4FA3A

Crystal structure of human 17beta-hydroxysteroid dehydrogenase type 5 in complex with (r)-1-(naphthalen-2-ylsulfonyl)piperidine-3-carboxylic acid (86)
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
317
structure length
305
Chain Sequence
QCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGIFDIVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKDIVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 3-(3,4-Dihydroisoquinolin-2(1H)-ylsulfonyl)benzoic acids; a New Class of Highly Potent and Selective Inhibitors of the Type 5 17-beta-hydroxysteroid Dehydrogenase AKR1C3
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords Aldo-keto reductase family 1 member C3
total genus 114
structure length 305
sequence length 317
ec nomenclature ec 1.1.1.112: Indanol dehydrogenase.
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 4fa3A00
2PDFA 2PDJA 2HVNA 4LAUA 3KRBA 2HVOA 4JTAA 4JIRA 3Q65A 3F7JA 4XVEA 2NVDA 1RALA 3U2CA 1GVEA 4JQ3A 4WDUA 3C3UA 4IJCA 3V0TA 2BP1A 1S1PA 5JH2A 1OG6A 2WZMA 4DBUA 4IJRA 1MRQA 2P5NA 4YS1A 2WZTA 4HBKA 1RY8A 2F38A 1YNQA 2IPGA 3MC5A 2IS7A 1MZRA 1S1RA 3N6QA 3LNMA 2HEJA 1PWLA 2ACSA 3LZ3A 3R43A 3LQGA 3UZZA 2PDBA 3ONCA 4NKCA 3LN3A 1ADSA 3M0IA 5LIKX 4PUUA 1QWKA 1XF0A 4LBSA 1IHIA 4JTDA 3GUGA 1M9HA 1ZUAX 4PRRA 4XZIA 3UZWA 1SM9A 4XO6A 1RY0A 1X96A 2IKGA 2DUZA 3LEPA 3V0SA 3CV7A 1X98A 4WEVX 4XZHA 5DANA 2FGBA 4LB4A 1LQAA 2VDGA 2FVLA 3H7UA 2C91A 4WDXA 2PF8A 3R58A 3UP8A 4WRHA 2I17A 1YNPA 3RX2A 4G5DA 1UR3M 1YE6A 2PZNA 2DUXA 3T42A 4F40A 3CASA 3H4GA 1AZ1A 4AUBA 3RX4A 4GQ0A 4DBWA 3LD5A 4JQAA 4WDWA 3WBYA 4ZFCA 4WDTA 4FAMA 1ZGDA 2ISFA 1EF3A 2ACUA 2IPWA 2QXWA 2AGTA 3GHUA 3M64A 3UFYA 4H7CA 3B3DA 1ZSXA 2PDMA 1T41A 4YVXA 1AZ2A 1K8CA 2IPJA 3G5EA 3DN5A 1FRBA 3O3RA 4OTKA 3GHSA 1PWMA 1A80A 4JQ2A 2PDYA 4PRTA 1Q5MA 2R24A 3R7MA 2PDGA 3UWEA 4WGHA 2NVCA 4LBRA 5M2FX 1US0A 3EAUA 4QBXA 3P2VA 3CAQA 1MI3A 4JQ4A 2ACRA 1C9WA 5HA7A 4Q7BA 3UG8A 1VBJA 2PDQA 3ONBA 4LB3A 1YE4A 3ERPA 3O0KA 2FZDA 3CV6A 3V36A 3GHRA 2PDLA 3FX4A 2J8TA 4YVVA 4YU1A 1EKOA 4R9OA 3UGRA 2BGQA 4HMNA 1EXBA 4XZNX 3R94A 4XVDA 2PD9A 1Z8AA 2INZA 3WG6A 4JIIX 2FZBA 2BGSA 3RX3A 3CAVA 4FA3A 3Q67A 4XK2A 1J96A 1XGDA 3R8HA 2PDIA 1LWIA 4DBSA 3H7RA 2PDXA 2HV5A 5C7HA 2ACQA 2I16A 2HE8A 3WBXA 1S2AA 4L1XA 2PDWA 4JIHA 3EB4A 4PR4A 3M4HA 4ICCX 4XAPA 2IQ0A 1R38A 3G1RA 3BCJA 1EL3A 1QRQA 3MB9A 1AH3A 4Q3MA 3V0UA 4EXAA 3WCZA 2DV0A 4GCAA 3UYIA 1AFSA 3GHTA 4ASTA 5AZ0A 4JTQA 1HQTA 2A79A 1Z9AA 4QR6A 2PFHA 4XO7A 3S3GA 4XZLX 4XZMX 4I5XA 3EB3A 1VP5A 5AZ1A 1S2CA 1XJBA 3LBOA 5LIYX 5LIWX 1ZQ5A 3FJNA 5KETA 4PUWA 3R8GA 4L1WA 3CMFA 4RPQA 1AH4A 3QKZA 3D3FA 3BURA 3VXGA 3LENA 4GACA 1HW6A 5LIUX 2IKHA 1Z3NA 4H8NA 2IPFA 4JTRA 4FZIA 4JTCA 2FZ8A 1PZ1A 4EXBA 4GA8A 4GIEA 3NTYA 4LAZA 3COTA 4GQGA 2PDHA 3V35A 4IGSA 3LZ5A 2PDPA 2PD5A 2PDCA 4PMJA 4FALA 5HNTA 4QX4A 2INEA 2PDUA 4GABA 3LQLA 4QXIA 1PZ0A 1PYFA 5JH1A 2ALRA 5HNUA 2IKJA 3N2TA 2HDJA 2IQDA 1Q13A 2IKIA 1AH0A 2HE5A 3WBWA 3LUTA 3BUVA 2F2KA 5LIXX 3UZXA 3R6IA 4JQ1A 1IEIA 2R9RA 4YVPA 4MHBA 3BV7A 1JEZA 1T40A 2FZ9A 3UZYA 1Z89A 3DOPA 1X97A 2PEVA 2CLPA 4DZ5A 2PDNA 2PDKA
chains in the Genus database with same CATH superfamily
2FKPA 3VI2A 2HVNA 5ABFB 1H41A 4P7OA 5BOFA 3Q65A 4R3UA 3IEBA 3TTOA 4BS0A 4ENLA 4KCWA 3U7VA 4AZBA 3R1ZA 4A21A 3F4WA 3EX6A 2DSUA 2WZMA 1TV5A 4HT3A 4C1LA 2D3NA 3KVJA 3B0XA 3WNNA 2R6OA 4RNHA 2FHBA 5JVLA 1G9HA 2ZRXA 1DWIM 3OLIA 2HISA 3VDHA 2ISVA 1TPC1 3UG4A 4NZ3A 3IUDA 5J5RA 1Y8BA 1NOWA 1XW8A 4WXZA 1Q6GA 5IFPA 4AU0A 1SW0A 2X1RA 1W1A1 1QVBA 2VR4A 3TMQA 2HQAA 4AMAA 4PL2A 2IKGA 2X41A 4QAIA 5DO8A 3LEPA 3KFTA 3NUKA 2PGRA 3SCSA 1JRBA 2NXIA 3OO2A 1P6CA 4IFKB 2O7SA 2GQAA 2WOQA 1ENUA 3W24A 3I10A 2QNEA 4OBSA 2ZX7A 3IVUA 1VKFA 5EMMA 4CEUC 1KM5A 3WYZA 4YCOA 1VQTA 3RIKA 3UGVA 2EKCA 3D46A 1XXXA 4L80A 1R7OA 2V5JA 4KWOA 3TQPA 1G4EA 3NGFA 1FKXA 1MNSA 4S3AA 3RX2A 1GYLA 3O16A 1FWAC 1UR3M 1CNVA 3VNLA 2OCZA 3T55A 1VD6A 3AS2A 4U2ZA 2R14A 1OK6A 1H5VA 4XIMA 2BHZA 3TYCA 4O4WA 4W8AA 3PNUA 5CLTA 3QYQA 1E3XA 2BGNE 5LNRA 4QLJA 3PF3A 3R10A 4JFWA 1E0VA 3RPDA 1QFEA 3CPGA 3W7DA 3P8IA 2X8RA 1NWTA 2I1OA 4K8EA 4ZO7A 1VGAA 3ZR5A 3VNDA 1I2PA 1AD1A 4XAGA 2NSOA 3W3OA 4KCVA 2WM1A 4B5VA 3AYRA 2YGYA 4FO4A 4U28A 5HINA 7TIMA 3SQLA 2KZHA 3SCOA 3CZJA 1F61A 3RCYA 1W1ZA 3UERA 3GG0A 2PWGA 4JEJA 3HA1A 1TA3B 4ERIA 1B3WA 1GQLA 4DWSB 1UROA 3AMKA 1EO7A 5AHFA 3ZWSA 1LORA 4O16A 3PPFA 4U5IA 1FHDA 2CZFA 2D73A 3IJ6A 3CBWA 1UD4A 2E0PA 1H7XA 1E1CA 2FZDA 3TLQA 3GYEA 3AIQA 3EMQA 3INPA 3FSUA 1JGIA 1X6NA 1XPGA 3WG6A 3B8SA 1BD0A 4BWLC 1UR2A 1B3XA 2A6LA 3VKBA 1JYXA 1J96A 1VCGA 3DBPA 1PL9A 2P0IA 3NPVA 2RFGA 3WJXA 2FVMA 1EYWA 1O1ZA 3M0HA 3CQKA 2ZDSA 4NAEA 1PHWA 1KGXA 5M1TA 3QW4B 6A3HA 1CLXA 4NNCA 1EJWC 2H3DA 4H6QA 3RR4A 2JF6A 3BANA 2WXDM 4IF2A 1GOKA 3A6OA 1EPVA 2D2HA 4PMXA 2RDTA 3BZGA 2EGZA 1HZYA 5LYRA 2NQHA 2GJXB 3JRKA 1OFOA 5FCZA 3W25A 3C8NA 3PZMA 3Q37A 2AL2A 3AS1A 2ZC1A 3GK0A 5E0FA 1W3LA 2DQXA 2YSWA 4I5XA 1EUNA 4ALDA 5AZ1A 4LTSA 4IIFA 4HZMA 5FAGA 4DZAA 5T91A 4KCUA 1B9ZA 3D3FA 2QJHA 4B3KA 4HNCA 3DYMA 1U1UA 2I9EA 1UBSA 3K4AA 2IKHA 2YZRA 4EF8A 3B0PA 3VFLA 3I7SA 