VA 3ZWSA 4AVOA 1JCJA 5AC8A 4PTMA 3KTSA 2RJHA 2WMKA 5AHEA 4FK9A 2EKCA 1W9DM 4Y8EA 4CQAA 3VFLA 4PUWA 3PZGA 1WBHA 2J7EA 3UR2A 2VDGA 1E6XM 1K4HA 2YDQA 3W71A 3VNIA 1EBGA 1H7PA 2Z29A 2QEZA 2PWEA 1DJZA 2PCEA 1EO5A 4JIPA 3UJEA 1GPFA 1KLYA 4RE4A 3Q2DA 3FSUA 5AYIA 4DXKA 3STCA 4K6AA 3RR4A 2R9RA 2ZXQA 1VCGA 2B0MA 4HQVA 3THCA 4PSRA 3PY2A 4GQQA 2P1FA 4HNVA 2X2GA 3HIJA 4K1WA 4Q8QA 4RK8A 5HOSA 2ZTJA 1CGXA 3UBPC 1OEPA 2ADAA 3WH6A 1RCOB 4YXGA 4I7VA 2EF9A 4JL1A 3WF2A 3PG9A 3L65A 3BJSA 3RMJA 3M43A 3RFAA 3PZOA 5U4NA 5TIMA 1P0DA 1GZJA 3B9DA 1GQNA 3LGGA 1X1ZA 1TQJA 1XRVA 4Q8MA 3ISIX 3E38A 4UFLA 2JF6A 3TONA 1XICA 1JCLA 1VENA 2NUXA 1KXQA 3H2OA 2XFFA 3BUVA 4DWSC 2W3ZA 2X0SA 6XIMA 4O18A 3H26A 4KWWA 8RUCA 1JYXA 1XIJA 4WXYA 3NGJA 1YEYA 5D2XA 2E6DA 5I09A 5D2VA 2FHBA 1V77A 1DTUA 4WSKA 3W85A 3C2VA 2CLMA 3U6WA 2H6RA 4L56A 4MFEA 7REQB 3VKBA 4OT7A 4V27A 2O56A 1DWIM 1IYXA 1DXIA 4D6DA 3ABZA 1JYVA 4JAWA 5A6MA 4ZEPA 1F05A 3PBUA 8A3HA 2X1IA 2YOCA 1LM1A 3THAA 3ARRA 1P1MA 2R94A 2XFWA 1TJPA 3N1AA 4ML9A 1MQPA 3TK7A 3T0DA 3CEPA 3AMKA 5LA2A 4W85A 4U10A 3CZJA 1E4MM 4KFOA 2WLZA 1UPMB 3V75A 4YTQA 2RHGA 4AZCB 1OBAA 2DT3A 2WMIB 2ZWYA 4D6FA 4O57A 1XLJA 2XJ7A 4ZB2A 1Y0EA 1ZJIA 1GVEA 3FYOA 4JTSA 3AHXA 2Z25A 3TW7A 3ECQA 3CL7A 3LCHA 1ITQA 1DE6A 3CV1A 5FAJA 2E8YA 1CLVA 1Z44A 5D9NA 4TMBA 3G6LA 3QR0A 1GOQA 3EB4A 2VX7A 4PMRA 3HQNA 4GC3A 1BTMA 3NZRA 4B3ZA 1XLMA 2O9PA 4TX8A 2V67A 5PTDA 1VF8A 3PNUA 1F6YA 3EOSA 4GKTA 2HBVA 3SUSA 1TZZA 1FTXA 1HJVA 4D8LA 2J7CA 1L6WA 3U4FA 3FXYA 2GJPA 3LBMA 1Q4WA 3SRDA 2BASA 3K30A 4OBTA 4HPXA 4WJEA 3S9YA 3G5EA 4QM1A 3EA2A 1QK0A 3CZEA 4J40A 4IPPA 3OVQA 1ZP4A 5CSUA 5EMYA 4DZAA 5I07A 3BPWA 3BG9A 1C7SA 2DT1A 3MZNA 3PUGA 4GE8A 4JHOA 1OCNA 2V5BA 2F6KA 1VPXA 2GJXA 5MHBA 4WOQA 3UNDA 3M0MA 2ABBA 4YNGA 4DEFA 3T42A 4RR4A 3B3DA 2ZZ6A 2DEPA 4XBKA 3LLDA 5C7VA 2A3EA 2JKAA 4UZUA 4AMAA 3UP8A 2CLHA 5DCDA 1LUCA 4I9TA 4E8DA 1HN1A 2GDQA 3P84A 3C2OA 2XN1A 1GT8A 1Q6QA 4JNMA 4AZ6A 1KB3A 4EOUA 1P6WA 4KRTA 2IKIA 1G6CA 3PJTA 3BDKA 4KQNA 1SJAA 4EAYA 4JQ1A 1PKYA 1T8XA 3NDYA 1UD3A 2V68A 1F7BA 1TA3A 1B9BA 3OIXA 5H91A 1DTNA 