4FA8A

Multi-pronged modulation of cytokine signaling
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
200
structure length
188
Chain Sequence
AVTAFLGERVTLTSYWRRVSLGPEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRSANTFFLVVTAANISHDGNYLCRMKLGETEVTKQEHLSVVKPLTLSVHSERSQFPDFSVLTVTCTVNAFPHPHVQWLMPGVMKEKDGSLSVAVDLSLPKPWHLPVTCVGKNDKEEAHGVYVSGYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted protein BARF1
publication title Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1.
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein/cytokine
total genus 37
structure length 188
sequence length 200
chains with identical sequence B, D
ec nomenclature
pdb deposition date 2012-05-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fa8A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fa8A02
5F3BA 1JUFB 3HMXA 4GMTH 5HHVL 1YA5A 4H8WH 1NMAH 2J2ZA 4XP1L 1S5IH 1YUHA 3MLUL 1CIDA 4WFFE 4WU7B 4QRTB 4WFGE 3THML 1VACB 1HHIB 4NRXB 4O00A 2WWKO 4GAFB 4PJAA 1T1YA 3HR5B 1MFEL 1T6VN 5I76B 3A6CH 1BFOA 1IL1B 5T3XD 1YQ2A 1CLOH 3AROA 2PKDA 1ERNA 1MHPH 1EGJH 5EULV 4UTBL 2CD0A 1AQKH 2AV7A 3QUMA 3KPRD 5DYOB 1YMMB 2ILLA 3NAAL 4K07A 1RZGA 4FP8H 2P8MA 4QHUA 1ZSDB 4ZAKB 2XWTA 3OKYA 2H32B 3BE1H 1NCDL 5JW4M 2YD1A 4H0IA 1D3CA 5E99H 3C2AH 5F8RC 2X40A 4LCCB 2CO6B 1F2QA 2XPGB 4ODTH 4Y5XC 1U8LB 4X5XA 5H37G 4XCNB 4ZFZB 5DWUH 3OKMA 4LCWD 1NMBL 1PY4A 1S7QA 3STLA 3M8OL 5J1SC 3DX6B 2BX5A 1BBDL 5FA3B 3TA3B 5EB9A 3FQNB 5JA9A 1PG7W 1E6OL 3CXDH 3P4NA 4UIMB 4D8PA 2A77H 2J8UF 2EH7L 3WFCL 3ZKMD 3O2VH 1N5YH 1PKOA 5A2JH 4PJFB 5LBSH 2HFEB 3T8XA 3WLWC 5AD0A 4LIQL 1FFOB 2LU7A 4KTDL 2DYPB 4FA8A 1J0KA 4MDIA 4PS4H 4M6OH 2HKFL 1N6UA 3U1SL 3OR7A 2Y36L 3DTXA 3M1BB 4M5ZL 5ANMA 1IVLA 4YC2B 4Y5XA 4I2XB 4UNUA 2ATKB 3FFCD 2LVCA 1MCOL 1TIUA 2FWOB 2OP4L 4Q6IC 4KZDL 5IEHB 4JPWL 4R2GB 4NKIL 1FP5A 4LEXL 5ITFA 5EOTB 5DJ6A 4N8VA 1LK2A 3S35H 3QA3A 1AHWC 1K4CB 1JHLL 1MJUH 4M6NH 3SBWA 1TQBC 5BV7L 2V2WB 2VQTA 2Z4QA 3VXMB 2HJKB 4JHAH 4ODBD 3G6JE 3MGOA 4YHPB 4O5LH 2J12B 4Q6IA 5IW1A 2P4AB 3QIUA 4PJXF 3P0VL 5BJTB 2RHEA 3PP3K 3MRGB 4S0SD 1E27A 1NGZB 3KPNB 4Y4KB 2DDQH 3ECBB 5I1IH 4D9QD 1IM9B 3O3UN 1Y6MR 4KI5E 3C6LB 2P8PB 4Y1AE 1HYSC 3QZWB 4YNYB 1KN2L 2C3WA 4PGDA 4NO0D 4WUKH 4AL8L 4QY8A 4XP6H 2XZQH 1XF2A 4Q7DA 4HKJB 1U8IB 2EIDA 3GMNA 4Q9RH 4OFPA 2WBJC 1VEOA 4OF8A 3HRZA 2I26N 1F90H 5SWZE 1EHXA 4E41E 3IFNH 4P4RA 3OB0H 2ERJC 5E8NA 4L8SB 3QUXD 4JKPH 4XVSH 1ZGLM 1U8MB 4JZJB 4EXPX 2XRAH 2AJ3A 4LEOB 2DQEL 1GZPB 5I66B 1D5MA 5GS2H 3D0VA 5C0BD 1IEBB 1MPAL 1XGPB 3V7AE 2MKLC 1RAMA 5TE7H 3SDDD 4OT1L 1XR9B 5ISZE 2P5WB 1JPGB 2VITB 3BQUB 3NCFB 