2XH0A 2IPFA 5EBUA 1PB0A 1ZTVA 2WVVB 2X30A 1F4AA 2PGWA 4AC7C 3VZYA 4OZOA 1DL3A 3FHQA 3S1XA 4U33A 3FY1A 3W2NA 4PMZA 2QCNA 2DT2A 1I2OA 5HNTA 1NARA 2A6NA 5CZJA 1OJXA 2CC0A 2PDUA 2CYGA 3M5ZA 2YB1A 4TIMA 2DFAA 4REQA 2P3ZA 2WJEA 3M6YA 5JH1A 1XFCA 2VC7A 4K3ZA 4FB7A 3FKRA 2C71A 5J04A 5ECVA 3ZT7A 1H7PA 3NVTA 4IMCA 4YNGA 2QS8A 5BNKA 3A13A 3WL0A 3PHAA 3M7WA 2A7PA 4B15A 1WXJA 3DOPA 2YXGA 3OOQA 3SADA 4EF9A 1K4HA 1Y5XA 2F6UA 4BI6A 2GVEA 3BLKA 9CGTA 4PMVA 3EA1A 2Z2UA 3BL3A 1MW1A 4DJED 1S5NA 1QNRA 4F0MA 4HPGA 3RU6A 4AZHA 2W63A 2E6FA 4L61A 1W2VA 3N11A 2GFTA 3SM0A 1YBQA 3C86A 4GVFA 1H3GA 1J10A 1PBGA 3WH5A 3PP7A 1EP1A 1YLVA 3R0UA 1FA2A 3HGJA 2G8ZA 3N25A 1XIMA 1EEPA 4KF1A 5JMUA 1LF1A 3KW3A 4PMQA 1R7AA 3GR4A 4WQ6A 3S6DA 3VO0A 1M6JA 4PB3A 3WF0A 3E49A 3MPGA 2XFYA 1J2BA 2DU2A 4ZOBA 3L67A 3GLCA 4ONVA 4H41A 3TX9A 4QCFA 1GWJA 2WM0A 3UZZA 3CQHA 4NXKA 2E6DA 4J9JA 4HJFA 1HJVA 4B9YA 4LOCA 1D8CA 3ITCA 5TAOA 5DX7A 3KCLA 1I0DA 3AHZA 1GHSA 2OGJA 3P93A 3T2QA 2D22A 4G1NA 3CB3A 1XBXA 5F4SA 4KQNA 1C91A 5CPTA 4ZCWA 3P0XA 2GOKA 3VNMA 4M8UA 5AVHA 5MKGA 3DKJA 3EZ4A 4S2BA 1OGBA 3GM8A 4GNKB 4O57A 3PZUA 4PMYA 3VM5A 4Y90A 4NRSA 4Q8OA 1OSEA 3L4XA 1XL9A 1B3YA 2VDGA 3M5XA 1PKYA 2C91A 3RG6A 1Y7VA 3IVSA 2QMKA 4ZZ9A 1GQNA 2ABBA 3AAMA 5FSDC 1WV2A 2WSYA 5F4XA 3T09A 3E02A 2V5KA 5FJRA 5AN7A 1KFEA 4PFHA 1OYBA 5FOOA 2GJRA 1IT0A 3ABOA 3BW2A 2VC6A 3CASA 2YXOA 4W87A 2Y8VA 4AUBA 4Q4SA 4DBWA 2OWCA 4Z0JA 3BMWA 1UUOA 2Z26A 2A4AA 2JIWA 2YCJA 4PCTA 1V3LA 5CC7A 2QJGA 1QOPA 4PBGA 3WJZA 3DIPA 2NVAA 1EF3A 4L7ZA 1G4PA 3FHAA 3RJYA 1IIHA 1WDWA 4TV6A 1HO1A 3RR1A 1PEZA 2W91A 4ACYA 4ZTXA 5FF7A 4YVXA 4L4LA 5GVJA 3WF4A 1M7OA 3O3RA 2WMIA 4TX9A 4W4QA 3NDZA 2QPSA 1CGYA 1EGMA 3NQ8A 3RRAA 2JEQA 1UC4A 1LLZA 4DO7A 2WNNA 2PWHA 5D9NA 3OW1A 4AY8A 3G0XA 4LUTB 1PO9A 3IK2A 3T0AA 3BV4A 2XIQA 4UIOA 3RM4A 3LBMA 4TOQA 1OFEA 4LANA 3AHYA 3POHA 1FFQA 1JFXA 1OK4A 4UTJA 3TTQA 4KRZA 2FZMA 2V6AA 4AWEA 4JZ5A 2VJXA 3VMOA 5HA7A 4HQVA 2PCEA 1RP8A 3T7VA 3ONBA 1CECA 4LB3A 5T8GA 1JCJA 1JNDA 3W1MA 1GHRA 3N2MA 2XM2A 3CU2A 3DFNA 1PKMA 2OTDA 3VGDA 3E1F1 4BQ3A 2GQ3A 3H2NA 2DZSA 4HMNA 1VLWA 2HS6A 5TF0A 2WJDA 3T81A 5I3FA 4GQRA 2V38A 3HO8A 4CVWA 3M16A 3W7CA 4NYUA 1JD9A 5HMEA 3AJ7A 3WH8A 4CU6A 2PWDA 1DJXA 5EY5A 5DT7A 3WBXA 4AHOA 4JYEA 3SO7A 4C6NA 4IX0A 4FXSA 4LYKA 4H83A 3W82A 3KTCA 1DKWA 1EL3A 4J2PA 2CBVA 4Q3MA 1L0PA 4IL0A 3EEGA 4MVAA 3ITXA 3W7NA 5JBFA 2NXGA 3S47A 1M01A 3SFKA 4M6PA 5BCAA 1CX9A 1C7SA 2BXYA 1R86A 2QJNA 4H8UA 1W3IA 2VDHA 2CBUA 4MNLA 3FGCB 2GSHA 4RXFA 4U3CA 3PWIA 3LK6A 1YTKA 1ZQ5A 2VKZG 4H8HA 3W6YA 1AQHA 1LT7A 1WAUA 3LGEA 4UCFA 5IDZA 1MEWA 4GYPC 2EF9A 1WA3A 3DERA 4BR1A 3H7VA 4QM1A 4NZFA 1AA1B 4B16A 2QJMA 1NDVA 4F9DA 2WMGA 4IUOA 2GQ8A 1TUXA 3HGSA 4H8NA 3IJLA 1UH3A 1HKJA 1E6ZA 2ZXAA 3T0TA 2VL4A 5IDIA 2FJKA 5IHSA 1YDNA 1XP3A 4DJFD 1OZQA 3G2GA 3HQPA 2Y61A 4J3ZA 3VOIA 4JHMA 3LPOA 2VFGA 2A3LA 1FCQA 4IMFA 3MO7A 2VGFA 4HYWA 3VKKA 3BXWA 1O94A 3U4AA 3SCTA 3E0VA 1UD2A 3PTQA 3HG5A 3C6CA 2IKJA 1J5SA 3AQUA 3KRUA 1DQXA 4IFKA 1NWRA 3OODA 3RK8A 3WFZA 2VP8A 3DI1A 4OGZA 2A85A 4UTTC 3WMBA 1ZLPA 3C0LA 2WQDA 4ORMA 4GI9A 2OJPA 1H4PA 3GVRA 3FVMA 3G1VA 4JTJA 1KW1A 3W7RA 4AZCB 3APTA 2D0FA 1JEZA 1G5AA 1D7KA 3ZO9A 1B57A 4HK7A 3LV5A 1V0MA 4UOZA 3LCXA 5D9PA 4HYRA 1EJTC 1XLGA 1BWKA 1US2A 4Y9PA 6TIMA 2ZUNA 3VIKA 3KRBA 1SZEA 3G8RA 3M0JA 2P1FA 3WENA 3TCSA 5BXPA 4Y8EA 4IJCA 4BI5A 3C2VA 4O1CA 1W3HA 4RNIA 2C0AA 4HA4A 5A5WA 4PMNA 3LI0A 2EBNA 3V18A 4F0LA 3APYA 3MI6A 3DI0A 1NOFA 2Q8XA 3CGTA 3MC5A 5A8GA 2ACSA 3SN1A 5F2LA 5EMJA 1V93A 3PSWA 1FWEC 2WC4A 1AQ0A 4B5WA 1FWFC 1OFQA 2J62A 1PTGA 1YRRA 3THCA 3EWZA 3QBUA 1GVFA 1PKLA 4JAWA 3A9BA 3S42A 5I2UA 4R33A 5FAJA 2CCRA 4KIRA 1J11A 4LNCA 3DC8A 2EJAA 3VU2A 4RJEA 1UR9A 1KBKA 3DU0A 4KFOA 2OLAA 1LQ0A 3GAKA 1JZ6A 1UMLA 3H24A 2EHHA 3L4YA 3PPHA 1HL9A 2FGBA 4DUXA 4V15A 2FZNA 1MO0A 4CD7A 1F9CA 3G3DA 2GUYA 2FFIA 2XZ7A 1ZPTA 4PMOA 3GXTA 1H61A 1BKHA 3WK2A 3H2EA 3GTNA 1B9BA 2H3BA 4H19A 3ES7A 2W6RA 3SW6A 3VNIA 3W2JA 3CL7A 1Q6QA 3IGXA 3U9IA 2FPYA 1FWNA 2CKSA 2OQLA 3O6DA 5ABGA 4AY1A 3RLVA 3UWVA 4O14A 4S3FA 2XH2A 1JDAA 3H4GA 5HWMA 2HWGA 1AL8A 4KW2A 2QAFA 1DJQA 4W7UA 2Z6JA 2P50A 4LQ1A 5FJIA 2Y6ZA 2V67A 1A5KC 4JFUA 1ZGDA 3CHFA 4DAFA 1MQRA 3QOMA 1X8CA 3VNYA 4IFOA 3A21A 4QJ4B 5FACA 1EC8A 3A3WA 2Z1XA 1RQHA 3FA3A 3HV9A 3B9OA 3S2MA 1JYNA 3W7PA 1X7IA 4WXYA 1A80A 1DWHM 3FJ6A 1J0YA 3C52A 2PDGA 3SZ8A 3C61A 3I3DA 2QUNA 3DHFA 4XUGA 3QOKA 4JCLA 1KC7A 3GDKA 3PNZA 4IGHA 4XSLA 4QBXA 4HPXA 3THDA 4O1FA 4JQ4A 1HO4A 1QI4A 1ZRQA 3QGKC 4Q4PA 5FSEC 1O12A 1MDLA 1PHQA 1F7BA 3V36A 1P1XA 3N12A 2XIIA 1ESWA 4HA0A 3LS9A 3SECA 5FESA 1V6XA 3EOLA 4ZQPA 3NQMA 4PSPA 2QVHA 2PSNA 2J4GA 4S3GA 4DIAA 2V3EA 4XK2A 3FFSA 2DSZA 3STEA 4HGXA 2O7QA 2GJPA 1TQXA 2P0OA 3N2BA 2PWUA 4UTUA 3EEZA 3GU2A 3N17A 3F4CA 3HMJG 3WF3A 3ZJ7A 1R30A 2RUSA 5HUPA 1XC6A 3BWWA 2JKEA 1QTWA 2Z27A 3AXMA 2FB2A 2XIOA 4QJ5B 4IOTA 1NDYA 4C7GA 3PG9A 4FXFA 1OGSA 2FDMA 2V3DA 3EDEA 1XH1A 3UCDA 3NG3A 2VFDA 3EYPA 1Z9AA 1NSJA 4QR6A 3B06A 5F2IA 1AW1A 4YJ5A 1UIOA 3B8TA 4KT2A 1WOAA 2AKMA 2E28A 4XB3A 6REQA 3HJZA 4NJKA 3AFBA 2CXGA 3TUUA 1KFCA 1E9IA 3HB9A 3DH7A 1HJXA 1XPYA 4L1WA 