3TA6A 2E68A 3QOKA 5LNRA 3B4UA 1UKSA 2HVMA 1XFBA 3LZ3A 1RLCL 3G0XA 2ZUNA 3SZ8A 2X1SA 3VKAA 2X05A 3U3HA 3MP5A 1RALA 1KM3A 2DW6A 1VB9A 2GUBA 1ZBCA 5IBXA 4BZYA 4PL1A 4NP7A 5LXEA 1RY0A 3G0UA 1XYZA 4Z1DA 4CNPA 1AH3A 1VJIA 1RCXB 3UU0A 4JQ2A 4CVUA 2QCNA 1GVIA 1A5KC 3QC0A 4W7VA 1KFLA 5A8GA 5FAGA 4EANA 2ZZ5A 1M65A 3B06A 3DKLA 3O6YX 5AZ0A 2ALDA 4U2ZA 1WZLA 4IPNB 2PWHA 1ISXA 4KWUA 3R94A 4U3CA 1IF2A 4E2VA 4P61A 3V5FA 4NZ3A 3M07A 5A3HA 1SJCA 4C1NB 1ZBVA 2BP1A 3ERPA 1LLZA 1K8YA 3IV8A 2Z1WA 4P8UA 3IAPA 3VIKA 5JH2A 1BKSA 3LPOA 1IWPA 5KITA 3N9RA 3CIWA 4MDOA 1O6IA 4LNCA 3BQ6A 2DZAA 5HANA 1TX2A 2Y5JA 4R27A 5B80A 2NX1A 3L66A 1DE5A 4CU6A 3GTXA 3RAOA 1UR8A 3UXDA 2QJIA 2VEPA 1EC8A 5B7YA 2EKGA 4NU7A 4WY0B 1LOQA 3ARTA 4I7UA 4N6FA 4WX2A 4WY0F 2XSXA 4O19A 3VDHA 5CC6A 1H2JA 2EG6A 1Z8AA 3BLPX 4O8AA 1H09A 3CYJA 4YJ5A 4LRTA 3VNLA 1FWTA 2J8GA 1HL9A 3PN8A 2HNEA 1X8FA 2HEJA 3GH4A 3B8IA 2BX7A 3CAQA 3L9CA 3UWVA 3CC1A 4Y9MA 2VEIA 5A6BD 2EAWA 2PGFA 3CYVA 4TTGA 3KAOA 5FJOA 3PSVA 4MYXA 3M0JA 2BY0A 2FLIA 4ZSTA 4IMEA 5A8OA 5HXMA 3LPPA 2J7FA 4K2SA 4OV9A 2ZA2A 2PDJA 2ICSA 4N42A 4KERA 3EWWA 5C6MA 1RR2A 1XLEA 1UH4A 2R8WA 3QN3A 2HWGA 1VFSA 1OFEA 2ZVRA 3E5PA 2OJPA 4PUJA 3JVAA 1ITCA 4W88A 3WQ4A 2VO5A 1S2VA 1JZ6A 4FMVA 4DJED 4PBFA 3N3TA 4RX0A 2GYIA 4M81A 1XI3A 3BGAA 4GH3A 1V08A 5LIYX 1GHRA 4ZQNA 4ZR8A 1E9ZB 4WGXA 3TH6A 1QDSA 3H7RA 4G6CA 4AIEA 3H4WA 1H11A 3NURA 4UCGA 2HPMA 1RQEA 2CZ5A 3G1VA 2ZZ7A 3H70A 3RPTA 4AC1X 1M01A 4FNPA 4Q4RA 3F03K 1BTCA 2OFJA 3G1XA 1GEQA 4UTUA 4LUSB 5BXTA 4CNNA 1U5JA 3NQCA 4BI5A 2OX4A 2X7WA 2J13A 1DWFM 4FNSA 1IEQA 1CXFA 3H2EA 4UNIA 5D32A 3TJLA 3GDMA 3GAKA 1E15A 4CD5A 4NZ1A 3EDJA 3QQ1A 1SMDA 3VD5A 1XX1A 3KW3A 2XIIA 2QNEA 1YLVA 4TQTA 2Z2UA 4UQEA 5D03A 3NYZA 3D3FA 3IWPA 1UKTA 1CNVA 4A3HA 4BCEA 1J6PA 1SVDA 1NF0A 2BTMA 2NSOA 3WNOA 3CAWA 4GKLA 4W89A 4GHRA 3CMGA 3VGBA 4Z08A 1EJWC 3OTRA 3R0KA 2XDFA 4Q4KA 1YDOA 1W1VA 2QDHA 1ISYA 4HU0A 3ZVHB 1O94A 5GJNA 3O06A 3NOEA 1FQ0A 4XWUA 1HW6A 4GIYA 4TIMA 1M41A 2WC7A 1HVXA 2BHZA 1K4GA 3CWHA 5KTLA 3M5ZA 1AJ0A 1I6NA 2C3ZA 1KGXA 3PZVA 1DYSA 3W82A 4LJ3A 4N4QA 