2YD7A 4K9EC 4NC1E 4S11A 2WBJA 4PB9L 4P2RE 4QXTB 3UJIL 4ZS7L 5LCVL 2RAMA 5GJTH 2QR0A 5D7JB 2HLAB 5HY9B 2X9YA 4M4RA 4F8TA 3HB3C 2CKBL 3NIFE 5IBUB 4RGNC 2ICWJ 3H3BC 4XXCA 1KT2A 1C5DB 5JXEA 3MCG1 1WZMA 2VC2L 5E5RB 2F53B 5J4MA 1D9KB 1P1ZB 4DN4L 1BWMA 4FQPA 1WBXA 5FHAL 2R1WA 1EPFA 4M93B 4OFDA 1X5KA 3BH9A 1UM4H 5T3ZL 2Y07L 3DNKA 5L2KA 1MRCL 1IGCH 3B6SB 5FOBA 1MIMH 4ZTOH 5MENB 3EOAA 4WIQA 3SPVB 4OLZH 1WWAX 2OR9H 4J4PD 3QULB 1L0QA 1G1YA 4CMMA 2QQNL 5IMKA 1OGAD 4Q2ZA 3TBSB 1DE4B 1F4XH 4ELMB 1X5GA 2GY5A 1V05A 1HNFA 1CFQA 43CAA 2GT9B 4TSCL 1E4WL 3L95A 1M7DB 1IGTB 4ZQKA 4R90L 1A7NL 5HVWA 3G04A 3CAFA 3MGAA 5LVEA 2QBWA 2J8HA 1MCRA 1AQDB 1F6FB 1MFEH 4OGAC 5GQBA 5JDSB 3DVNA 1Q9WA 1SHMA 4X5WB 5FECA 2Z35A 4FG6D 5K9OA 2E3VA 1FVEA 1TITA 4UTBH 3MV8D 3ZTJG 1ZWIB 3LRGA 4G8GA 4BA8A 1JFQL 4K8RC 1QVOA 1KN4L 2WQRA 4PGZA 2HFGL 4JAMA 1LILA 3SO3C 3B5TA 4GRMB 1CTNA 1NC4B 2YMXL 2X1WL 3IGAA 2E7MA 5F7DB 4YPGB 4NNXA 1NCDH 4MNGE 2XY1A 4ZXBA 4RAUA 5HVHC 4OZGA 3P11H 3SDCD 3H3PH 2APFA 5T3XH 2Q8AL 1JNNH 4G43B 2A9ML 5IB2B 4KY1H 3S5LG 4WFFD 4WFGD 3Q5TA 1NLBL 2UZIL 4GG6B 1KB5B 5J9PB 4I4WA 4LKCA 3M8OH 1NUDA 3HZVA 1B0RA 4MAYB 5D4QA 4CDHA 3BX7C 1DEEA 3CFBA 3QDJB 5D6CA 4NN6C 1YPZA 1U91B 5IBTL 1LNUB 4LIQH 1A6WH 2F54A 1UWXK 5IROC 1MI5B 1Y0LA 5EU4A 3IJSA 4KTDH 3G5XB 1FLRL 4X6DE 4QRSB 2HKFH 2LAAA 3U1SH 1FORH 2Y36H 1UA6H 4YDVB 3O9WD 4YAQB 2R2HA 4L4VB 5C0IB 5ICZA 4PJEE 3T2PA 2VERN 5CP7A 4Y4FD 3QR2A 2OP4H 4KZDH 5EBMA 2ZUSA 4ZAKC 3BYYA 1JUFA 3LCYA 1MQKL 2HP4A 4FQXD 3MXWH 2GKIA 4XXDA 1N26A 4KGJA 4WU7A 3DYMA 1HHIA 3RIFF 2QSTA 1LEKA 2FRGP 1T1XA 4XRCB 5IROA 1UQSB 5I76A 2DMKA 2ICEB 1HXYB 1IL1A 4PG2C 3KYNB 1IGMH 3U36B 1CFVL 1QSFE 5B39G 4RFNC 3LMJL 2YK1L 3BUTA 3IDIA 4NFCA 1RULL 4L9DA 3LHPL 1RJYB 2GSGB 1RZFL 1ZSDA 4ZAKA 3P0VH 5ALBL 5DJ2B 2H32A 1DBML 2Z91A 2H6PB 3MFGB 4NFDA 2AJVH 4LCCA 1TTGA 3TM6A 1YNKH 2XPGA 5A2FA 3IS1X 1U8LA 3L3KA 4E0RB 4U1JA 4XCNA 5FM4A 4AL8H 2MPAL 4ZFZA 3U0WL 4RRPA 2Q76B 4PG2A 4F7CB 4JFDD 3DX6A 2IMNA 4N1HB 3J7HA 5FA3A 3TA3A 1K85A 3FQNA 4UIMA 2APXA 3O4LE 4MA1C 5E9DB 2Z0BA 3MREB 1WGOA 1QBAA 3WFDL 4PJBB 5IVOA 3QSKB 4PJFA 2HFEA 1CFBA 1FFOA 1YJDC 3TBVB 3WIFA 4RZCB 4HSQA 3O8XB 5LG1A 2NW3A 4XX1G 4HXBL 1TZGL 1OAXL 2DQEH 1DZBA 1NBZB 2ADGA 1S9VB 1MPAH 4I2XA 4DWHA 2EE2A 1A1MA 2ATKA 1II4E 1U8PA 4KI5D 4Y1AD 5IBLD 2FWOA 1YEDB 4OT1H 4JFZH 1OF2B 5E70A 1MLCB 2HLFC 4ZOEA 5ABDE 2E7CA 2ZUXA 2FB4L 1CT8B 5EOTA 5LCVH 4EI5B 2NY0B 2P7TB 3VXUB 4OZFG 5IB4B 1DSFL 1U8OB 5AUMB 5SWZD 1K4CA 3HC4L 4E41D 1OWRM 3QIBB 3MRDB 2IMMA 4ODHL 2NY1B 4V1DB 3VXMA 3K2UL 3T0EC 1ETZB 2GJ6E 2HJKA 4IJ3C 4DN4H 4YHPA 1MNUH 4B5EA 4RBPK 1KSRA 3OAZH 1T7WA 