1HJUA 4IX2A 3QKZA 3IAPA 4PEKA 1GOQA 1IEVA 4QNWA 2C13A 4A29A 5LIUX 2OLSA 2QUTA 2WCSA 4MNMA 4DO4A 4DN1A 5K9XA 1F3WA 4JTCA 2FZ8A 4FMVA 8TIMA 4MWAB 1EOKA 3DAQA 1FCVA 4UXDA 3MUCA 4HK6A 4PTNA 1ZB5A 3MP3A 2OT0A 3ZJ6A 3KXQA 3QC0A 2DP3A 1VFLA 4MFEA 4NF7A 3ANVA 3B9AA 1BG9A 2XHYA 3G0SA 4AG0A 3G1AA 4LUSA 2YCEA 1AD4A 1EC9A 4CNUA 2ALRA 1RK5A 4S2CA 1QO5A 4IWWA 5DY2A 3N3TA 3WSUA 5BWFA 3VKJA 4XD4A 3UYCA 3WEOA 1LG2A 4AIEA 1K6WA 4H3DA 3ZT5A 3SY5A 1MUMA 2BOFX 3H12A 1OF6A 1Q6EA 1RUSA 3DCPA 3S5YA 2XIBA 5AECA 4F2BA 2XN1A 3PTDA 1RV8A 3K4DA 1N82A 2ISSA 5E0KA 3MKVA 5FF4A 3O05A 1E1CB 1YDOA 2O92A 1X97A 3CZKA 3W7JA 2QMJA 2ZUUA 9RUBA 3MZNA 1SFJA 4Q6XA 1IV8A 3VGEA 3N34A 4M3PA 1DHPA 1SQ7A 2BVDA 3HU7A 2YCKX 3LPGA 3S8HA 3POCA 3IVTA 4LW7A 4D6EA 2CXEA 3EPMA 5GJNA 4DNHA 1GK8A 3OIHA 4XBSA 1AQFA 3CS2A 2BP1A 5I06A 5CBBA 2VFHA 4FF5A 3UU0A 1UWTA 5D30A 3P61A 3W7QA 2Y8UA 3QRHA 3O7UA 3WDPP 4HBKA 1VPYA 4RDYA 1OG0A 2E8ZA 1MZRA 1TYGA 3UVIA 3B0UX 1O68A 4KIEA 2VGBA 3H22A 4HU3A 5U4NA 3O2LA 1M65A 2GLKA 3J7HA 5U7SA 4HP5A 1CXEA 2PB1A 1TIWA 4DRSA 4N4PA 2Y0FA 2AL2B 1G1YA 4WSKA 5I77A 3CMGA 1W1VA 1XBVA 3LGDA 3MJMA 3CV7A 3M0XA 4FX7A 4AD5A 3MVTA 2VEPA 3I6TA 2G4FA 4WEVX 3CIWA 3F2DA 2J79A 3P6LA 4HN8A 3SUUA 5HULA 4LAOA 3ZVHA 1MZHA 3H7UA 1FHUA 2WO5A 2YDAA 4O17A 3B03A 2PP3A 1XD0A 4B5NA 5HMDA 3QF0A 3LSCA 3N9KA 3BE7A 3W7OA 4MY1A 3AICA 3RDKA 1R2SA 1E56A 1E4LA 4LPCA 3NSMA 4MJZA 3QFWA 3T42A 3KVLA 1R3VA 2E9BA 3WL1A 1W0MA 5AKQA 5CPMA 1A50A 5CAKA 2IMRA 1VHNA 2QLYA 1CGTA 3UJEA 4EACA 4WDWA 3UJSA 1Q2SA 3T07A 1W91A 3UXAA 2BVYA 5AC7A 1QBAA 4C6DA 2OEJA 3B8VA 1Y5VA 3PY2A 4GX9A 3B3DA 4ECLA 3TQVA 2QGHA 3NQEA 2G97A 4MB4A 4XQ6A 2YB4A 1UZDA 4HNNA 4UMBA 3FYPA 5FJPA 5CC6A 1IEWA 1Q5MA 2R1LA 2G96A 1GORA 2BWGA 1CXLA 3PJWA 3KZPA 3UXIA 2ZFAA 5LHEA 1H5YA 1IEXA 4UQBA 3WDJA 3LRLA 3MWCA 4XG1A 1J18A 1GCYA 2V2HA 1OCNA 1O4UA 2ATSA 2J8GA 4C1NA 5BMXA 4LS0A 5FEPA 3ABXA 3HMCA 4WVXA 3MMDA 4Q4RA 2WHJA 4AD3A 4J3WA 1OD0A 4L6OA 1QPNA 3WUGA 1ITXA 3FNDA 1Q3NA 1XINA 3QLLA 1ZJIA 3GHRA 2WMFA 4JTTA 3WMLA 3DESA 3FJ4A 5CSYA 5D2VA 1MQPA 3VDCA 4GYKA 3B4YA 2D3LA 1GYNA 4IMAA 3DFHA 3TE9A 4UCGA 4HOZA 3GDBA 3E0WA 4A35A 4F9JA 1JI1A 2J27A 1H0IA 3R0KA 1MSSA 1T8QA 4RNFA 4GWEA 1YDYA 1VRDA 5C7HA 1M41A 4PUEA 3M0ZA 2WYSA 5DN1A 3CT2A 1WB0A 2ODOA 2VYOA 4L1XA 2EKGA 4LX4A 3JVAA 5I07A 4PCNA 3SGZA 5HDRA 5SWUA 4H04A 1E51A 1E0XA 1EJVC 2R1KA 4AB4A 1YYAA 1WZMA 3FEMA 2DY3A 5HAOA 3AXIA 5AZ0A 4A2SA 3S5ZA 3OHIA 1OC6A 2XIMA 3OG3A 2FQIA 3AHVA 3TK7A 3W07A 3UWQA 2EG8A 4AH7A 4KGLA 1TMHA 1TWSA 3CH9A 1V51A 4W86A 5JU6A 3DFTA 4L9XA 4Z2GA 4QS5A 5DMMA 1P0BA 2VFFA 1UG6A 3LOTA 1NY1A 3OGVA 2ASHA 2GWNA 4P8UA 4DJFA 3HJEA 1KKRA 3U3HA 4F48A 3XINA 1QW7A 4H9TA 1FH8A 4FLSA 1JD7A 5B7ZA 1VC4A 1G69A 1WUFA 1A5BA 1R9ZA 2A2IA 1XDJA 1K70A 3PBGA 4JDBA 3C0JA 5C71A 1MEIA 2EPOA 3LYEA 4O12A 3SRFA 1W56A 1L6YA 1WO2A 1WYIA 3B8DA 1GYMA 3WMCA 3F1QA 4OWGA 3W1NA 3M41A 4DUVA 4AQLA 1W32A 4QNEA 1QK0A 4LC8A 1PSCA 4LV9A 2BNJA 2DVUA 4PH6A 1IGWA 1PX3A 3CT7A 2NT0A 1L8NA 4NJGA 2A7RA 4W8BA 3OZPA 2J75A 3L65A 1E6NA 1K9DA 4GLEA 3QVQA 4NI8A 3MY9A 1U5JA 4ZO9A 3L4WA 9XIAA 4PL1A 1SJCA 4QQ3A 2DSKA 5LIXX 6CGTA 3LHYA 1JCLA 2XIJA 1Q8JA 1EH9A 2DZPA 4XX6A 1DXFA 1H1NA 3UZYA 3ES8A 3IIVA 1GEQA 3CV1A 1SSGA 2YCIX 1QHOA 4LWWA 2YR1A 1DE6A 4HMDA 3KL3A 1FFRA 3ID7A 4US5D 3U57A 1LP6A 2O4QA 2BVWA 1FWRA 4LAUA 1BQCA 3UR8A 1SVDA 2FHFA 4IL2A 5DFAA 1SMAA 1KM1A 3KZSA 4XVEA 3GFZA 2RDWA 3N29A 4L5ZA 4OBRA 3B9NA 4NHVA 4LY8A 4G56A 2VEIA 2VC5A 3C3NA 1C90A 1MRQA 4I9JA 2WZTA 3NZ1A 1P0NA 1ZBWA 4NL1A 4YTSA 4Y9AA 2Q3RA 3NJ3A 4AD0A 4MYXA 3LNMA 2ZQ0A 3IK4A 1HGYA 1LOSA 1PIFA 3ONCA 1ADSA 5HATA 1XIHA 2CFFA 1H1ZA 4HNLA 2BZNA 1UP3A 3WN6A 2ZOXA 2O0TA 4OU1A 5F2MA 4PSRA 1KRAC 2A5HA 1LUCA 1I60A 5T9BG 2WMJA 2VGGA 3M0YA 3RRXA 2VR2A 2Q09A 1OVDA 1MXDA 2NQ9A 3E0FA 1S38A 3UWYA 3C2OA 2E40A 1CENA 4C91A 4O0QA 2VEKA 4DBEA 3DHUA 5ECUA 5G1MA 4UTFA 3VX0A 2FMOA 1C92A 4YYCA 1HKWA 2NQ5A 4C1NB 4JNMA 4LVAA 4AD2A 3R2GA 3JZEA 1FOBA 3ARXA 5HPCA 3NQFA 3MYOA 3M9YA 4DXXA 1H7RA 3AHXA 3KVKA 4G7EB 1EX1A 1LL7A 3BVJA 4DWSA 1VB9A 3PN8A 1EHNA 4FNQA 3RPTA 1HT6A 4W85A 3T4WA 3F2CA 2DT1A 4MB5A 3VIPA 1WKYA 2ESCA 1KRBC 1DTNA 4MNKA 4CNPA 1HFBA 4GUIA 3TONA 4GC4A 4TXEA 1XKYA 2BOGX 4RZ4A 3N73A 3UJFA 3AIBA 1DJNA 5HR7A 4LRTA 4H2CA 1XWYA 3QHOA 1QK2A 4I8DA 3TJ4A 1K7FA 1BYCA 4B5SA 4M1RA 4M6VA 3S2NA 4JQ2A 5CZTA 3MDWA 3H2FA 4HN4A 3A3XA 7PTDA 3WDHA 1O5QA 2FGLA 2NVCA 2D2OA 4FNRA 4HKPA 1W9UA 1XCXA 3WLTA 4XUYA 1PE1A 4HOXA 5DCEA 5A6KA 1FWBC 1KA9F 3WLKX 3BQ6A 1WZKA 5CCZA 3A5VA 4WR3A 5H1WA 1ITQA 2DT3A 1QJWA 4PGLA 1JUKA 2WMIB 3ZR4A 4Q7BA 5D04C 5CSSA 1RK6A 5AFDA 5C0QA 1U33A 2WCAA 2TMDA 4JN8A 2ICSA 3TLLA 2L5HA 3KL5A 5A95A 4UFHA 3L2IA 2J7EA 4PBEA 1IT8A 4M6QA 1ADDA 3N19B 4Q7NA 4RNJA 3NDOA 2PD9A 4M19A 4LH8A 4CEXC 3QY8A 1QPKA 4JIIX 1XQLA 3VZXA 3W37A 4D8ZA 1XM3A 5DXYA 3RX3A 5AHNA 3WQ6A 4AIUA 2Y88A 1OEPA 2ZRWA 2D20A 5BRQA 3GKFA 4EK7A 2OG9A 3KM8A 1RVGA 1XICA 4JL2A 3WEMA 3VNZA 2VFEA 4NIRA 4HSNA 4LC6A 2DH3A 2FTWA 2ZVIA 4S3CA 2VX7A 1EGVA 3TOYA 2G3FA 4KERA 2V8ZA 4XZ9A 4D1IA 3QPZA 4UFJA 4J27A 3UWZA 1BXBA 2J6VA 3UR2A 2WKJA 1JZ4A 3PB2A 4XIAA 1UJQA 3CHVA 4GCXA 2D23A 3AI0A 4TQTA 