3HB9A 1BKHA 1TJ2A 2QPUA 3INPA 4GY7A 1EJUC 4DPPA 5E6YA 2OWCA 1XSJA 4OQVA 1UP2A 3SCVA 5ECVA 1MYRA 1TKKA 1KGUA 3DBPA 1F6KA 2QCFA 2WMJA 2WJDA 4DJFC 4QQUA 3WBWA 4AQLA 3PZ9A 4ATLA 4F8XA 3OODA 5T26A 4DUOA 3ZR5A 5BMWA 3WUEA 4UFMA 5DMYA 5DO8A 4NZ4A 1FWFC 1QO2A 1WDQA 4IT1A 1X39A 2F38A 3BE7A 1KNWA 1ME9A 1A4LA 3CQJA 3GNXA 4MUZA 3VXGA 4FX7A 2DJLA 1RBOB 5FJTA 1VBHA 2PP0A 1UD2A 1JDFA 2VC7A 3LS9A 1M04A 1DHPA 2OSYA 4O50A 3PVFA 4FNQA 2CWXA 3L68A 4XIMA 3G6MA 4IF2A 2YDAA 3CBWA 4LWWA 4C6IA 2QCCA 3R43A 1TJRA 3I7SA 4OU1A 1GVOA 3WH8A 3M16A 1XKYA 2Z26A 1PTAA 1OT2A 4ILSA 1BRLB 3W7DA 3VE7A 5CG0A 4G7EA 3TROA 2BODX 3VD9A 1XIFA 1H63A 3B8UA 4KBXA 1LBMA 4MSSA 2QAFA 4A3YA 4K8EA 2H9AB 3SFWA 1ISWA 4FA3A 3UG5A 1FY6A 1H7XA 1RXOB 4GCAA 3W70A 3VGDA 3N17A 4N6EA 1KCLA 4B3LA 1KM5A 3F1QA 2HZGA 2VDIA 1DJNA 4B5VA 1EXBA 3STEA 1KV5A 3DFSA 5C2CA 5K4XA 3H24A 2QUTA 3R79A 1W5OA 3WD2A 5C70A 2PTYA 1X7FA 4CN4A 2NV2A 4AFYA 4JL2A 1B3ZA 1ESWA 2AL1A 3CLMA 3AMDA 1J4EA 3TTQA 5CSRA 1Z7AA 1GQLA 1ZAHA 2I14A 3VFCA 4DXXA 3SQMA 2OGJA 4QCFA 3P67A 4C6KA 3NIYA 3TWAA 3EKZA 2I9EA 5GJPA 1Z89A 1YPIA 2XH2A 2GJLA 1KTBA 4TMCA 1I2NA 4S3AA 2ESCA 1E0WA 5A6AA 2RDWA 3KEHA 2WANA 4LB3A 4NJGA 2VZOA 2CHRA 3W7LA 5K7JA 4UNLA 5CBIA 2GVLA 4ORIA 3AWOA 3W2JA 1MEIA 4XZNX 3UESA 1ZFJA 1KR1A 1LRQA 3AICA 5F2GA 3L2MA 3H54A 5F2LA 1QPQA 2E9BA 1KQYA 3ARQA 4Q32A 3TSDA 4A2RA 4MB3A 4Z0SA 3M0KA 5DBUA 4ICMA 4JPGA 4IP5A 4LY8A 4I8DA 5CSYA 1ME8A 3MYOA 4HCDA 3W27A 1A5MC 4KFNA 4HPHA 1KWGA 3AMLA 2PRHA 1NFBA 1S5WA 4HMEA 4HSOA 3BMXA 1OADA 3HQOA 1UR9A 4UMBA 1YHTA 5AHLA 4XIAA 1R9YA 4YS1A 1QASA 4MYAA 4WOZA 3AIRA 3VOGA 3ORWA 4C6OA 3TR9A 3O16A 4MKNA 1WUEA 5CH9A 4AD2A 3CLWA 3NA8A 1I4NA 2DU2A 4KESA 3UY8A 3RM4A 5FJUA 3SB0A 1WBJA 2H90A 1CXKA 4JZ5A 5HR7A 4M80A 3KLKA 4C6CA 1Q45A 1M7JA 3TSMA 5M1TA 3W28A 1EQPA 1AMKA 4B9YA 1BLIA 3JUGA 2A2IA 2ACUA 3VZZA 5FSDC 4LNYA 1AMYA 2G50A 2WSKA 4AG0A 4JBRA 1B5TA 4XKMA 3W73A 5C8BB 3SURA 5CEWA 1IXNA 1EWDA 3EXRA 2ALRA 4CQ9A 5CPOA 3PC0A 3PZUA 4QR6A 1QJWA 3JRKA 3WNNA 1JJKA 4BR1A 4NZ5A 2UY3A 4WDUA 1Q85A 4UQAA 2YKKA 2OKTA 2TODA 3Q45A 2IQDA 3AYRA 4QCEA 