5FM8A 4RWHA 3OXSB 5BJTA 4CNIB 3MRGA 1TVHB 3HFML 2UYLA 3RY5A 3KPNA 2H9GB 1SJHA 4Y4KA 3ECBA 5ISZD 1GC1C 1A7RL 1KCVL 3B5HA 3OV6A 3C6LA 4P2RD 2QQNH 4YNYA 4KV5F 3QCTL 1PX3A 4J6RL 4HKJA 1U8IA 1IC1A 1QHOA 3BQUC 4GLRH 3KLHD 3WLBB 2J8OA 2IBBA 1A7NH 2FLRT 3PQYE 3TH2T 2A83B 1BOGB 3UBXG 5DJYB 2XG5A 5MERB 1TZHB 5KAQG 3NPSB 2Y6SC 1I7RA 4I9WE 5B4MD 3UROR 4L8SA 4YHLH 3V0VB 1JFQH 3CIQA 1LP9B 1R24A 4HWUA 3RWJA 1U8MA 3GJFA 4JZJA 1DQJB 4YDKL 5DJCB 3RVXC 2CDEB 2YMXH 5I66A 1D9KC 3HTLX 1IEBA 1XGPA 3KWWB 1YECL 2J1KA 3HPLB 4EN3C 2B20A 3HE6D 1JPGA 2VITA 3BQUA 4M93C 4HPOL 3TVMC 2Q8AH 5D72H 4N1EA 5KJRH 1UB5B 1X6NA 4QXTA 3ZLQC 2YA0A 2VZOA 2MQCA 2P44B 5FUZL 2VQ1B 1NLBH 2UZIH 2AJZA 5GS0D 3QP3A 3UTTB 1JGLH 3MZTA 5C6TL 4WUUB 3NIGE 1TJIL 4QXUL 1C5DA 2B0SL 5HJ3B 2FGZA 4RAVB 2FBOJ 5C09A 1U41A 4M43L 4ELKB 4OLWL 2F53A 5IBTH 1FV1B 1KG0B 1D9KA 1P1ZA 4PRHB 1FNEA 5ICXA 3RWDA 1BVZA 1DBBH 5L8JB 3TVMA 4UT6L 3CLEL 4P46D 3K8MA 3B6SA 5I71B 4U6YA 5MENA 3SPVA 1CTOA 3QULA 4JO1L 4LQFL 3HLAB 1DE4A 3NPZB 4DK3A 4ELMA 5IJVA 5F7EL 3JWDL 3MRBB 1T5XB 4X83A 2GT9A 5BO1L 4HIXH 1M7DA 1I1YB 1IGTA 1XT5A 4RNRA 5IMMB 2AABH 3X14A 3MLSH 1FL3A 4D2NA 1AQDA 4W4OC 2FNBA 3NIDF 5JDSA 4W68A 3S6CA 1YDPA 4X5WA 5E56A 2NXYD 1YNLL 1ZWIA 4Y16B 1CFVH 4KQ3H 3LQMA 1IEHA 2FX8L 2G5BB 3JUYA 2YK1H 3VXPA 5CGYC 1X5YA 5I17B 3HNVL 1RZFH 4P23C 1AO7A 3F8UB 5F7DA 1HXMA 4HK0B 1DBMH 3EYUL 4XP4L 1P6FA 3HZYB 4DKEL 3C6SB 1DLFL 2W65A 1QFUH 1ODAA 5C0ND 1I9IH 2FEEI 4YDIL 5IB2A 4NCC2 1WFNA 3V6ZA 1MJJB 4GG6A 1B0WA 1KB5A 5FK9B 5J9PA 4JRXA 2PTTB 4M62L 1JK8B 2E9JA 2H2SC 4PP1D 4U1IB 3QDJA 4JGMA 1HQ4B 2ZUQB 5I1EH 1QSFD 4WHYG 5HXMA 1ZHNB 3TIEB 1LNUA 5IMLB 5IUSA 3SDAD 2W92A 3AREB 4M7LL 5CD5C 4PY8J 2BNRE 1MI5A 3EYOB 3ARVA 4K94C 3G5XA 4HXBH 3MV7A 4QRSA 1RQ5A 1SEBB 1TZGH 5BS0B 1MCPL 2I25N 4S1SL 4YDVA 4NBYB 4YAQA 2DQUL 4GAGL 2RQ8A 4Z7WB 4L4VA 4FQHB 4MVBC 3X17A 5C0IA 4XTRC 5F9WB 4YZFF 2R1XB 1RUMH 2EDRA 1M7XA 1T1WB 2WUCL 5IK3A 3U9UB 4U31A 5L88L 1VGEL 4DUXA 2YPKA 2WIIB 4MD4B 4NZDA 1L0YA 2Q1EA 4POZC 1KFAL 1QLRB 3FB5B 1F11B 3O4LD 3DGCR 4ZO6A 4XRCA 1UQSA 3IF1B 4H8WC 3SKNB 3EYQC 1WF5A 5C07B 4XH2B 4Z7VE 1FE8H 1KLGB 4ODHH 3KYNA 2NY2B 3M07A 4ERSH 2VAAB 2Q86B 3OG4B 5EDXA 4FOMA 2EDXA 2Q7NA 5CEYB 1CICC 3GI8L 2BC4B 3I6KB 2GSGA 2CSPA 3ISWA 4NQTA 3IDMB 4HX1B 5DJ2A 1HE7A 3HFMH 2VZ1A 3MGTB 5SWSE 5TQ2L 2H6PA 1A7RH 5HI4D 4JG1H 5GGTL 1KIUA 5FYLE 4PV9B 1AXSB 4E0RA 5I74B 4KROB 3JXAA 4P2OC 4J6RH 3HKFA 5I1CL 1IKFL 4F7CA 3L7EA 4GRWB 5F9JA 2GSIA 1BFVL 1DBAL 4Z9KB 1OGTB 4QXWA 5E00B 5GRXG 1CICA 3MREA 1MREH 3IYLW 2GJ6D 4JDVB 2UVEA 4XMKL 3PWPE 4LP5A 4PJ7E 3RVUC 2BVYA 3O6MH 4GW1B 3MRJB 1NFDF 3IRZA 3TBVA 