4EWJA 5AYBA 4LUJA 1LJYA 4BA0A 3OVGA 2ZXBA 2RH9A 1J12A 2PE4A 3UEQA 2AL1A 4JX6A 3BLDA 3SCQA 3U7BA 4CCDA 2WKGA 4REQB 3K46A 3C8FA 4AXKA 1J2WA 1SR9A 2H90A 3BMVA 3AMDA 3CMFA 4FX6M 4OECA 1XSJA 1QW8A 5H2ZA 3AZSA 3B9DA 4X2RA 2XN0A 4GJIA 3H21A 1TJRA 1TJ1A 4GACA 4ZL1A 1W3TA 3GW0A 4R85A 3KLKA 1JQVA 1FWJC 1SZFA 1GQIA 2AQVA 2I9UA 2XWDA 1JDFA 5CZ0A 4JX5A 1O95A 3NYDA 4W8LA 1PX4A 3HPXA 3BAIA 1R2RA 2G37A 5LGXA 3GFYA 1HKIA 3B05A 3C56A 2PDHA 4X0NA 3W6MA 5D9OA 4LYRA 4RUBA 3EMZA 2GSEA 2J7CA 1BKSA 2INEA 1K8XA 1L2UA 1UKQA 3VIIA 2GDUA 1TPWA 5XINA 3MMUA 3PZQA 5CBJA 1WAWA 1CB2A 1MMFA 1XGZA 4UTKA 4Q6JA 4LVFA 4QG9A 4HSHA 5HNUA 1JFHA 3O06A 4HZ6A 2IQDA 3ARYA 1S2TA 1TUFA 2AKZA 3PAOA 5BMWA 5G4HC 1O5KA 3W2LA 2HE5A 4JD4A 4S1FA 3WBWA 4G7EA 3QN3A 3ZVHB 1KBIA 3S9IA 4KRTA 3OTRA 1EJ7L 1YXCA 3CL6A 2EG6A 4O0ZA 5GNZA 2FTPA 2NLYA 1M53A 3LHVA 1K02A 1MXGA 3LV6A 3E0IA 4EPDC 4WK9A 3WK1A 1TV3A 4EPBC 4ZE4A 3WLLA 3UPWA 3ALFA 7XIMA 1DIDA 2Y5JA 1XYMA 6PTDA 1X1NA 2DSVA 1A0EA 3NA8A 1JZ8A 3ARUA 2HNEA 1M7JA 1T7LA 2J7GA 3K30A 4JIQA 3HG4A 4KWUA 3U0HA 1HXJA 3NOYA 3BAKA 3WD0A 3ENLA 3TOPA 4URIA 2BLEA 4W84A 4Z1AA 1ITCA 5LZLA 1R85A 3UG3A 4K1WA 2Y63A 3HPAA 2PBOA 1GQJA 5EFDA 3XISA 1TPVA 1OG6A 2CITA 4ZFMA 1XYBA 2ZZ5A 2ZVRA 1Z69A 1CGVA 1BAGA 1ISVA 2Z1SA 1JIBA 4YS1A 1S3HA 4V28A 2CZDA 3IV3A 3PVFA 1REQA 4DNMA 4LCSA 1YNQA 3FGCA 3N6QA 1ZL1A 2QCGA 4O8AA 1NIUA 3T9PA 5LXEA 4X9SA 3TA6A 2WLZA 1I1WA 4PEEA 3TV8A 4C6LA 1XF0A 2XZ9A 2G50A 4JTDA 3JR2A 2XU2A 2OVLA 4IQLA 3GUGA 3BOLA 3EX4A 3HOJA 3PZOA 5GPRA 2JFEX 4XO6A 1X96A 3P60A 3KHJA 4E3TA 4GYPA 1AVAA 4JX4A 1J93A 3KBSA 4AWTA 3CC1A 4CKQA 5I09A 4DJDD 1E43A 2Z2BA 2Z7GA 1J6OA 3LMYA 2ZE0A 1RH9A 4UTWC 3KL0A 3BW3A 3FA5A 1WDQA 1B5TA 1GPWA 2Y5EA 2DZTA 1OADA 3LLFA 3LTYA 1OYAA 1UD3A 1PXGA 2JBMA 3C4UA 1Q6DA 3BJTA 1JCNA 4Q4OA 2F84A 2J7FA 1PDZA 2D2JA 2QCCA 2CWNA 3SRDA 4ES4A 1G67A 2XVNA 3S1WA 4OJYA 1UYQA 4JTEA 4O1EA 3IJDA 2GGJA 1Z41A 4KESA 2UY4A 3SGUA 2YX0A 5DEZA 1TO3A 3CQJA 1AL7A 5IRPA 3S83A 1K6AA 1GVRA 4MDOA 2YA2A 3UW6A 2OZTA 1QW9A 1PWMA 1E1EA 5CLWA 4H9XA 4RKAA 2C3ZA 4UFMA 2OX4A 2V5CA 1WKEA 4PRTA 4LUTA 2ISWA 5DCDA 3G1FA 5LHFA 4LUYA 3L4UA 3AUOA 4IPPA 3P8JA 2GGGA 2VX6A 4IQJA 3GD6A 3M07A 2NV2A 3T8QA 2ZWZA 5BXSA 1SR0A 4MSSA 2ZRVA 2D0HA 1SO4A 4IJBA 4A3UA 2E1DA 1E1FA 4NT0A 3ATYA 5HUOA 4WIWA 3N4AA 1UWRA 3TP4A 3GX9A 1XLMA 1FCBA 2OWXA 1DVJA 2HNHA 3TZNA 2BY1A 5G2HA 3F5KA 4AHQA 3VPLA 2E9LA 2FH6A 3MUAA 1MW3A 3QMSA 3KOWA 4YU1A 1VHCA 4TX8A 1XLLA 1GPFA 3LNPA 1TB3A 2P88A 4OUIA 4LRSA 4K2SA 3I3EA 2FPVA 4I5RA 3NFUA 1SW3A 3U2OA 4AVOA 1T96A 1QO2A 3CTLA 2OYMA 3WLOA 1M3UA 3R8HA 1A5SA 2Q71A 3AISA 1E9LA 1K03A 3S2JA 1K9TA 3EB4A 3FIGA 1E71M 2HBXA 2IQ0A 1C8YA 2PWFA 2WKLA 1E5JA 3BTNA 1A3WA 4DBDA 4QAWA 3TQKA 2X0SA 2ZIDA 1SO5A 3BGAA 1FP8A 3EOUA 4OOUA 1HVQA 1C8XA 1XLFA 3M0LA 4R7JA 4M56A 3QR0A 3WMSA 3P5YA 3H2OA 3VD5A 5JBEA 4B4FA 4LEFA 2VXNA 1W8SA 2CEQA 1JCXA 4UBPC 3BLFA 4Q8PA 5K3VA 3BURA 3AU6A 1KM2A 2EAWA 4GNJA 1HJSA 3WF1A 3VD3A 4HSOA 3NM1A 1J5TA 4AX6A 3SCVA 1MVYA 4NAFB 1J01A 3BLIA 1FWHC 4NAFA 4Q4MA 3VIJA 5L6UA 4CD8A 3NTYA 1XDMA 4JTKA 3CXOA 4LAZA 4RE2A 3TW7A 3UWWA 1L6FA 3YPIA 3CJPA 1V77A 3NM3A 1J8VA 1EQCA 2NV1A 2XH7A 4UR7A 4UWMA 3L68A 4X63A 1SMDA 4WSJA 3QV6A 2I5IA 1F5ZA 1Z7AA 4GABA 3LB0A 3AYVA 1PZ0A 4QXIA 4ZEPA 2PBGA 1XLJA 4IPJA 1VCVA 3LM7A 5BWAA 1OC7A 1REQB 4PMDA 3SI9A 3EOEA 2WV8A 4O53A 1Q13A 3TR2A 1AH0A 4ZA0A 3W22A 4DZHA 3BARA 1U1JA 3LUTA 4J3TA 3FS2A 1FCUA 2REQB 1R3TA 4UMCA 2VURA 4TX6A 2ZZ2A 3I6EA 4JR5A 1BSIA 1B4KA 3D0CA 3VD7A 4R27A 3SAZA 4RCXA 2PEVA 3LXCA 4DZ5A 4Z2IA 4UNLA 1EJRC 2YL5A 1SU5A 3AIEA 1RAKA 3AROA 1IWPA 1OABA 1L6GA 1GGOA 1DHKA 2NWRA 4BF7A 2YPIA 4H2HA 2NVDA 3CO4A 2HBVA 1JXKA 3VINA 1KTNA 2RKXA 3CMJA 4E2VA 5I78A 4E3VA 2Y8KA 4GRSA 3WH6A 1E40A 3K4WA 5EKYA 2VCBA 4RW5A 2XVGA 4X22A 1LLOA 3HURA 1VRXA 2CNCA 4UR9A 3RITA 1XQKA 4J35A 1NDWA 4WD0A 5FEXA 3EDDA 1QNQA 1E6QM 4PCFA 4S3KA 1MNZA 1RLCL 5HMSA 4R88A 4QDPA 2PLMA 1CCWB 5KITA 3QTPA 1EJXC 3IUIA 1RD5A 4H7ZA 4LVGA 1IIGA 2VFIA 3Q45A 4D8LA 3S2CA 1VFFA 3EBVA 5HOSA 3H55A 3NR0A 5AYYA 4GI6A 2C1HA 3T2PA 2FJUB 4PRRA 4ACZB 3W1XA 3TN3A 3E38A 1KGUA 4FNSA 1UPMB 1LWHA 1TE1A 2J7HA 3VYLA 2GJXA 3VOJA 3UR7A 1V6TA 4C7DA 1ME9A 1W9DM 3B97A 3RLUA 2C0HA 1TV8A 2E77A 1IXQA 1VEPA 4JFTA 3BZJA 5AB3A 2OR2A 2FVKA 2OSXA 3OP2A 5BXRA 2C18A 4BI7A 2YA0A 5ABTA 3DYOA 1TJPA 2GGIA 1ZCCA 4ZSUA 3VNJA 3HTWA 2WLYA 8CGTA 5HXMA 2I7GA 2WZIA 3S6OA 1FBAA 2E1WA 3B4UA 1YE6A 2Z7KA 3NL2A 2PP1A 3IIOA 2V5LA 5FI8A 2WC3A 2TPSA 4O28A 5AHLA 2B7NA 3ZXWA 3PPGA 4MWAE 3CV2A 2G95A 3VOGA 5A2BA 1JZ3A 3TYDA 1LT8A 4AEOA 3FW6A 4LBUA 2QCHA 2GSJA 3NNTA 1VPQA 4DJEA 1QOXA 3DUGA 5A8PA 4FNTA 4FAMA 4C6BA 3MT1A 1VS1A 3SUTA 4MUPA 1F8MA 2P3EA 4H8VA 2ZBTA 1KR1A 2QXWA 3F4VA 3FJLA 2AGTA 4MOZA 5F2GA 2WC7A 3AMLA 1ZNNA 1ICSA 1I0BA 3TTEA 3K1DA 1T41A 3M0MA 1A5UA 2IPJA 2E25A 1Q7ZA 2XDFA 3WNMA 2NXHA 3DN5A 4RL3A 5A8OA 4OQVA 2UZ9A 4P7RA 2OODA 5FJOA 3ARRA 3GSMA 5G5IA 5DQPA 2PODA 2XSAA 1KD0A 4C6IA 1W54A 3URBA 5K9CA 4LGXA 2YW4A 2OZ8A 4HZ8A 3B04A 5EA9A 3RLHA 1P5BA 4UFIA 4GFIA 2QCDB 3S2LA 5LNWA 4Y6GA 5EL1A 3E2SA 4JFVA 2VGIA 1CXKA 5I79A 2Y62A 3OA3A 3M7SA 3EKLA 3L4ZA 1PX8A 1YE4A 3EMCA 3SUVA 