3VOFA 2ZFAA 1TPDA 4TR9A 1POJA 4AIUA 1AD1A 8XIMA 4YCPA 1Y5XA 3GVVA 1F76A 2NLIA 1X7IA 1ZCCA 3CT2A 3DYPA 2AQVA 3IEBA 2O4QA 3KUMA 4E0CA 4ZMGA 1Q7MA 6PTDA 1I2PA 1G9HA 2PF8A 1JEZA 4GGHA 4Y2WA 2ZZ2A 4GIEA 5A8QA 4W4QA 2OLSA 1FWGC 2QHAA 1QPKA 2ANUA 2FZDA 1C93A 1QNQA 2B7PA 4C5YA 1SW7A 5D04C 2I5QA 4J35A 5D2WA 4JIRA 4B5XA 4NJHA 2BXVA 1YNYA 1YXCA 4O14A 2WNNA 4UB9A 2GLKA 3UETA 3MY9A 3T2PA 2C6QA 3BZGA 2YPIA 3NDOA 2CFFA 2PWGA 4G2DA 1PTGA 4QISA 4Y96A 1D9EA 4QLJA 1QPOA 1QAPA 4B5WA 5REQB 4PRWA 4R7OA 2PZ0A 3EOLA 1Z41A 1DEDA 3FA4A 3IIPA 5G2IA 4KH2A 2NQLA 4LAUA 3U48A 4BQ4A 5T9BG 4LYQA 1KW1A 4AZBA 1N8WA 1AH4A 1XLCA 1AQ0A 2WQPA 1FH9A 2UY4A 2XM1A 3GH5A 5I78A 4M6UA 3IJDA 1PXGA 3ICJA 5G2WA 4AF0A 1OINA 2JF7A 4M19A 5JH1A 3T1GA 5E0CA 2PS2A 4JTGA 5JBFA 3TXZA 3HG3A 5A2AA 4PMZA 4WK9A 2QW5A 1J0ZA 2ZRWA 2PLCA 4JFWA 3P0XA 2A7RA 4Q4OA 2XIQA 3B0UX 2GOUA 3HJZA 4ERAA 1ZTVA 3KL3A 2DZVA 3KOXA 4J2PA 3W2KA 3VC5A 1K77A 3KL0A 4A8IA 4BF9A 4W8AA 3STGA 4PMJA 5C2GA 4JQAA 3NVDA 3GXIA 1XLFA 3S6TA 1V93A 1C8QA 5ABHA 3WYZA 5JQ9A 1NFGA 2NV9A 2ZXBA 3NDZA 4YCOA 4DWSD 2EXOA 3NXLA 3T44A 3PNZA 2NT0A 2DFAA 4M24A 5AVNA 1UBSA 3NL5A 4KKXA 4PUNA 1OZMA 4LEQA 2FB2A 4R33A 4EPEC 2DDXA 1E9YB 3TIMA 2PGWA 5KZMA 1SU5A 3RM8A 3W6MA 5HMEA 3UG3A 4U5KA 1UH2A 3NUKA 5ABFA 2Y6ZA 1UIPA 2HXUA 3ZVHA 2ZZ3A 3FEMA 4BQ5A 5AKQA 5FF7A 1KBKA 3W4RA 2DIKA 1WZMA 2VCAA 1HX0A 1OK6A 1D3CA 1HGYA 2LLEA 1UOKA 2CLOA 2WMHA 5IDZA 1K6WA 6A3HA 4W5ZA 1CEOA 1EL3A 3MP4A 1MWOA 1T7LA 1WDSA 1PVNA 3IGXA 1OCBA 3OZMA 3N18A 2X8RA 3OLIA 2I57A 2E4TA 1WX0A 1G01A 2YCJA 2YSWA 1FDYA 5T9CE 2YW3A 4FR6A 3R1ZA 2QF8A 3ALGA 3RIKA 2G3FA 1XS2A 5K9CA 4P8VA 1WNOA 2J8TA 2FGBA 4V28A 4B5UA 4RL3A 2D22A 2WPGA 5J8LA 3NL6A 3ZJ8A 1OD8A 4J3ZA 1Q6LA 1O5KA 4MLRA 1ZRQA 5CLWA 3HTWA 1N55A 4AXNA 1KQZA 2WSRA 1QNSA 2DPEA 3D5HA 1R47A 3TYEA 3DX5A 4JCLA 2CW6A 1TV2A 3E0IA 4E8GA 3LUTA 5TF0A 1RH9A 4PCSA 4UWMA 3W23A 3GHRA 4RCXA 4WUIA 1XBYA 4NF7A 3UVIA 2WXDM 4HNLA 4ADTA 1BYAA 2BY2A 1YX1A 2PDIA 4JCMA 4EXQA 3TFCA 4DF0A 5AB3A 2I1OA 4K1GA 4PTWA 4OUIA 1ZB5A 5D8ZA 3AJXA 3WLPA 2TYSA 4S39A 1W3HA 3ONCA 1XCWA 3WFZA 4EAMA 