3RVWC 2BOBB 4RZCA 4ZYKB 1AGBB 4N0UE 1B3JA 5EU6B 4O2EB 1GOHA 1YMHB 4YDKH 4P9ML 2ZCKL 1NBZA 3ZT7A 1S9VA 1JNLL 1LDPH 3D2UA 1C5CH 4P5TC 1YECH 1YEDA 1OF2A 2O5XL 1U8HB 1R0AL 3L1OL 4QRUA 2YS4A 2BDNH 1CT8A 1JWSB 3U9PL 4BQ6A 5FUZH 2P7TA 2LTQB 4LBEA 3AVEA 3SE4C 3REWB 4PGBB 1I1AD 5MEQB 5IB4A 1YEKH 1S9XA 5AUMA 3RAJL 2MMXA 5C6TH 3JV0A 1TJIH 4N90D 4DQOL 2B0SH 3S36X 3QIBA 2VXQH 1E4KC 4I9WD 1AJ7H 2Q6WA 2X1XR 1CU4L 4V1DA 4YFLI 1G0YR 1ADQH 4M43H 5E2VH 3EDDA 4LSRL 4OLWH 1DQQB 1AGEB 1KCUH 2A6KB 3QIWD 2H2PC 3R8QA 4P3DB 2ADFL 4R97B 3OTTA 2W9LA 3GSVB 5TFSH 4QGYA 3W5NA 4UT6H 1N6QH 3OXSA 2H41A 1JZ4A 2H9GA 3L3IB 3KPLB 1G7HA 2O5ZL 4NN5B 4GSDL 1UZ8A 1VFMA 3QEQB 4NM8H 4OIBA 2X4RB 1MSPA 3SE4A 4JO1H 3W0WB 2ZWLT 3DVGB 1UJ3B 1HI6B 2VDLH 3WDJA 5F7EH 3JWDH 4QOKB 4NZTH 3MZGB 3VRLE 5HYEA 5TGBA 4B50A 4AEHL 1KENL 1PLGH 5BO1H 3Q1SH 1E4KA 3MLZL 3WLBA 3RDTD 1OQOA 4XCEA 2A83A 1BOGA 3IFPA 1FL6B 4UV7H 1AKJA 3BD5A 1TZHA 2J5LC 4XI5C 3ZHDA 1YNLH 4GT7A 4NQXB 3V0VA 1T3FB 3LPFA 1JZ2A 4ZPTB 4H5SB 1R5IB 3BPNB 3N85L 1P7QA 3PWUA 3GO1H 5DJCA 4GXVH 1AXTH 4I3SL 5IQ9B 3OKKB 3GIVA 3EYUH 3ZTNL 1QR1B 4XP4H 5E2TH 5F6HI 5CLWA 5D1ZD 1DLFH 1QRNB 4M4PA 5C0CB 4N1CA 4YDIH 2LU4A 3ZL4H 4WTXA 3VGAB 4ZMAT 4M62H 4C55A 1A9EB 4FQLH 3VRJA 1U3JA 4WUUA 1EK3A 4JFYA 1JYNA 5GZND 5HJ3A 5IFJB 4RAVA 3ULSB 2V7HB 1EFXD 4L9LB 1BIIA 2B5IB 5KZCD 5FHBL 3F7VB 4ELKA 2IH1B 4NO2A 4M7LH 2AJSL 5C8JB 3UYRL 4U7KA 4OZIE 5DMKB 5SV3A 4U1SB 4Y2DB 3SDXE 2PXYD 3LZFL 3PGCB 4S1SH 5LAXB 3MUHL 4CMHB 4GAGH 1XF3A 4TTDC 2X4SB 1NL0H 4TUKH 2VLKA 1FYTB 4QHNB 3HLAA 1H15B 1N59B 2R39A 5HHXH 4P5MB 4J8RB 4OLXH 5FUCC 1T5XA 1JWUA 1VGEH 5KN5B 3PDOB 5IMMA 5DHVB 2OK0L 2FEDC 2ARJB 1UCBL 5E94B 1BOYA 3O81A 4Q6YA 3MJ7B 5F88B 4PPTA 1JE6A 2HVJB 4JM2F 3RY6C 1NUNB 3D85B 3QAZB 3MNZB 5T1KD 5C0FB 2BNRD 3BKYL 4Y16A 4LF3B 5ACLA 4M5YH 1S78C 2EEAA 5C0GB 7FABH 3OKOA 2G5BA 3T0XA 2C3HA 3OKDA 3PIQB 3GI8H 2W60B 5I17A 4Q97A 2GUOA 2VLRB 3HA0A 1RMFH 3WFHB 3BGFC 5HHPB 4L3EB 2HVKB 4YHMH 5I30H 1A22B 5TQ2H 1JNHB 3U6RA 3UJTL 2VDKL 3TN0D 5GGTH 4MMZC 3VA2C 1QBBA 2XOTA 1MCNA 1DVFB 2ADJA 4XCYA 5F97E 2HH0L 3LN4B 1A2YA 1MJJA 5FK9A 4YXKH 1AGCB 4IOFD 3KYKL 3ETBF 2WK2A 5DO2D 3VFOB 4X80L 2FBJL 3VGDA 3VFTA 2CKNA 1BFVH 4UT9H 3VMPA 1LD9A 5F96L 3IB4A 4U05A 4Y4HD 4YDJB 5DK0B 1HQ4A 3MRHB 3CMOH 4OCLC 4I3RL 5KW9H 3TIEA 5IMLA 2VDOL 3EYOA 1OP5H 2FJGB 2UWEE 1CQKA 1JGEA 4GS7C 1NAKH 1SEBA 2E27L 4JFXB 3TGXA 1BX2B 2PYEB 2BVPB 2ZCKH 5FO9B 4JY6B 5SWSD 1KJ3H 2QTEA 4FQHA 1JNLH 2W0PA 5CBEB 2OX5A 5FYLD 3S3JA 4UOW0 5D8JH 3T1WA 3FT4A 1T89C 2R1XA 4B41A 1PQZB 3FZUC 3L1OH 1T1WA 2KPNA 4M8QB 3VU2A 3E0GA 2WIIA 1BQUA 3KPRA 5LWYL 4F7TB 5E5MB 3VFUA 