4H1ZA 3SFWA 3OGSA 3BSMA 2DJXA 5FF2A 4YXGA 3BJSA 3TC7A 1SGJA 3W01A 5ABEA 3BGJA 1ISWA 3TU9A 3OG2A 2BGQA 2R1PA 2INZA 2FHCA 3SRKA 2BGSA 4GH3A 4IG2A 4NNBA 1VR6A 2G0WA 4M51A 1DJYA 2C15A 3HFTA 5F7UA 3GXIA 4E0CA 2Z1BA 4Z17A 1XUZA 3WFAA 1XG3A 3VE9A 1S2AA 3KDNA 1A4MA 2HXTA 3QV8A 1BFNA 4MFDA 4PR4A 4FOKA 2BHYA 4AEEA 3OA5A 3VGFA 1THFD 3TA9A 1E6XM 1JULA 2QT3A 1BGGA 1GKQA 4ASTA 2Y7GA 4PE8A 3WQGA 4FX8A 2ZCGA 4HCDA 1QNOA 1V0NA 1W37A 4CQAA 2ZX5A 4R7OA 3GYCA 1EEXA 5TIMA 1R2TA 2W62A 5MF5A 3ARTA 3MP4A 4NJJA 2B7PA 3QMRA 2O9RA 2CLLA 4H7VA 3MQTA 4QSFA 1GZGA 1XLEA 2XTKA 3HZ3A 4IG2B 2GPTA 4MPQA 3G8EA 4IISA 1TWWA 2ZZ1A 4N0RA 2NX9A 5RUBA 5CGQA 4IPNB 1BRLA 4HB7A 5L9FA 1TVLA 4M6UA 3CUFA 4FIQA 3W1RA 5D32A 2UY5A 1GJWA 4FZIA 3RGTA 5FJUA 2E68A 4HPHA 4AWSA 2CLKA 4RK8A 3NQ6A 5CG7A 1LBMA 1PV8A 1WDSA 2XN2A 4GZIA 2XFRA 4H00A 3N14A 1E4MM 3LTSA 1S5MA 2WAGA 3SCRA 2PDCA 2OU4A 4PMJA 3F5JA 4HU4A 3W75A 1BTMA 4JY8A 3W76A 2PRHA 3AHTA 1H7OA 1TCMA 2WZHA 1H7NA 4MTVA 4HNTA 3VD4A 3NVDA 4WY0F 4Y9OA 3AALA 4GXWA 1ADOA 1S5TA 3OLEA 4NZ4A 1T0OA 5JIWA 4GZEA 4KEUA 3WH7A 4TO8A 5CKSA 4P61A 4KS0A 4KRUA 1DXEA 2ALDA 2XM1A 3QHNA 1KWKA 1W17A 1FDJA 5REQA 2NUYA 2DZXA 3FAWA 5KINA 4FK9A 1OHLA 3TWBA 1YX1A 3KE0A 3T0DA 1Z89A 1W5MA 4HU8A 5C70A 2AAMA 3VKDA 1TE6A 1WBJA 3O15A 1BF6A 2J88A 4ZOAA 2YXXA 3EWWA 2PDJA 3WJYA 1JPDX 4QSHA 5CPQA 2Y85A 1UZ1A 1V6UA 3F7JA 4RW3A 4WDUA 3W7KA 3R13A 2CLEA 1AJ2A 3GB6A 3PS7A 1H1YA 1XIFA 3TJLA 3R79A 1A5CA 3KEHA 3W73A 2F6KA 3EDJA 5H6HA 1F74A 1AG1O 5A6MA 1P6BA 4INFA 3W1PA 3TAOA 3B8WA 4PB4A 4L65A 4QRNA 6ENLA 2H8XA 1BYDA 4BQ5A 1NU5A 2ATMA 3PM6A 3PZ9A 3LQGA 1W9VA 3IRSA 4HHHA 4AZGA 4LAKA 5D2YA 3H23A 1OFBA 4F3HA 4X0VA 4Z1YA 1G6CA 4I6VA 2JKAA 1W5PA 1RCXB 1NELA 3NYZA 4DHGA 4MB3A 2AAAA 4M24A 1SUXA 3WQWA 1D3HA 1YDVA 3KCJA 4I90A 3D6NA 3WQFA 4S39A 5I03A 4MPKA 4IMGA 3WEZA 3UT0A 4ZQRA 1IE7C 5FD0A 2OYLA 1OX4A 3NL3A 1ZJHA 1H0GA 4IXHA 1FWGC 3P81A 2OSWA 4MZ1A 4WDXA 3AXHA 1XC4A 3T8LA 4A8NA 3U6WA 3R58A 2CLIA 2RGMA 3P67A 1HP5A 1GQKA 1C93A 4EPEC 4UTWA 4B4HA 2YCLA 1JAEA 1MFUA 1J0JA 1E0TA 3STPA 1JQXA 4W93A 4L9YA 4DQWA 4OKDA 3WJSA 2ZE3A 3JUGA 4FR6A 3KAOA 3SEPA 4WY0B 1VZWA 2H9AB 4DPQA 1RBOB 2CU0A 2X2YA 3VM7A 2B31A 4K7YA 3TYAA 3DFPA 5C55A 5AY7A 1R0MA 3STFA 2GWGA 1OCBA 1XIIA 2GL5A 3UFYA 1J0IA 4Q8UA 1XFBA 2PDMA 1DJGA 3OZMA 4J2MA 2EXOA 1KXHA 2J78A 4OTKA 5E09A 3WLSA 4XZBA 3IGSA 1N2VA 2YJQA 4WHBA 1G94A 3GC4A 1RLDA 4DYJA 4H9UA 1A3HA 4M7SA 3WELA 4TVUA 4WGHA 2ZX8A 1KFJA 4ZGYA 3B0YA 1D7FA 5AYIA 4GIRA 2YYTA 3CPRA 4QQUA 4C90A 3PB0A 1BWLA 1ZU8A 2OZ0A 1DP0A 3ARPA 4C6KA 3OVPA 3UG8A 3MZ2A 2GYIA 5DELA 5E6YA 1PTAA 3H4WA 4OUEA 3RO8A 5KSWA 1JZ2A 1I2NA 1TA3A 2YFOA 1KCKA 3NSNA 3W0KA 3TSDA 2NQLA 4XZNX 1D3CA 2YFNA 3WLIA 2VELA 2WHMA 2V5BA 5DMNA 3UCCA 3Q4DA 1W1PA 3CNYA 5C9ZA 3HQ1A 4HVXA 2PDIA 1GVSA 4UB9A 2SFPA 4CNNA 2CPUA 2PDXA 1YXDA 3KTXA 1G4TA 5A3HA 2HE8A 3CIXA 3V5CA 3E9AA 3VIGA 1IF2A 3GVWA 1OX5A 4Y8FA 5CZSA 5HJLA 3P84A 2PDWA 3T05A 1UWSA 1P0DA 3MUY1 1T6MA 1UMYA 5KTLA 4RZ5A 3PFMA 4BCEA 4Q8MA 1D2KA 2VOTA 3KOYA 1XRFA 1F6YA 3EXSA 4IP4A 4DYEA 4YN5A 4GG9A 2DW6A 4LJ3A 1D8WA 4XZMX 1FP9A 3AOFA 1XLHA 3HG3A 1NFGA 3WLJA 2VRJA 4AHPA 4K8GA 2D1ZA 4IGNA 3A24A 1NAL1 3A23A 4D2JA 1QATA 2GQ9A 1JPMA 1UZHA 2DIJA 4BY3A 5I5RA 1K7EA 2R82A 3DDMA 4RPQA 1GEHA 1XLAA 4GHRA 2R94A 4WJ8A 4N6EA 1HW6A 3GDRA 1VYSX 3REQA 2NQZA 4D6HA 1KRMA 4AIBA 3RF9A 4JTRA 4AEFA 1CTNA 3CO8A 4JOMA 4IIEA 3N2XA 3BG9A 1WX0A 2QULA 1TX0A 1E9ZB 3ZLGA 4PC8A 3OQEA 3AYSA 3ITOA 3WLNA 8XIAA 1R3SA 4GJJA 1O7AA 3WIJA 4FALA 1ZZMA 3WFLA 2CHOA 1YEYA 2DVTA 4UZUA 1OWQA 3PBYA 4KWWA 1O66A 3DGRA 1B2YA 4CD6A 3L4VA 1TELA 5CGTA 1ONWA 2VX5A 3HGOA 2OEKA 3WBEA 8RUCA 1WXZA 4IIBA 1PPIA 3L5MA 4KWVA 4G9PA 1TWIA 1W8GA 2AOSA 4MY9A 4P7QA 2WANA 4PUNA 4B5XA 1EJSC 3BUVA 2VOMA 4BZYA 3EGJA 4EKJA 2A3EA 3L0GA 1XLBA 3VFCA 1JCYA 3W1QA 1VCFA 4WOZA 3FV9A 4TVDA 2QJJA 3TYZA 3LMZA 3CL8A 1W1IE 3L5AA 4L1GA 3JZUA 1PIGA 3CYJA 1LL6A 2QPUA 3CB8A 2VC9A 1H7WA 1XYLA 3VMPA 2V5DA 2PDKA 3U5YA 5G4WA 4O19A 1DWJM 1WOBA 4ACZA 3C2RA 1AODA 3FVDA 1JCMP 4WJXA 5D37A 2HVOA 4XAYA 1A0CA 3T1GA 3SCNA 5C8BB 3O07A 5JXQA 2HCVA 3U2CA 4GX8A 3EKGA 3QYSA 2CERA 1XSIA 3A12A 3STGA 1JPHA 4O1BA 2QPXA 3ZYZA 1KTCA 4D6CA 2P5NA 1KFBA 5LA2A 2HROA 4QEHA 1GG0A 1G4SA 1KFLA 5AOUA 2RDUA 3AZTA 1CLVA 2VD9A 1XBZA 1GZJA 4FHAA 4UQ9A 2H6RA 1Q6CA 2F8QA 5HWJA 1W3KA 1QWKA 4DWSD 2ZUVA 3QGAC 4F8XA 4QS6A 5G4EA 4QE4A 4PTWA 1FUYA 3JU2A 4ILSA 5CPLA 3GWQA 1RY0A 4GQBA 4ZODA 4DI8A 4MY8A 3IJ8A 1YMYA 3USBA 1XHGA 1OBAA 1AW2A 3WUEA 1X6UA 3SURA 1CWYA 3DG7A 3G1YA 3E96A 3GTIA 3TN4A 4ADTA 3W27A 1GZ1A 3GZAA 1HP4A 3I4KA 5CPOA 5A2AA 4K6AA 3OGRA 3L2MA 4GO9A 3UP8A 1KCZA 1RPXA 3U48A 1AMYA 3BCDA 3ZLHA 2CLHA 4B3ZA 3MO4A 2GGHA 4G5DA 2CZ5A 4YMZA 1Q66A 2GUUA 2ZUSA 3IUHA 3QM3A 1GOXA 4ZXLA 3EDFA 4MJ4A 3MP5A 1B1YA 1NP2A 2JF7A 1TPB1 1TIMA 2HS8A 3GO2A 4X9YA 3DHPA 1UOZA 5LNSA 5HJYA 4O10A 4ZFCA 3DFYA 3L2LA 3AIWA 4H9ZA 2YBVA 4CN1A 1EFZA 5FKYA 3PBUA 4Q7IA 2X1UA 2GK1A 1UWIA 2XJ7A 2GVGA 2VVNA 3G5EA 3NURA 2TAAA 3SGGA 2XISA 1I4NA 4WKHA 3PWGA 4L4OA 3U8GA 3VIHA 3CUHA 3USZA 2I56A 4ZOCA 3ZIZA 3Q94A 4HHPA 3GH5A 2H8ZA 1EQPA 3C5QA 4AMCA 1TREA 4AZ7A 3RMJA 5BW6A 4HNUA 