4OKDA 3FJ6A 4QDMA 2BY3A 1YE6A 3TV8A 3AYSA 1R3QA 2R1MA 3MUXA 3ZYZA 4JTTA 1U33A 1UMYA 3UCQA 4WXZA 3V0TA 2C0HA 4OTKA 1V6XA 5D30A 2FDSA 4L64A 1POKA 1ICSA 3UPWA 3I68A 1XIEA 2ZZ4A 1IEWA 4ZFCA 3W37A 4DY1A 4M3PA 2BVYA 2WHKA 1XRFA 4IMFA 3R0DA 3HG2A 4FX6M 3W1XA 3W1NA 3HGJA 4IHCA 4YN5A 1Q7QA 4PH6A 3FW6A 4UBPC 3RPMA 3M41A 4FNTA 2YBVA 3SEPA 3VNKA 1X38A 3WENA 2BXYA 2ODOA 4FLQA 1KBBA 3P5YA 3L23A 1EGZA 3CTTA 4ZO6A 3O05A 3BW2A 1QHPA 4JEJA 3HOJA 3AJ7A 2XUCA 1S3HA 1KFKA 2O9TA 2EJAA 2DJXA 4HHPA 1AQFA 2REQA 4GYJA 9CGTA 1EX1A 2BFGA 1LLWA 3MMTA 3G8EA 3VNJA 2WBGA 2XWDA 3F5LA 2X30A 5AC5A 1NQKA 1I8JA 4MNMA 1FCQA 1S5VA 4XZBA 2QIIA 2I5GA 5I3KA 4ZOEA 2E9MA 2RGMA 2EQDA 1V0LA 1OB0A 2CZVA 4RNHA 3EB2A 1XUUA 4EACA 5CPNA 1QW9A 1XGZA 3BJFA 1P48A 1B30A 4H00A 4AZHA 4XD3A 1HTIA 3MUAA 1OC7A 1UZHA 5BOOA 3B8SA 3P7YA 3EX4A 3K4AA 3LTSA 4WZHA 2WWCA 4MTVA 1RQBA 5C9UA 1PV8A 4HA1A 3COTA 2GQ9A 1K8XA 4N9BA 3WK3A 3G3DA 1UR2A 2Y7EA 2OLAA 4H8UA 3IUDA 4DWSB 2VFDA 2IPJA 2WC4A 3ZLGA 1P0BA 1OYBA 3E6EA 1EF3A 5JMUA 2CESA 1TV7A 3PTKA 2WM0A 1HKKA 3ANVA 3BJTA 1HUVA 1JZ3A 2XZ9A 2A21A 2PMQA 3R25A 4D2JA 3P3BA 2PDQA 3LNMA 4LOCA 5HAOA 3LK6A 1VLWA 3VIOA 4H41A 4H04A 3H4XA 3LSBA 3W86A 4DRSA 3B04A 3N2TA 1EYWA 3DG3A 1K02A 2E6FA 2GQAA 1BPLB 3B0PA 2V8ZA 3EWZA 3DCPA 1DHKA 3PJXA 3NZ1A 1D7FA 3VUSA 4NG3A 4NRRA 4PUDA 3M0ZA 1NP0A 2C18A 4C6NA 1UIOA 5BRPA 3LM3A 1REQB 3W24A 3OBEA 1OX4A 1VPYA 3OYZA 3PPFA 4A3UA 4DNHA 3MB9A 2Q8XA 4PTVA 5C5YA 3DOPA 4HHHA 3GBEA 3OZYA 2VX5A 4JTDA 1DIEA 3V4BA 1E3XA 4Q8OA 4MUPA 2W0UA 2IS7A 1W3LA 4GH1A 3S6OA 3U8GA 2X09A 4KIEA 1JNDA 1FP9A 4K7YA 1T0OA 1XLIA 3IACA 5ENLA 3Q37A 3W7QA 1WKYA 3S42A 3AS0A 3AS1A 3JZUA 1E71M 3WD1A 4HHMA 4HNTA 1RP8A 2XZ7A 1EUNA 1ODUA 4ZO9A 1BXNA 3DG6A 3LLFA 2ZUMA 3A4XA 4NZFA 4MKVA 1ZQ5A 2PWUA 3QH2A 1Z32X 2WHMA 1U2YA 2FB3A 2QUUA 2BWGA 4MM1A 3WQPA 3HFTA 3KP0A 3QFWA 1XDMA 4AX7A 4C5ZA 3N2CA 1UG6A 1IXPA 5REQA 1JZ8A 4AIOA 2ACRA 1VP5A 2YFOA 3M64A 3WUBA 3IJ6A 4UQDA 1VYRA 1S5MA 1EO7A 2O9RA 2PWVA 2EPKX 5J04A 5LA1A 2PPGA 1KGWA 4NX5A 1GOWA 5CJMA 2VRKA 1IT8A 1J2BA 1P1XA 3SUTA 3KHJA 3W7MA 3VOCA 4XX6A 1SFSA 