1F11A 3ZKMC 3MBXL 5I8KL 5I74C 5DUBB 1JTOA 5FIEA 3W39A 3SKNA 1T0MA 5D5ME 4H0GA 4DQOH 5C07A 2IJ0C 4LSPH 4XH2A 3PWPD 3MRRB 3E6FB 1CU4H 4EEEA 1KJ2A 4LSRH 4MA8L 4V2BA 1DL7H 4ZFGH 3GRWL 4WI5A 5CZXD 2Q86A 2LE9A 2X44D 1A3RL 2ADFH 5EUKA 4JLRB 4NKDB 2BC4A 1GGCL 3I6KA 4IDLA 3K2MC 4P2CG 4DVRL 5FV2A 4HX1A 3DARA 2ESVB 4YGVB 2OXGA 4WEUD 5DVNA 3HC0B 4GLRI 4ODSL 3SQOL 3GMOB 2EZ0D 2O5ZH 4PLNC 5BW7A 4Z8FL 3RKDD 2VZUA 4N8CH 4LARH 4NYLA 5D2LE 4PV9A 1LK3L 1FCGA 4NSKB 4PRAB 1AXSA 1Z2KA 3PWNB 1CXFA 3ES6B 1ZLWH 1KENH 1ZA3A 1T0PB 4XMLL 1JWMB 4ODXA 4EUPG 2VN7A 3QUYB 2R8SL 2X05A 3VMOA 1CD0A 3PE9A 1QKZL 3T3MF 3CMGA 4LL9A 1EJOL 4OFIA 1QSEB 4JDVA 1JI2A 2GTZA 3RL1B 3BIKB 2BVTA 3MRJA 3O3BB 2BOBA 3PV6B 4NZUH 1AGBA 5EU6A 4O2EA 4PJIF 4EZMA 3N85H 5C7XL 4XAWL 4UAOB 1G7JB 4WHTB 2D7MA 4I3SH 1XGRA 3ZTNH 1U8QB 4BQ8A 4RQQB 4EIGB 4DKFL 5DGRA 4ZNEA 2QHRL 4KH2A 1ZLUK 1MY7A 2DQCL 2ADIB 5EUOE 4CVUA 4C56E 1NGQL 1U8KA 3CDCA 3OX8B 4PJAF 1MCLA 5D7LE 5EBGA 1CZ8H 3VXRB 4MQ7B 4H1LA 4PGBA 2YA2A 1P4LB 2Z8RA 4LHJB 4NQEB 4D3CL 2JLLA 3HZMA 1UJ3C 4BZ2L 5IW6A 2R2CA 4FQIL 4K3HA 3TLRA 5C1MB 3SKMB 4F3FB 3MYJB 3QUXC 1CDUA 1OTSD 5EU7E 1FJ1B 4YHZH 1S7SA 1UVQA 1AGEA 4K7PY 1MIEH 2AJSH 5CAYB 5GRWA 5DD3H 1A64A 3LZFH 3MLPA 3SDDC 3QRFM 3BD3A 3L3IA 2D0GA 1Z9MA 1IC4L 3KPLA 1QEWB 3RGVD 4GBXD 4OQ1A 2X4RA 3W0WA 4AENB 2ZKHL 2JCCE 3DVGA 5CD3B 1N3NA 4KJQC 1UJ3A 2JK5B 4X9BA 5E8PB 3BPCB 1UXWB 3LKNA 3TIDB 4QOKA 2A9NH 4G6FD 2Z8VC 3UO1L 3HC3L 1LHZA 1Z9OA 3CUPB 2IQ9L 1UCBH 2QSQA 2AJYL 1FL6A 4C58B 1MFDH 1YEJL 1XGQB 2X1QA 4IBLT 2V5RA 1RURH 3A67L 1ZV5A 5DUPH 5JIPA 2NY6B 3VGAC 5IR1B 1CGSH 3BKYH 5A16A 4G7VL 4NQXA 4HUNB 4KDTC 3EUUA 1TCRB 4ZPTA 2JELL 4H5SA 4OZFH 4WU5B 3S35X 4XNUH 4QT5A 4U1MA 4HEPG 1I9JL 1NKRA 1IAIM 3MV01 4FFYH 5IQ9A 5TPWH 4KRMB 4J4PC 2NY4D 3L3OB 4XPHH 4PP2A 4OF6A 1MCKA 4Y2DC 3FKUS 3RIAF 1QRNA 4ZG1A 5KSBF 5L9DL 5C0CA 5B38G 4R4FL 3SDYH 3ARQA 2HH0H 5EBLB 4CU8A 3DHMA 4U0RB 3WXWH 3ARGD 5ADOL 4FG6C 1M71B 1FGVL 1A9EA 2FBJH 3NTCL 4PJDE 4KDTA 3BZEB 1WVZA 1ULVA 5MEPA 5ICYB 3F7VA 1GGIL 1J0YA 2IH1A 4I3RH 4IRJD 2VDOH 4OFYD 4PLJD 4J4PA 3H9HB 4TNVK 5C8JA 1FNSH 4EI6A 1MEXH 1A6UH 1OGAA 2CIIB 5DMKA 4U1SA 1TQCB 4Y2DA 4FQCH 4A2LA 4LQ1A 3D39B 3CC5B 4PJGB 2VR9A 3SDCC 2X4SA 2FATL 4K3DH 1CE1H 4X6CA 4A6YB 1FYTA 4QHNA 5B3JF 1N59A 4P5MA 4J8RA 1ND0B 4QTIL 1RIVL 5KN5A 1QP1A 3PXJA 4XMPL 1T22B 1GGBH 1P7KB 2VSDA 5LWYH 5DHVA 1J8KA 2VXSL 3IKCA 4U1GC 3UTSB 1A1OB 2ARJA 5H8DA 3MBXH 5E94A 5F88A 5DRNB 1RUQH 2HVJA 1B9ZA 5EZOL 3U7WL 3D85A 3EJYC 3MNZA 5FYLH 1JGDA 5F7KC 1NGYB 4MA8H 5C0FA 2XIDA 5KANI 2GJZA 3SDCA 5J56B 4BQCA 3CSPA 4NGHH 5C0GA 3H9ZA 1LO0L 4MXVF 4WO4D 1Z9LA 3IDGB 