2DQWA 4BK9A 1N8FA 5H8MA 1WNOA 3S46A 2NT1A 1FDZA 2W66A 3EAUA 3P2VA 1LLWA 3S9YA 4ZR8A 4YLWA 2OGYA 3WY1A 4HHMA 5DF0A 3UETA 3VOHA 1E9YB 4YHGA 3IJ7A 2PURA 4KFPA 1M1BA 4LSBA 1JVNA 1Q8AA 2OB3A 1R47A 4MUZA 1BF2A 3WK0A 5IM51 2WQPA 1NDZA 1A3XA 4MZ8A 1EUAA 3GNPA 2HVMA 2ZTKA 3OJGA 4YCPA 3CPUA 3HV8A 2BX7A 3R94A 4XVDA 3CIVA 4WGXA 1KXTA 1JG9A 2A7NA 1YPFA 5I02A 5KMYA 2FZBA 3VVGA 1TX2A 1VJSA 4E8DA 4DLFA 1K9EA 1SYTA 1ZALA 3GRIA 1XLCA 3KS6A 5A6TC 3ITVA 3H7RA 1ZJBA 4ZB0A 2ACQA 4V2XA 3WDQA 4J3SA 3VIFA 1SO6A 3G24A 2DH2A 4GUHA 3KRZA 2Z24A 4UUIA 1XS2A 1U5VA 1V6WA 5BOEA 3CUZA 4IMDA 1V3KA 2YIHA 4PB5A 3G1RA 1QRQA 3QTGA 3UESA 5D2XA 1JYVA 2YL6A 1VFOA 4B3LA 4P8XA 2Z0IA 4HOWA 5BRPA 3UYIA 3MBFA 3IACA 3UPMA 2XINA 1EJUC 1EX5A 2ABAA 1F6PA 3MMWA 3S3GA 5FL1A 4XZLX 1ECQA 6XIAA 3EB3A 2V82A 3NQ2A 3GXNA 3P14A 1S2CA 3R0DA 1MQQA 4AW7A 1VFSA 4GNVA 4IQDA 1TPFA 3FJNA 1ZCOA 3WK3A 1I9CB 1DIEA 3GKAA 2G41A 1QI0A 4BHYA 3URNA 1L9WA 3OVQA 4A2RA 2VCAA 1B4EA 1JR1A 3MI3A 3VIMA 4M29A 3QQ1A 3BW4A 3G77A 4OHQA 3NQDA 1KR0A 3I68A 4GKLA 4UTMA 1DWAM 1C29A 2EQDA 3PZTA 4GQGA 3S1GA 1GNXA 1JZ7A 1UCWA 4LFYA 4PYSA 1XIJA 5C6MA 4JY9A 2D24A 3DKLA 2Z00A 2V63A 3MV11 3OYXA 2E9MA 1DBTA 1AMKA 2VD8A 4QJ3B 1HJQA 1G7UA 2PWEA 1WBHA 5FIPA 2HTMA 1J79A 3EPNA 3K8LA 1XI3A 1QBBA 1KCXA 4W5ZA 1HL2A 3RU8X 4UQAA 3ITTA 3GIPA 1S5VA 2IKIA 3LHTA 3BDKA 2CZEA 4Q8NA 1ONEA 3S0CA 1ICQA 3T44A 4FXJA 3AS0A 4FF7A 2KX9A 5E93A 1H2JA 1EWDA 4FR1A 1TRDA 4IIDA 3FEQA 3LRKA 2R9RA 4GY1A 1WDRA 2YCLB 4EIVA 1TTPA 3LERA 1ZP4A 1QCWA 2GJLA 1Y5WA 1E0UA 1W5QA 1CDGA 3WF2A 1YTEA 5HWNA 4NJIA 1XYFA 1TPEA 1AUSL 1QHZA 4RE0A 3TXVA 1MW0A 2W79A 4BQ2A 3AC0A 4L4MA 3MJYA 5XIMA 3EXTA 2X16A 3EA3A 3CK5A 2WJFA 2QCEA 4AZCA 4IIHA 2DVXA 2Y5SA 4DJFC 1OX4B 3BLPX 3PK7A 4IJRA 4MWAC 5H8UA 2VEFA 1RJQA 3OLGA 5CEWA 4L64A 3W7HA 4QTGA 1NH6A 4K39A 3CHCA 5MHBA 2GVLA 2WNQA 1DJZA 5E6ZA 4NKCA 2DW7A 2VWSA 1DWGM 3E2VA 4L6HA 3N1AA 2ZRZA 1YW1A 3QGVA 3BAJA 4E2BA 3ITLA 1I6NA 3OEXA 3WQEA 3QH2A 1QPQA 1SPQA 6TAAA 4JTGA 4FLQA 2FFCA 1TCDA 3I6RA 5I3JA 3D47A 1V0LA 1NQKA 1FXQA 1X98A 4KETA 2YDSA 2P8BA 1BVZA 3NQCA 4RV3A 1S46A 4V1YA 4LB4A 5HNNA 2VZUA 4PRWA 2FVLA 2CBJA 3KRSA 2HPMA 3GNRA 2CETA 2E5BA 2Z4GA 2PF8A 1OFAA 4XSMA 3O6AA 2Z1VA 4WRHA 1Y65A 1CT5A 4KBXA 3MSGA 3FOKA 3B8IA 1GVIA 3C2YA 3OU8A 4R9XA 3ZZ1A 4L56A 2QIWA 1MWOA 3QQWA 3EWXA 1PVNA 2O4MA 4U3AA 2QVNA 3RX4A 3HN3A 3QSTA 2CLMA 3LD5A 2E6AA 5LKYA 4GGBA 5LGZA 3WBYA 3SSZA 3QSRA 1GT8A 2DT0A 1OFDA 1NFBA 4KCTA 4AY7A 1JRCA 4FLOA 4O0KA 1S2VA 2WJZA 2ACUA 1UASA 3VA8A 1CZ1A 4POCA 3RFAA 2YZ5A 5CJNA 3LU2A 3M64A 2E4TA 3WO8A 3UZJA 5D09A 1A0DA 4GIAA 3ITYA 4EP8C 5A6BA 1US3A 2OSYA 2G4JA 1HKMA 2PDYA 3H8AA 3W38A 4MKVA 1YQ2A 1UUMA 2ZYFA 1TSIA 1R9YA 4PULA 4PUKA 2AMXA 1A53A 2WVUA 3UG5A 4K68A 2QDDA 3SCPA 2GUBA 2WZEA 1C7TA 1C9DA 1X1OA 3GW3A 3E2RA 3HPSA 4V1XA 3N4FA 2X7VA 1QAPA 2H9AA 3N3MA 5D03A 4P8WA 4XTIA 2YLAA 5CJMA 2JGYA 3O0KA 3M46A 4GOAA 5FJTA 3TYEA 3NQ7A 1LTDA 4D6IA 1RA0A 5EFFA 3R11A 3FX4A 3TSBA 1KKOA 2WSQA 4R9OA 4TMBA 4YWSA 3L0KA 4DEFA 3V75A 5DMLA 2V2CA 1UPPA 4GKTA 1DJWA 2XVLA 2C1GA 3BAWA 3RN6A 2FB3A 1GVOA 1A5LC 7ODCA 1FWIC 4CQ8A 1KLZA 1XGDA 4BEUA 2ZZ3A 1LWIA 1VBUA 2O56A 3KS5A 4CCZA 4CD5A 3GTFA 3REQB 1G0CA 9XIMA 2DZUA 3IV8A 2VRQA 2OYKA 3ABSA 5M5DA 1JZ5A 4XAPA 1R38A 1QI2A 1S39A 3TWAA 3MB9A 4HPJA 3V0UA 2JEPA 2OT1A 2JIEA 2W61A 1OB0A 4G2DA 5CC3A 3TW6A 3W02A 2NUWA 4X60A 3UBPC 2W9MA 4I9AA 4U10A 4MLRA 1OIMA 5JQ9A 1VP5A 2ZXQA 3RMEA 4C5ZA 3LBOA 1QASA 1J0HA 1OIFA 1EWEA 4JTSA 2OLHA 1AH4A 1B3OA 4MAZA 2X09A 5DT5A 4L4PA 3QW3A 1OFPA 2CHRA 3OHMB 3F5LA 1R9XA 2E6YA 1U30A 4N2YA 2VM8A 1GTEA 1ISXA 4EXBA 5CQ1A 4EXQA 4GA8A 5I7GA 2DPEA 3L9CA 4NUWA 3TNOA 1FHVA 3P74A 3MANA 3RM8A 1ZAJA 3PBMA 1SJAA 4NX5A 2WPGA 5D38A 5D8ZA 3GDMA 1GVQA 1JAKA 5D2TA 4TR9A 4JIEA 3VZZA 1S5WA 3CLWA 3NSXA 3R89A 2OELA 3QR3A 2NUXA 1E70M 1YNYA 2A3AA 2V9DA 3T08A 1HX0A 3N15A 4JTHA 1RQBA 3N2TA 4AX7A 2HDJA 3GH4A 7ENLA 1WP6A 4WX2A 3ZSTA 3MCOA 3L4TA 3NXFA 1KBLA 1KM6A 3RHGA 2NX3A 2QF7A 4GIYA 2GDVA 3R6IA 4LXFA 4C6QA 3KP1A 3UY8A 1GJPA 4PA8A 1TMLA 3BV7A 4PBFA 3AWNA 3SIZA 3GXPA 2ZC8A 3BOFA 1U5HA 2E5DA 3N6JA 2Z1WA 1WUEA 3FYOA 4K1GA 2C1IA 1SZGA 1GKPA 5LNVA 3GVVA 2ZZ4A 2YLLA 4FLRA 4UTLA 1SFSA 3PZGA 1OT2A 5DRIA 2I5GA 2CBIA 4KFNA 1RALA 3MW7A 4A8RA 3ELFA 1ECEA 2W0UA 2J25A 4JNYA 3C3UA 4WUIA 4CD4A 4ZXOA 2NZLA 1EF2A 1LDCA 2POZA 3V0TA 3QPYA 3IJQA 5KZ6A 1XH0A 2UY2A 1XYCA 1LRNA 2ZX6A 5D8WA 3TAKA 4DJDC 3VABA 4GH1A 2IS7A 2MNRA 1ISZA 4UFLA 3WKZA 3EWBX 3M5VA 4C6CA 1T8XA 5B80A 3GY1A 5C5YA 4IFRA 4RDWA 4DZIA 2OX1A 4S3BA 3LM3A 5A6SA 1XKJA 5I23A 4XZIA 3L0NA 3EX3A 1PS9A 3MSDA 1SW7A 3SDOA 3LDVA 4IMEA 2Y24A 4DAIA 3N2OA 3TQ0A 4AISA 4L6DA 4I9MA 5DY3A 1W31A 5DANA 3MKCA 1R87A 4WSHA 3TTSA 2F6XA 2X42A 1CEOA 1UHVA 1KXQA 3EX1A 1YIXA 4RLIA 1X7FA 4RZBA 3VOFA 1B3VA 3O9NA 3MYPA 2OWWA 3ABQA 1WPCA 3MS8A 4YL2A 4A6GA 2G3JA 4CNOA 3UQNA 1NF7A 5I6SA 2YDRA 3UZ5A 2UWFA 2ONEA 3BPWA 4TUFA 3T0CA 1OGGA 3W74A 1QNVA 2ZKMX 2QCFA 3FCPA 4MG4A 3AUJA 2NQJA 3MVIA 3V5FA 2VVSA 4Z08A 1H62A 2PTYA 4HU0A 3ZM8A 1DYSA 4IZGA 5AYXA 4NILA 3S6TA 2B4GA 3HIJA 5GNXA 5A6LA 4ZBCA 2MANA 3N9RA 4A8LA 3O8AA 1UD8A 3GHSA 3O6CA 5C9UA 1FWWA 3F03K 1XLDA 