3QFEA 2ISDA 2D0FA 3AO0A 2QCMA 1WKDA 3M6DA 1DIDA 2OELA 1S2UA 2PLMA 3O8AA 3R6IA 2IW0A 1JCTA 4L9YA 1B54A 4ZO7A 1OQFA 4N9CA 3E0VA 3R13A 3FY1A 3VC6A 5IFPA 1FDJA 2QJJA 3LA4A 3H4GA 2W91A 3A13A 3BMWA 1BWKA 1JFXA 1VIZA 2XINA 3C0JA 3ITLA 3MMUA 4ZODA 3CPGA 3UR5A 4OHQA 3EZ4A 3SJ3A 1ECEA 1BWLA 3TVAA 2G4FA 4LANA 1F74A 3N19B 2O0TA 3NTYA 3WFAA 2FFCA 5F4XA 4JKKA 1DL3A 1QPNA 3UZXA 3CIVA 4RNIA 1AD4A 3AXMA 4HZMA 1E56A 4IGSA 4AMCA 5ABTA 3CNYA 1FWBC 1W1PA 3FSTA 3UVAA 5TAOA 1BVZA 4GI8A 1TO3A 2D23A 4C6EA 4EE9A 2QV4A 4HTYA 7TAAA 1OG0A 3VM7A 3L12A 2YYUA 1UUOA 3OBKA 4ZO8A 3W25A 3KWSA 4DJFD 4Q8WA 4H83A 5E1QA 1QRQA 5EY5A 2V38A 1CECA 3CPUA 5EKYA 2Z1VA 3DDMA 4FPSA 2PA6A 3TCSA 3S8HA 3VIPA 3H12A 1V3JA 3CWNA 3KXQA 1JAKA 4HIBA 2VURA 1JDCA 2PP1A 4HU8A 4JOMA 2VZTA 1W2VA 3GTNA 3O07A 4ROPA 1F07A 2V5CA 4H9VA 1JG9A 4DF1A 4U4MA 3CEUA 1JPKA 1I0BA 2HS6A 4WR3A 5EGRA 4DXVA 2WVSA 3R12A 3H2NA 4IFKA 3L2LA 5BXRA 5AOUA 1W6TA 4O12A 1KRBC 3N3MA 3TC6A 4BF5A 2ZWZA 1UJQA 4B90A 4FNRA 2VUYA 4KETA 3MWAA 3LTYA 5D05A 3U2EA 4ZCWA 1OF8A 2RH9A 1LT7A 3SAZA 3CV6A 3THDA 2ZUWA 5CJNA 1EA9C 3GU9A 4JTUA 3NO5A 4CNTA 3TR2A 2C14A 4DBSA 3KLLA 1TR9A 3ZLFA 3CGTA 1L8NA 3VNZA 3HGOA 3NQMA 3ZVIA 5A6JA 1SZGA 3CM4A 1DKWA 4XAPA 2CXEA 3CK5A 3KFTA 4B16A 3JU2A 1EZWA 1RA5A 3LENA 2X16A 3OVGA 3KS5A 1LORA 1XR2A 2QAPA 1OCQA 3IJLA 1YXYA 1UR4A 5CSSA 2BSLA 4RPPA 3TP4A 3TTYA 4A6GA 3MI3A 1KM0A 3TAKA 4C1KA 5BYWA 2XVLA 1YPXA 3BOXA 2V2CA 4M6PA 1UR1A 2XH7A 3S9ZA 1HT6A 3FHQA 1TSIA 1JXJA 3KCLA 4BJHA 3UXIA 3QEZA 1ZL1A 1R85A 4WGHA 1FHUA 3KCJA 3WNPA 3M46A 2WZEA 3PBWA 1RP9A 4ADSA 3GY1A 1LP6A 4L1XA 3ZO9A 3NPXA 3AU6A 2D73A 3UGVA 4PB5A 3SIMA 1VJZA 2ZKMX 3OU8A 4XD6A 2IPFA 1EB3A 3TKFA 1BD0A 1W8SA 3CT7A 3WLOA 3M5XA 4ZQPA 2PWFA 4EX4A 3M4HA 5LIKX 3GYEA 4XD4A 2V81A 3B0VC 1PKLA 3B8VA 3BSMA 1TTQA 1BQGA 3SSJA 4Q8NA 4RZ4A 3RG6A 3LY0A 3R2GA 4GXMA 2YW4A 1V8EA 3SN0A 2W79A 2Z6JA 2GUUA 1VPQA 3THUA 2J7HA 4GFSA 1DJHA 4UTWA 2ASHA 2ZYFA 3A3HA 4FR1A 5HNNA 4HN8A 9XIAA 3MBFA 1W0MA 4WIWA 4FB7A 4IXHA 2PTDA 2DW7A 4CQ8A 3DFQA 4UOQA 4AWUA 3LI1A 3ITCA 1GKQA 4REQB 3MQTA 1PB0A 2E6YA 5CLTA 3QGVA 