2AQ3A 2W60A 4QGTA 1RJCA 2VXUH 2VLRA 1PAMA 3WFHA 1T80A 3PL6D 1IKNA 4RFOL 4Y4FC 5HHPA 2HVKA 3EDKA 1BREA 1JNHA 1IARB 2FJFB 2MFNA 4ODSH 2AW2A 2R15A 4GKSB 1GOGA 4FQXC 4X7EC 3DURB 1DVFA 3BZ4B 3QJHB 2O5YH 2QADD 5KS9B 1Y6KR 3LN4A 3DRQB 3RHWK 4DN3H 3BP7B 5EG6C 5I16B 1AGCA 1OSPL 4XBEL 4YO0B 3LEVL 2HFFA 2R8SH 1GZQB 4JY5H 3VFOA 4Y5YB 2Q3AA 1QKZH 5DK0A 1A6VH 1EJOH 4LRIC 1AR2A 4X9IA 1I1RA 2ZG1A 4Y4FA 1WWWX 4Z77B 2FJGA 2IANB 4PJCB 5C7XH 2DBJA 4FQXA 4LCUB 4JFXA 1BX2A 1R3JA 1SJEB 5CBAB 2CK2A 1QACA 4YLQT 4QHLA 2J6EA 2HYMA 1YN7B 2L7JA 2DQFB 2CR6A 3BH8B 2DL9A 4HH9B 3GUTB 1CVRA 1RZJH 1WAAA 4DKFH 1PQZA 1UWEL 3KYMB 1X5FA 1PGRB 1V3JA 2VDNL 4WWKD 5IGXL 1RZKL 3L5JA 2VDML 4DKAA 1DLHB 4HW6A 4LRIA 2E6QA 1OM3L 1FG9C 3OKEB 4F7TA 5E5MA 5A1AA 4JPVH 3GSXA 4JE4B 4M1DL 3IDXL 3MRRA 4O9HH 3E6FA 5JDJA 4KUZH 2B2XL 1NMCC 5JPMB 3WUWB 4FXKA 3BN9C 3BP4B 3K7UA 1D6VH 3DXAB 5KOVC 4JLRA 3C60D 4NKDA 4NQCB 4PJ9B 1HCVA 5TF0A 2BP3A 4KI5C 4YBLC 3D6GA 3BKJL 2E7HA 3IETB 4YGVA 1S7TB 4TNWK 3DPBA 3HC0A 2VMFA 4N8VG 1NCTA 4WHYH 4P48A 4HGKC 1MJ7L 4RMSA 2ZKHH 4PRAA 4B7IA 4C56D 3K4ZA 1JYVA 1ZK9A 3PWNA 3ORJA 5D7LD 3QNYB 3A6BL 3ES6A 4PRIB 1JWMA 3UZQA 1EEQA 3ALWA 4UDUB 3UO1H 3HC3H 4GAYB 2BERA 1YZZA 1P2CA 2AJYH 1INEL 2DBLL 1YEJH 2WV3A 2PR4L 3EZ8A 4MJ5B 5ECJE 3SKJH 1QSEA 4HS6A 2FIKB 4Y1AA 1FBIL 5DMJB 3RL1A 3BIKA 3O3BA 3ARFD 3CFIC 1AIFB 2JELH 2FD6L 2R56L 3C2SA 3T2OA 1KYOK 1K4DB 1G7JA 3LVEA 4WHTA 2ICWI 3K4DA 1HHJB 2RFXA 3PQYB 4NC1C 2AAVA 3DECA 2DLIA 2Z8WC 1MCWW 5CJ5A 4HBQA 4RQQA 5BRZE 3L5IA 4E41A 5L9DH 1S9YB 2UY6A 3KLHC 4OUOA 2ADIA 2GJJA 4R4FH 4JFFB 2Q20A 2MHAA 4G8FB 2J7LA 1TDQA 1DFBL 4MQ7A 5AZEH 4JVWA 4LDEB 3H9SE 3QEGL 1J87A 1IEAB 1YY9D 1UCTA 1JF6A 1FSKB 2XACC 5B4MC 4LMQE 3SKMA 4F3FA 3MYJA 3MUJA 5GJSL 1GGIH 1FJ1A 5T33H 5CILL 1WIOA 4M48L 4EBQL 3CFJA 1YY8A 1T0NB 1XGYL 2OL3A 2A6JB 1S8DB 2YKLL 1QEWA 2D7OA 2FATH 4PRNB 2EKJA 4LLQB 3VFVB 3SKOB 1YEEL 4YQXH 3GSUB 3GKZA 4GMSL 1BD2B 3BPCA 1UXWA 3TIDA 5GS0C 1GL4B 1RIVH 1AD0B 4K55A 1RJZB 4NQSA 4Z7UF 1N5AA 4XMPH 4R4ND 4OIAA 5BVPL 2VXSH 4XCFL 3WNLA 4N0RA 5E8EA 4MYWB 2BY3A 4O4YL 4CVXB 4ODWB 1TETH 5E6YA 5EZOH 3KXFE 1SY6L 2BMKA 3GB7B 3ULVF 4Z6AT 1NUFA 5DD6B 1BM3L 5DHYB 1ZA6B 4K3EL 2WW8A 1TCRA 3GHEL 3S37H 4HCRA 2W0KA 4WU5A 4P46C 3ULUE 3CLFH 2P24A 4NN7B 3X3FH 4RFOH 1HH6B 1IGYB 1KEML 2JB5L 1G7PB 3WHE1 2ITDA 4FS0A 3SJVB 3D9AL 5JIIA 4LU5H 3DMMB 5B22A 2DIAA 2R2EB 3ARPA 2YD2A 5EBLA 4G6MH 5HDOA 1IT9L 4S1DD 1P84J 4LLDB 5IG7B 1OSPH 4Y5VB 2GTWA 2KKQA 1M71A 3GMPA 5K93A 1LMKA 3RJQB 3BZEA 1BVKB 4XCCL 4MNGA 2B7DT 3PUCA 5ICYA 1EV2E 2ZUYA 5I75B 3H9HA 5I15L 4EOWL 1T20B 2CIIA 2CRMA 1UYWH 4O2CA 1HYRC 3SCMB 3UTQB 