4ZQNA 1NTHA 3V1HA 2QHAA 3NO5A 4JTLA 4C6EA 3WQ5A 4ZMGA 4O4VA 2J7BA 3PZVA 2WMHA 4JFSA 3L21A 3NAVA 3T2OA 3QY6A 1IXPA 1O1HA 4N9CA 1US0A 3CAKA 3QXBA 3IARA 4NZCA 3MV01 1UQYA 2O9OA 3ISIX 1NF0A 4MGGA 3ANYA 3BAXA 3LLDA 4E8CA 2VX4A 3CYVA 3RJXA 2TYSA 2BOEX 1C9WA 2G3NA 4YIWA 1KRCC 2G3IA 5B7YA 2YW3A 3ZQ9A 4JICA 3WD1A 3MHFA 4F2TA 4BQ4A 1XD1A 5C2CA 1OY0A 3PR2A 4N4QA 4LCQA 3SQMA 5LSMA 3W7IA 1YTDA 4V27A 1UR4A 3MSYA 5IBXA 3W7GA 4NJHA 3HPZA 4B5TA 2VZVA 4UOJA 1FHLA 4N9DA 1BSLA 1RXOB 1JPIA 3H26A 3QY7A 4JEQA 4DELA 2CLFA 3AWOA 3MDUA 4Q4QA 1EDQA 4CUCA 1PZ2A 3N9SA 1M7XA 1HJWA 5LNUA 2HV5A 3W72A 5ABFA 4JN7A 4CU8A 1TQJA 1BRLB 3UJRA 1HUVA 1LBFA 2PPGA 4ATWA 4D6GA 1N8WA 3PUEA 2J8FA 4WLCA 1U2YA 1DPMA 4QGCA 1LUCB 5EMYA 3T6CA 3ARZA 2BHUA 4X61A 2QIIA 4B91A 3GHTA 3SR7A 3CUJA 3HPFA 4DWSC 5A2CA 5K4XA 1H49A 5AHEA 3VD9A 3A64A 1FWDC 3ANUA 5CGMA 3VCNA 4BEQA 1POJA 1EDGA 5LIYX 4OIFA 5CZKA 1NWUA 4KKXA 2ZTJA 3OBAA 3SUSA 1H60A 1LG1A 1P1MA 4MDPA 1VPXA 2FDSA 3JW7A 1GONA 3GVGA 1KQYA 2AQWA 3S5OA 3ZOAA 3TROA 2X1IA 2FPTA 3BGGA 3PJXA 1AW5A 4S23A 3W7EA 4Z1DA 3KX6A 4D8AA 1Q7QA 3LCFA 5J8LA 2EG7A 1PZ1A 1T99A 2EPKX 4I9TA 3IS4A 5CAHA 4KMQA 3MU7A 1NEYA 2Z2AA 4Z2LA 1QT1A 3COTA 5CXPA 4CCCA 1V02E 3P0WA 4HD5A 3G1SA 1UIPA 2QKFA 2V68A 1E55A 3W70A 4WCJA 4DUWA 4U2YA 4AVNA 4K7VA 3GC2A 2O9PA 1GTHA 5I3IA 2PC8A 4OE7A 3U4FA 4AXNA 5KEZA 4MM1A 4QE5A 1VFHA 3BH4A 3C0SA 4PUMA 2P76A 1RBAA 4Z42C 4IP5A 4JKKA 1TJ0A 3FXGA 1E6SM 4GVIA 2I14A 5C54A 2W92A 2CKRA 3M0KA 3DFOA 3TTYA 1JPKA 5AHMA 3AZRA 5A8NA 1UZ4A 1UOKA 2BMBA 4C5YA 1UJPA 5EU9A 1MDRA 3QPEA 1G01A 1V02A 2DORA 4FP1A 3TMLA 2X1TA 4AZ6A 3NEHA 4YTRA 4GBDA 3SJNA 5TBOA 2W5FA 3LBCA 3VUPA 1A4LA 4JL1A 3GAYA 3KBWA 1L2QA 5FF3A 5K9DA 1Z48A 3ZVIA 2GGEA 5H91A 3BLOA 1WDPA 4G6CA 1UWQA 4MADA 3W7LA 4N02A 4YHEA 1UP2A 2JGQA 4JIPA 4ROPA 3SJ3A 3GH7A 4JTIA 1F3TA 4GBUA 4FNUA 4GXMA 2RDXA 3B40A 2ZZ7A 6XIMA 1K8YA 2OQHA 4OT7A 1TKKA 2GDQA 1S1PA 4PN2A 1QWGA 1ZS2A 3ZR6A 2DJLA 1TV4A 3VGHA 3DHDA 2WVTA 1RY8A 4W9TA 1RJPA 1DJIA 4XWUA 3CWOX 1K7XA 2VI0A 3R43A 3LN3A 3W6LA 4WKAA 4C6PA 3GU9A 1DTUA 3V7PA 1EBHA 3KHDA 2PTDA 2PGEA 5G2WA 5AC6A 4WOQA 3RM9A 3KUMA 3TW9A 2C79A 3IGHX 1O6IA 3I4EA 3SY8A 1LRTA 3R4IA 2V2DA 1KFKA 2VMFA 2V69A 5BU6A 1D9EA 4EX4A 2NWSA 4YPJA 4EOUA 5E1QA 4GXPA 4C1KA 2BSLA 2VDIA 2QDGA 4XZHA 3MMTA 4Z2JA 4W5UA 3B0VC 1IT7A 5GJMA 1WZAA 2V30A 3H2MA 4E4FA 2LLEA 3ARWA 1FH9A 4LS1A 1TTIA 3HM7A 2BBFA 1ZENA 5KZDA 1WCGA 3PC0A 2VWTA 3W87A 4DO5A 1TZZA 1U1HA 5CSRA 2BASA 4F2UA 1W9BM 1Q45A 4GY7A 4XAZA 1YXYA 3MA8A 5D33A 3CLMA 3WD4A 1B0IA 3BLLA 3ARSA 1H50A 4WDTA 3NO3A 2EPHA 1MUWA 2VUNA 1JDEA 4IGMA 3V4BA 4DXVA 1QPOA 5F4WA 1BQGA 2PP0A 4FS9A 4NP7A 3NO1A 3BC9A 4H7CA 2WWDA 3THQA 5A1AA 1FH7A 3QZ6A 5A69A 1E6PA 1JXJA 4I7VA 4TU1A 4A22A 4B92A 1CGWA 2DZWA 4QDWA 3MUZ1 5D9MA 1Q6FA 1ZBVA 4ZTYA 1WXYA 4Q33A 2Y7FA 1TPH1 3TXZA 4DO6A 3PZNA 2RHGA 1QU4A 4Q8QA 4C60A 3WZ0E 1V7AA 1R46A 4FOJA 1DE5A 3DC0A 4HTBA 3R25A 5I0DA 1P43A 3HBLA 3ARVA 1EYEA 4NYYA 4NZ5A 4EAYA 5C9XA 3QJAA 5C7VA 1SFTA 2XPKA 5A8QA 2BFGA 5E5CA 4DLMA 1B54A 1U83A 3RUBL 3OZYA 5BXTA 2PS2A 2Z6IA 3CWHA 2YKKA 2BXVA 3KBJA 1A5MC 3GTXA 3CV6A 3I7RA 1W9XA 3KOXA 1TJ2A 4CGTA 1R3QA 4GI8A 2ANUA 5FF0A 4TTUA 4YVVA 1UC5A 3MCNA 3WLQA 4DB7A 2CWXA 3L66A 3C2EA 3E2QA 3TNBA 4O18A 1BPLB 3FDGA 3W2MA 3CAVA 3FN9A 3NZGA 3OBKA 2WHKA 1R5YA 4LCRA 3G3MA 2HSAA 3STCA 1SJDA 4HZ7A 4AC1X 3UXLA 4ZENA 2QCLA 3R5EA 4GY0A 4XD5A 1TFVA 3GG8A 1NWSA 2FMNA 3V16A 3P62A 4A3QA 1XRTA 4PTVA 3WQOA 3VUSA 5XIAA 4O15A 1Q6OA 3L5LA 4JHOA 4GVHA 3WLHA 3WCZA 1XH2A 5DLCA 3GNXA 2QDHA 1CBGA 1GW1A 4OV9A 1LQ2A 4IPLA 3UA3A 3UA4A 5CPSA 1P0EA 2GOUA 1CYGA 3ZFHA 4NVTA 4C6OA 2QR6A 2QF8A 5I3GA 6ALDA 3O6YX 1UR1A 3MUIA 1FWCC 5BRBA 3LCGA 4CU7A 2VQTA 4PUWA 3R8GA 1V03A 3C2FA 2ZICA 5EB8A 4X3ZA 4QFUA 1FDYA 1S2UA 3NOEA 4DX3A 4B5UA 4ERGA 3VCRA 1F3XA 4ZO8A 4DVOA 3M5YA 4DF1A 1QDSA 4D72A 2C19A 2ZDRA 2I5QA 4RDZA 1PZ3A 3NL5A 4W7WA 4NU7A 4JXCA 4NSBA 2PU0A 7CGTA 4B9ZA 3QZAA 1DIOA 4GIEA 2VQUA 5CSUA 3SIMA 2XGIA 1JUEA 5A8MA 1JDDA 4H6KA 2QGYA 3V35A 4JYDA 5HBFA 2FYMA 2XWEA 5EGRA 5I00A 2VCCA 4CQDA 4E6MA 4J7RA 2EJ1A 5ENLA 1BXNA 3PJUA 3WLRA 3E6EA 3LQLA 1K1DA 3WQDA 2R1NA 2HPIA 4L9ZA 4CQCA 1S2WA 5IXEA 4GUGA 3ITGA 2VHLA 2EEXA 1HL8A 3RYSA 3PZIA 2ZRUA 4HK5A 1V6VA 2FIQA 4JCMA 1HIZA 3W83A 3TH6A 4ZO6A 4DF0A 1CLKA 3PFRA 1X6LA 2WBKA 1MXSA 4IXXA 1EIBA 4HJWA 3UZXA 1IEIA 4RDVA 4PCPA 4YVPA 3K1GA 3LG3A 4R53A 1L6WA 4X2PA 2QW5A 4GD0A 3RILA 1XX1A 5G2IA 1BTCA 1B90A 3XIMA 4QIUA 1IZJA 3SCWA 4G7FA 3BCFA 4XBKA 4PCSA 3A47A 2P8CA 4DJEC 3V3WA 3K8MA 2CIPA 1Q4NX 4HCHA 2JQXA 3LPFA 4ZQOA 2J13A 3S1VA 4LF2A 3THUA 3ZWTA 1KGWA 4WKFA 1Z6KA 1F6KA 2PI6A 4JQ3A 3NZQA 5BROA 1E0WA 3GR8A 3NQVA 1XYZA 4QITA 4DWDA 4IPIA 5G1TA 2J24A 2PMQA 3S5SA 4DBUA 3QR1A 3VE7A 1J0ZA 2Y70A 3OQ8A 1EHAA 1V3HA 1JCTA 4QLKA 4HA3A 2NLIA 1KWGA 3TR9A 2IPGA 3RAOA 4MLJA 1LM1A 3E74A 1BVWA 2PRMA 4GE8A 1VJIA 3LCIA 3LXBA 3F2BA 1PUDA 5LIKX 4PUUA 3GNDA 1C8VA 4EE9A 3NWRA 1NFPA 4F0HA 4FXRA 1LWJA 1M9HA 2E8YA 2W4XA 4HNOA 3I7QA 5EMKA 5AC4A 1UQZA 2ZUMA 4ICMA 3G18A 4HMEA 1RJRA 1SM9A 4MIMA 2DUZA 3N2CA 1OX6A 4GPNA 4H01A 1POKA 3WBAA 4J3VA 1P6WA 1VIWA 3CZLA 1R3WA 2NV9A 3BK0A 3DFQA 