3S46A 4RE3A 3ZLHA 2OGYA 2J78A 2Q09A 2QCLA 2OB3A 1FRBA 3TWBA 1CXEA 1JR1A 2C16A 2X1TA 1RD6A 1V4YA 2NXGA 2DZUA 1MVYA 5BWAA 2OYLA 1GYNA 3S2JA 1A3WA 1HIZA 3U5UA 2BMBA 1IGWA 3EYPA 1W1IE 4AY1A 4DYJA 4IJBA 1NY1A 1SJDA 3A9IA 3S5YA 3IANA 3TN6A 3RDKA 2RDXA 5HPCA 2OU4A 4DWSA 1TCMA 1ICPA 1JFHA 4UMAA 1RK6A 4B4HA 1E9IA 1RJPA 4LBSA 3B9EA 4H9ZA 1WV2A 2Y88A 2C91A 2WMGA 1EHNA 2CITA 4HZ8A 1E4NA 3A21A 4GQBA 1DVJA 1G7VA 3TJ4A 1OK4A 3MJMA 4HPNA 3ZXWA 1OIFA 4MB5A 3SUVA 2Z4GA 5LIXX 4ZVJA 2OPJA 3UYCA 2QVNA 3W1RA 4LX4A 3FVDA 4GA8A 4MOZA 5AVHA 2NQZA 2Y7DA 4YVPA 3VCNA 2Q71A 3MT1A 1VBJA 1ZUAX 4Q3MA 5BW6A 3W7KA 3W3OA 3WD0A 3QZ6A 4XZMX 1KA9F 5IOBA 3ZR6A 1QK2A 2YCLB 7A3HA 1SZRA 6TAAA 2VQUA 3C86A 1VR6A 3QSTA 2FKPA 1UWSA 2J66A 1V51A 4AU0A 2Z27A 5JIPA 4YTTA 3DUGA 2BHUA 1J12A 5CKSA 4HOZA 3S5SA 1V0KA 4PMUA 3AXXA 1RY8A 3B05A 3IARA 4BI7A 6CGTA 3ZS4A 1OWQA 4GQ0A 3T0CA 1O60A 1GYMA 4JYEA 5CQ1A 3BLLA 2JKPA 2EPMX 1XH0A 2FYMA 2QCDA 3EDKA 1OM0A 1AW1A 1UH3A 1XH1A 1MRAA 2TRSA 2C15A 3BICA 1E43A 4G7FA 4QG6A 3OQ8A 6REQA 3LHUA 1QUMA 4FXFA 2WCGA 4PYSA 4PULA 3TA9A 4DYKA 2V3DA 4XBSA 4QE5A 1XBZA 4IGMA 3VDGA 3FIGA 4E6MA 2ZRZA 4GI6A 4NI8A 4JN6A 2I7GA 3UPBA 4NL1A 1ZZMA 5A69A 3QW4B 5CPMA 1V6UA 4WF7A 1A47A 1OJXA 3NAVA 3LHVA 3UJ2A 3ZT6A 4L6HA 3RO8A 2VC6A 3UWYA 2ZA3A 4LCRA 2DZTA 2E8ZA 1OY0A 1AA1B 2DT2A 4EP8C 1TIWA 3N25A 3K4DA 3T81A 3ITGA 2OSWA 3S5OA 1WOBA 5I3FA 4PUUA 1UWRA 1A3HA 3T08A 1KD0A 2NXHA 4MFDA 3QV8A 4R34A 3QLDA 3NEHA 3GHUA 1NOFA 3ZSTA 4DBUA 3W2LA 3E74A 1R2SA 2NWSA 2P5NA 3L2IA 3M0HA 1E9LA 4TXEA 2ZE0A 8CGTA 4XZHA 1W9UA 5JUVA 2YFNA 2BLEA 1A4MA 2A7PA 1XDJA 2YA1A 4GOAA 4JNYA 1QBBA 2BG5A 5FI8A 3KBJA 2QCHA 3QC3A 2YZRA 4DB7A 5EA9A 1PIIA 1TYGA 3W75A 4JHMA 1XWYA 2R1LA 4CGTA 4R7JA 1XV8A 4TX6A 3LRLA 2D3LA 3C0SA 4KEZA 1CYGA 2XG9A 1BGGA 1EOKA 3SO7A 2CHNA 2YA2A 4HJWA 4CVWA 2DZSA 1Q13A 3LD5A 1Z48A 2QDEA 3BVJA 3SY5A 1M7XA 2P88A 1WP6A 3IAQA 5AY7A 4AYSA 3HV9A 4MAVA 3RLHA 3HV8A 3HPXA 2XWEA 4UCFA 3S1XA 3P5ZA 4Q4MA 1TPUA 5D4YA 2HISA 2WKLA 1K9TA 1JF6A 3T4CA 2DSZA 1QWGA 5J5RA 4XD5A 3W7OA 4MWAE 3T78A 1CTNA 1RHCA 2GJNA 4X9SA 5D2YA 1QNOA 4PCFA 