1H5BB 4GKNA 1A0QH 2ZNWA 4PJHB 5HDLA 4D0DB 1PG7L 5C0NC 1FAIL 4UUJB 4OM0L 5CJOL 4NUGH 5E6ID 4MSWB 2BCKB 3SGEH 1A5FL 4WEMB 3U82B 1ND0A 1RZKH 2XQBL 5ALCL 5I8CB 2AXHA 5FA4B 2LAGB 4ENEC 1P7KA 1OM3H 5MEOB 3H0TB 2WSKA 5FGSA 1A1OA 1P6AB 3P40A 5D93B 4IOSD 4NBXB 5KVDL 5DRNA 1FO0A 3SDAC 4M1DH 1NAMB 3IDXH 1WEJH 1U92B 4YHOL 5HHOB 1NGYA 4HLZG 5DJAB 1GOFA 2B1AH 3CDGB 3R4DA 4RWYL 3ME0A 2H45A 3IDGA 5D1XB 1S5HA 3RUGB 3JTTB 1U3YA 2YWYA 1F58H 4G8EA 3BKJH 1KLUB 4UQ3B 3JTSB 4JY4B 1J8HB 3MLWH 3CU1A 4GKSA 4JJ5A 3N1GC 1MJ7H 3DURA 4LPVA 4ZUUA 3BZ4A 3QJHA 2DM7A 1QSFA 3DRQA 1NKOA 4AQ1B 2EYRB 1QBLL 5I16A 1ZVYA 4OI7A 5D7IF 4YO0A 1JPST 4XBGB 5HYQB 1HHGA 1GZQA 1FDLL 1OTTD 1V7ML 2J4WH 3VE0A 1INEH 5FGBC 5D9SB 3CZJA 3MRNA 4X6BB 4S1RH 1KTDB 4XPBH 1K3IA 5F71A 5I1GL 3FQUA 1FZJB 1MF2L 4ZOAA 3OZ9L 4QEGA 3JWNC 4Z77A 5GGVL 2IANA 4PJCA 2FD6H 2R56H 3QDHA 1N0LA 4WW2C 3SHSA 1DBKL 4KUCD 1SJEA 5HI4C 5CBAA 3QCUL 2DQTH 1QFWL 2X4NB 1YN7A 4PRPB 2DQFA 4ODVL 3BH8A 2KQMA 4HH9A 4RRPG 4X4YB 3QQ4B 1F42A 3RWIB 1NDGA 3KYMA 1RIHH 5IJKA 3AAZA 5AEAA 2WBWB 2APBA 5KSVA 4JQVC 5EZJB 3U4BH 5FGBA 1DLHA 3TT3L 4P59L 3F7YB 3OMZA 3OKEA 5LGKA 4U3CA 2EH8L 3VFRB 5EOCL 4NJAH 3QEGH 3BT2H 4OLEA 4QXGL 1B90A 4LPUA 4YDLB 1WZLA 4WW2A 3OKNB 5L2KE 2B4CH 3T1FB 2L4OA 3QHFH 4JKMA 5TDNA 1A4JA 5JPMA 3LN5B 5L6YL 3RZCB 3BP4A 5CILH 3V4PH 5IHUH 5DURB 4WRLA 2NY7L 4PY7A 4M61A 2YPLE 4EBQH 2DF3A 3KPSB 4HMDA 3E1F1 1XGYH 1M4KA 3RPKA 2YKLH 4JQVA 4WGVB 1PYWB 4KRNA 1YEEH 1KB9J 4GMSH 4KHXL 4U4BA 2NXZB 4NWTL 3B9KB 4TULL 2Y5EA 3OR6B 3L5WB 4PRIA 1RV6X 3VI3E 3DV6B 5BVPH 2IADB 3H9SD 4KDVA 5CZVH 4XCFH 3RTQB 5CMAB 4R6UA 4GAYA 4B7LA 3VFMB 2DAVA 4O4YH 3WJJC 3KNBB 2D31B 3QIWC 4OCYL 5DEGB 1SY6H 3MRFA 2DQGL 1FC2D 5AZ2L 4R7DB 3RX7A 1UKQA 4S2SB 4OZGE 4LP4A 3SGKC 4OV5B 1BP3B 4X98B 2O26U 4OM1H 2X9XA 4DZ8B 4HIIB 1HHJA 1FFNB 3KPOA 3PQYA 1MFAH 2X7LA 4NM4H 2HJFB 3LH2L 3ZE2F 8FABB 1FFRA 1IC5H 1JPFB 4OQTA 3B5GA 5IW3A 5JORB 3VGHA 4WI3A 4FZEH 3RDTC 4JFFA 1YPZE 3QIWA 4J3VA 3TT1L 1IT9H 1MCWM 4OJFH 1DQML 3LQAC 3T3PE 2F54E 5EO1A 3TBTA 2XZCL 1F3DJ 1SVCP 5KVEL 3UTOA 4MGXA 3NZHH 4G8IB 3SGKA 2I24N 4KK8C 1X9QA 3KLDA 5FCUH 4P3CL 2C5DC 4L8CB 1YEGL 4FQ1L 5DR5L 2VLLB 4YUEH 4QWWD 3ULUD 3BPOC 5SV4A 5I15H 4EOWH 1OAUH 5HGDA 1IAOB 1R3KB 1TTFA 2BSTB 1G6RH 4EUPH 1T0NA 2R23B 3ZMRA 5D1ZC 1OLLA 3DSFL 2VXVL 1S8DA 1FAIH 2CK0L 2AI0H 1AGFA 4ZOCA 5CJOH 3JWOC 2ENYA 5F9AC 4PRNA 3V4UL 3VFVA 3GSUA 3UPAA 1EEYB 3WIIH 5BV7B 5FYKU 2ZCLL 1CFNB 1DCLA 3OGOE 4ZUVB 3P73B 1HWHB 1MFCH 2JE8A 4HZAA 1OAZL 1XZ0A 1YMME 2CRZA 2C26A 4CVXA 5KVDH 3TNNB 4ODWA 4N9OB 4POUB 3GB7A 3BJ91 5IM7B 7CGTA 4OKDA 1AH1A 5EO9B 4AEIH 4YHOH 5DD6A 3BKCH 2PXYC 