2Q01A 4XAFA 3VDAA 4MF4A 3RPMA 3GR7A 3NIYA 1BGAA 3TN6A 3U2EA 1J6PA 2PLJA 7A3HA 1CB7B 3MWAA 4AYSA 4FI4A 2Y7EA 2PTZA 3UNDA 3H2AA 1AJ0A 5GNYA 3ZSSA 2ADAA 1Q4WA 2B81A 2VO5A 3E0LA 2I17A 4RE3A 4F66A 1IXOA 1YBQB 1EP2A 3NDYA 2PZNA 1KB3A 4M1BA 4H9MA 3HGRA 3PBWA 4QDMA 4HPNA 3QHMA 3CUGA 1J4EA 5D02A 5AC5A 4PODA 3TC6A 2Q6ZA 3UWUA 2UBPC 3U2ZA 1K77A 3EX2A 3VAVA 2X7WA 4P8VA 3G0UA 2GK1B 1CW2A 3GHUA 2CZVA 4B90A 3A9IA 4GO8A 1IR2A 1N7KA 3IGUA 1MUCA 1XYAA 3LHUA 1IZKA 2HZGA 1UW9A 3MHGA 2ZUWA 2YBUA 4MJ2A 4AZIA 1EPXA 1DQWA 3IIPA 3CHEA 1RA5A 4NRRA 2R24A 2F61A 3CTTA 2OO0A 4F0KA 4LBRA 5F1VA 4TV5A 1V79A 4NAEB 4ZSTA 1MI3A 4IUGA 4LALA 2D69A 4O8RA 2V3FA 2D2GA 1R8LA 2BY3A 3TVAA 4LYQA 4NX0A 1NJJA 1PTDA 3W2UA 2FH8A 3W1TA 2XFWA 3EOOA 3EXRA 4M82A 3ICJA 1XBYA 1IZCA 3TYBA 2VEGA 1F4HA 5FEZA 1VFUA 1PDYA 4GGHA 1VBGA 3L23A 2NW0A 3URAA 2A3BA 4LVDA 4XISA 2CESA 2FTYA 1RP9A 1NQ6A 2XGBA 3GDLA 4Q8TA 4RXGA 2TSYA 2QCMA 3W53A 3S9ZA 1W1B1 2J9ZA 4Z1BA 2HK0A 3W7MA 4E5TA 5K7JA 2QQ6A 1B3ZA 3W26A 3GFXA 3VTRA 2EPMX 4ORIA 2DEPA 2Z25A 4GFSA 4UC5A 4JIHA 3II1A 1K3UA 3DFSA 3P80A 2ZZ6A 1KFWA 2HJPA 1PKNA 3PUDA 3AXKA 2J9YA 1KTBA 3DG3A 3NL6A 1Z44A 4AF0A 2QZRA 4GCAA 3KVMA 3U5UA 3VKAA 1ISYA 2XH4A 4JTQA 1HQTA 2A79A 4CQ9A 3W1LA 4C6JA 2X1SA 1W9PA 2VZSA 3M43A 3LCWA 2Q8ZA 4D1JA 1ZBCA 4A3HA 4OBTA 2TRSA 1RVKA 3C0QA 4P7NA 1LOLA 3GDTA 1I45A 5DRCA 4NI3A 3GS6A 1XR2A 3LENA 1VAHA 2W67A 5AC8A 4UZSA 1Z3NA 5CJ5A 4ICNA 4QE1A 4MWAD 1ONXA 5M17A 5HANA 1MFVA 3DXIA 4A8IA 4UQCA 1V5XA 4AF0B 3R8RA 3WQ4A 4BJHA 3VKCA 3EKZA 4PMUA 4WF7A 2PDPA 3ECQA 4GUJA 2XUCA 1EBGA 1TVNA 1WDDA 1BWVA 4UR8A 1EO5A 4QEEA 2PRLA 3KOFA 3WNOA 3NZPA 5JIPA 3NPWA 4LY4A 1Q63A 1EZWA 1O5XA 1HVXA 3K5XA 3W1AA 3NEVA 3SY1A 3UPBA 4DJDA 5GJPA 1W1YA 1FY6A 2X40A 3RXZA 3GBDA 3VX1A 3HF3A 1HG3A 2J47A 3SBFA 1IEQA 1Y0EA 3QV9A 3OBEA 1ML1A 1VEMA 2BODX 2FLIA 3RNDA 4EWND 1K4GA 4TTGA 4JYFA 5I3KA 1QMLA 1VBRA 1KM4A 5IFTA 3K2GA 3ZT6A 3MCMA 3UF9A 1T40A 1ODZA 2FZ9A 1UB3A 4H6EA 3G6MA 3L7RA 3AMGA 4R7WA 2FGZA 2VUYA 5HQLA 1UA3A 3G1HA 1GVYA 2WWCA 4PTXA 5HPOA 1A49A 1SJBA 1Q85A 2PDFA 4FSAA 4NZ1A 1LROA 1IWBA 1I2QA 2Y89A 3URQA 1S3TC 3TJXA 4B2DA 1KM0A 3UNTA 5BYWA 1GVEA 3AJXA 2CHNA 1JYWA 2EPLX 3WQPA 2QDEA 2A0NA 4YTTA 2XYLA 1EXPA 1GJUA 3FSTA 4GVGA 4A05A 2PTXA 3SUWA 3N4EA 5DBTA 2DDXA 2J7DA 2NX1A 1X38A 5HR6A 2X2GA 4O11A 2AMGA 4N42A 4IH3A 3LPPA 3DG6A 2HXUA 2PDBA 3OYZA 2C16A 3A4WA 2WSKA 3W84A 4BF9A 1CXIA 4PFMA 3GG7A 2PLCA 1IHIA 1ZFJA 1PJ9A 3LSBA 2I57A 4ROQA 1CGUA 3VGBA 1JDCA 2F7FA 5E9AA 4M80A 3KBMA 4D9PA 3TN5A 2HK1A 1KCLA 2Z29A 1TRIA 1XRVA 4GYJA 3V0SA 4CLMA 1PCKA 3IJIA 4UQEA 1BXCA 3N6HA 4Z2KA 4HMCA 3A22A 2PA6A 4IM4A 3IANA 4M5PA 1R6WA 1Q65A 2VRKA 1C8QA 7REQB 1BYBA 3LI1A 5H8PA 1CGXA 2DIEA 2CLOA 4OFCA 5K4ZA 1E15A 1M5WA 2PF0A 3S5NA 3EPOA 3LCLA 1UH4A 3W28A 4BKNA 1PYMA 1VFMA 1MYRA 1HTIA 3N18A 3IAQA 4BF5A 3WQCA 5E9XA 5A6JA 5EBAA 2VR5A 4LT9A 4DM2A 3KWSA 3BG5A 2OKTA 2PZ0A 2DUXA 1IGSA 3KOZA 2XSBA 3ARQA 2IQTA 4TMCA 2GZXA 3O63A 4F40A 4M81A 5EMUA 1VIZA 1RHCA 4GC3A 1UWUA 3CZEA 4GQ0A 4HHLA 1IQ8A 1XLKA 3DGBA 1OD8A 1TR9A 3TJIA 2YYUA 4O50A 4PUDA 3B8UA 4R34A 4Y96A 1T5AA 1DIKA 4F0SA 1KQZA 4GQQA 5IBXC 4LUSB 5EMLA 1ITUA 1E73M 2VENA 2OMAA 4NASA 3PANA 1OCJA 2IW0A 4AZ5A 5KZEA 1KBBA 2BY2A 1IWAA 5IOBA 3GG1A 4KGJA 3APGA 3H54A 2CW6A 3MSRA 4N6FA 3VMNA 3WDIA 3W00A 1B31A 4NG3A 5F1UA 1NOUA 1H09A 1Q6RA 3UWEA 3F4NA 4J28A 2RAGA 1PAMA 4LNYA 3T4CA 4AFYA 3ZLFA 3FXYA 1KBJA 2YOCA 2IUZA 5CH9A 1KLYA 4IIGA 2V3GA 1L6SA 3GIYA 2ACRA 4US6A 3W2KA 3DECA 4XKYB 2V81A 4RR4A 1RD6A 1I1XA 3AIVA 2Q3OA 3CM4A 3RCNA 1DORA 4E38A 4H9YA 2INFA 3CUXA 5C9RA 1OT1A 3ABZA 4AAJA 4JHZA 1Z42A 3EDKA 1VEOA 5BZAA 3UGRA 2E7FA 1EXBA 2ZA1A 2DSWA 1G7VA 1FKWA 4UNKA 3GXDA 4CCEA 1ZY9A 3W85A 3FLUA 4M7TA 4H6RA 3I3BA 2PCQA 1PIIA 3P7YA 1W1TA 1XISA 4D6JA 5E70A 4AIOA 1V7YA 3NQBA 1ME8A 2BVTA 3KBVA 3KLLA 5ABHA 4RE4A 3LXAA 4RZ6A 4P7LA 1Q6LA 1VBHA 1IYXA 3ORWA 2AQOA 1XCFA 2YA1A 4I8YA 2JE8A 3EWUA 3GQYA 1XIGA 1E72M 4UTIA 3SSJA 1I8JA 4UTHA 3SN4A 4FNPA 3DENA 2J77A 3G6LA 1EGZA 1VFTA 4W88A 2QUVA 3LCHA 2W27A 3M0VA 2DV0A 4ZB2A 1V3MA 1TR1A 1J0KA 3EWCA 4LF1A 3PPCA 2Q8LA 1DQUA 1N8IA 4C7FA 1V3JA 4RX0A 1P0KA 7TAAA 2A3CA 1B30A 2E09A 3GBEA 5D05A 2R8WA 2QCDA 2D0GA 5LIWX 1KNWA 3S4TA 2G5WA 1VYPX 2QV5A 2PTWA 2QYGA 4O54A 5JUVA 4YTQA 3WLMA 4QHRA 3ATZA 2E5CA 4LU0A 1VLIA 1QR7A 3LHZA 4FIRA 2YDQA 4I6KA 1ONRA 3P3BA 2YL9A 3WJWA 3LHWA 3WUFA 3W4RA 1FQ0A 4BWLA 4Q8WA 3VGGA 1HKVA 1V4YA 5AVNA 1UA7A 4ZVJA 4IGSA 3IIXA 3Q2DA 4DXKA 3PUGA 4FEZA 4J5NA 4KEVA 2ZWYA 3UXKA 4MWAA 2C14A 4E8GA 3VIOA 1EB3A 4IQEA 1TPUA 2RJHA 4U31A 3DX5A 3N04A 4XZWA 1TG7A 4ZOEA 4HYVA 4P5UA 3TYUA 3MTWA 1M68A 3VC5A 4JKMA 3WQVA 1LL4A 1LZOA 2J9XA 1YKWA 2BG5A 3GUWA 1XIDA 1TV7A 2REQA 5HJXA 1RSCA 1H51A 3DBNA 3LLXA 3GXMA 1P7TA 4XKMA 1QNPA 4ZQMA 5TNVA 1AK5A 1IR1A 2Q02A 4PZVA 1A5AA 1UKPA 2ZA2A 2DZBA 5I3HA 2PDNA 4OOZA 1DOSA 2J66A 4QROA 1KM3A 3E5PA 3TKFA 3T40A 1JUBA 5REQB 3LA4A 1RCQA 2PGFA 4YWIA 2QEZA 4JTAA 4JIRA 3PTKA 3KBNA 1W5NA 4A3RA 1UBPC 3FK4A 1RCOB 3LGGA 1VH7A 4FOUA 2X0YA 3PULA 3UR5A 1LCOA 2X0HA 4IP7A 1SZRA 2XVKA 1GW9A 3NGJA 3BG3A 3DZ1A 4GINA 3V5OA 4E2OA 1TZ7A 3BSGA 3K13A 4U5KA 4WJEA 3QV7A 4JGDA