1J0KA 3KTCA 3A4AA 3UERA 4NZCA 1VCFA 3KOYA 1EF2A 4GUJA 4OFCA 1XYBA 1AL7A 1TWIA 2VFGA 3EBVA 3NQ8A 4P7RA 2PTXA 3UY7A 3BSHA 3AROA 1C92A 3EOEA 1CCWB 3N14A 4LV9A 3K5XA 3C3UA 1VC4A 3W29A 1DPMA 4YTUA 1TTIA 4K8HA 1AW5A 4B91A 4C7GA 3VA8A 3GR7A 4D71A 2E6AA 2AGKA 3W83A 2QZRA 3BAJA 1EDQA 3E49A 4B9ZA 3ABSA 1FWCC 1JCMP 3KDNA 2V6AA 3S3GA 2F6UA 1NDYA 1EWEA 2WSPA 4KW2A 4QAWA 3BCDA 4ENLA 2OT1A 2Z28A 4FLSA 3BLEA 3OEXA 5HJXA 2NQJA 4QXIA 1PX8A 1H1NA 3ATZA 3QVQA 2X0HA 3WLRA 1VAHA 4UTHA 1EH9A 1R2RA 4O52A 1EJXC 3DYOA 4R85A 3OB8A 2E67A 1XYFA 2WLYA 3MV11 3EA1A 1UKPA 3NXFA 4GX8A 4MZ1A 4C6BA 4GGBA 3P81A 3MSDA 5LYRA 2VOTA 5LNUA 1CENA 2WWDA 4BFAA 4H7VA 4S23A 1UASA 4IM4A 3MI6A 3BGJA 3GFXA 2UV8G 3DAQA 3ANUA 1EDTA 3A24A 3K1GA 4LTSA 3AFBA 4RDVA 3RCYA 5B7ZA 5C9XA 5KEZA 1K7EA 3H7UA 4AWTA 2FQIA 1R7AA 1QHOA 2GQ8A 3LXAA 4MKSA 1XLLA 3LN3A 3G1DA 3G3MA 2D69A 4PMXA 3MANA 1HXJA 2OZ8A 3RITA 5CPQA 1WDDA 1JPMA 3EKLA 1JZ7A 1BYBA 2VEGA 1ADOA 1HL8A 3W1PA 4EIVA 4M56A 3VX0A 4LW7A 4GIAA 2VNCA 3LPGA 2QV5A 2OLHA 5A94A 5FACA 4IIBA 4KEVA 4FF5A 1O1ZA 4H8VA 4QSHA 5AC6A 4W5UA 3PJWA 3URAA 4AD1A 3AU2A 2YL5A 3PZQA 5HNTA 3WJZA 1XQKA 1I0DA 2P8BA 4C6DA 1TZ7A 3BLDA 4PODA 2Z0IA 1D2KA 4A21A 3MDUA 4AWSA 1DWGM 1Q6DA 3UFYA 3FJNA 4LYPA 1TMLA 2H8ZA 3POCA 1KO0A 1UQZA 2BGSA 2YZ5A 2GJXB 1PTDA 3P2VA 5DN1A 1G4SA 3WIJA 4IIFA 5D2TA 5BRQA 2BHYA 3GXTA 3SRHA 3W6YA 2G3MA 4RV8A 4W8BA 5HDRA 2ZXAA 1TV4A 5K9XA 1MW2A 4LC6A 5U7SA 1QNPA 1V02E 1HJQA 1DWJM 3IGHX 1I9CB 1I2QA 3G2GA 4S3GA 3NWRA 5LIWX 2XISA 3TW6A 1S1RA 1OFQA 1H7WA 4RNJA 4REQA 3O3RA 5I03A 3GG1A 3TTSA 1CGVA 2AGTA 1A0DA 5CZJA 3QSRA 2TPSA 3P0WA 2HSAA 3SGGA 2F7FA 1RBAA 3B9AA 3CHCA 3BAWA 4MF4A 1B4EA 2ONEA 2UZ9A 1TA3B 3SQSA 3ZT5A 3RX2A 4TO8A 2A3HA 3E02A 1EC9A 2Z2BA 2QUVA 1E6PA 3C2FA 2XVGA 5AYZA 3WEZA 4QLLA 3RX3A 2GUYA 4JFVA 3N6JA 4YLWA 1YMYA 4O10A 2VFFA 4IIHA 1WXYA 3H2FA 2WCAA 4S3KA 3RPDA 1TE6A 4L4PA 4CCZA 2WJFA 4U31A 3C6CA 3HA1A 4ZB5A 3WQVA 1YTKA 4LVBA 1R6WA 3TSBA 5D8WA 3W01A 5A8NA 3PFRA 1JIBA 2GL5A 3TOPA 4CQDA 1RBLA 3H7VA 3GYCA 2Z1XA 1UR0A 3YPIA 2R6OA 3TC7A 2CC0A 5LIUX 2P8CA 1TUXA 1F2JA 2PGEA