1LO2H 2EDOA 2R9HD 3MRPB 2YR3A 2BSSB 3BW9A 1HH6A 1J86A 4FXLA 1G7PA 5F9OH 5L0QC 3INUL 2J88L 1EO5A 4PGCB 4JR9L 1GJIA 4L29B 1UZ6F 2R2EA 5JOFB 2EDHA 4YK4C 2VR4A 1KTLB 1JPSH 4PJFE 5HHNA 1AR1D 4LLDA 4L4JA 2C4FT 5I2IB 5KG9A 1XMWA 3QIUD 1BVKA 3MROB 5JW3H 2DQIL 5HHQB 4OD3L 5I0DA 4Z7QE 3HAEB 4I2XE 1REIA 4Z0BL 3GNMH 1OP3K 3NA9L 1MF2H 4TVSa 1F2XK 3TO4B 4RCAA 3BMWA 3UTQA 1DBKH 1I9RH 1S9KC 3TN0C 3QCUH 2EEDA 3UJJL 3V4VL 2CKBB 4IIQB 4PJHA 4D0DA 1FZOB 2ZSWB 4CUCA 5I1HL 4NQDB 2M26A 2RCSL 5F44A 4MLIA 4M9OA 3TCLB 4LNVA 3FQTB 1KIRA 2MQ3A 2AJXL 3K81A 3X3GL 2V5YA 3FRUB 5DJDB 4IOFC 4ODUB 2I5YL 2BNRA 4OGYL 5I8CA 3VXME 5HPMA 1IGFH 3UTZA 1GRWA 4EQ2A 3H0TA 4LRNL 3HUJB 4XVTH 4Y4HC 5EFIA 2EH8H 2QSCL 4I0PD 5J6HB 2ZUWA 4QXGH 1NAMA 1OSZB 1U92A 2AKRB 1K5NA 2H8PB 3VXSB 1XF5B 2Y7QA 3EOTL 4LAQL 4X4XB 5EC1B 4Q74A 2C3GA 4UILL 4YJZL 3RUGA 3LD8B 3JTTA 1RD6A 1S7VB 3SGDH 5AAMA 25C8L 2BY1A 2VABB 4UQ3A 3JTSA 2EDQA 4JY4A 1J8HA 4LSSH 4ETQB 3D48R 4HD9A 4Z7NE 1CL7L 5JXED 1DN2A 1WTLA 5A2KH 4NWTH 1MAML 4MCZB 3MNVA 3SO5A 4TULH 5IFHL 2JJTC 5TE4L 4OF0A 2EYRA 1UG9A 4HUWB 1MUJB 4MMXC 3BVNA 4XBGA 3FRPG 5L2KD 1H8NA 5CZXC 3S3SA 1MRFL 3QXAB 4ETYA 2EEBA 5CEZE 4ZFOA 1TZIB 4J2XA 1FZJA 4U1NB 4LVHC 2ZG2A 2P5WE 2YPLD 1OQXA 2WLZA 4YDLC 2V2TB 5IFAL 2EZ0C 5EZIH 3T2NL 3LB6C 5KVGL 4OI8A 3RKDC 4CGTA 4GAJH 1UWGH 1Q0YH 1DQTA 3ZE1E 3Q6FB 1MCCA 2R0WL 3R8BB 3VJ6B 2XQYK 4X4YA 4XPAL 5DS8B 4K9EL 3QQ4A 5GRUL 2XFXB 3DYPA 3RWIA 1J12A 4LSDA 3PWPA 4PJ7A 1EX0A 4J7RA 1BJMA 5ESVB 1RPQA 5CHNB 5EZJA 4K23H 4QNPF 4N0UA 1WV7T 3HMXH 2D4DA 2F53E 3F7YA 1DQMH 3CXHJ 3WS3B 2XI9A 2NXZC 4GRLB 5KVEH 1ES0B 1LDSA 4UQ2B 3OKNA 1DUYB 4ZXBD 3T1FA 4HUVA 4JDZB 5DR5H 4NP4L 3LN5A 2LVEA 3RZCA 5MENE 2HN7B 4OGZA 1HZHH 5FYJE 2F15A 3QUMH 3FB6A 2HTKD 3KPSA 4YFLF 4PB0L 4RA3A 3DSFH 1CXLA 4M8VA 4PV8B 1TTUA 3NMEA 4YR6B 1PYWA 3V4UH 1GYAA 2KDGA 1D5XB 2ZCLH 4M7ZC 1JNJA 3OR6A 3L5WA 2YC1B 2F54D 2XG4A 3EGSB 2MKWA 3DV6A 1PD6A 4KPHL 2IADA 1EHNA 1KPVA 1FCCA 1OAZH 5CMAA 1ORSB 3ZYIA 1ORQB 3KNBA 4U3HA 1VEPA 5DEGA 2DLEA 3HPJA 3HZKA 3IRPX 4OZHF 2IWGA 4UDTB 3UDWC 4R7DA 4RISL 4K8RL 1P84K 4AIOA 1WLHA 2VUYA 3ALPA 2IPUG 2GFBB 1EAPA 4NQUA 4HIIA 4DZ8A 4Y2OA 2XNAA 3PWVB 3RGVC 1NEZA 2ZSVB 3OPZH 3N1QC 4GG6E 4PTUB 4KGLA 1JPFA 4ZD3L 3WJLA 5E8DL 3BP5A 3GMMB 5JORA 5KVFL 3UPRB 1I8MB 3QDJE 4C4KO 5C08B 4KQ4L 2PW2B 1VADA 3GM0A 4LPXA 1YMMD 3UDWA 4YZFE 1MI5E 3MRIB 3D0LA 3KPPA 3FO0L 4ZAKD 1PY9A 1Z5LA 4G8IA 4GKOA 4OD3H 4CW1B 3C08H 5FFLA 4L8CA 4OLYH 3VH8B 4Z78B 4L4VE 4Z0BH 3ZE0E 3WYRA 3E2HC 1R3KA 2BSTA 4LK4A 3QXTA 2NY4C 2RIKA 4FQ2L 5DJZA 5T1LB 1OD7A 3SGEI 3RWGB 2R23A 4D9LL 2IALA 3V4VH 1U9KA 3N50A 3O2DL 2G2RB 4I48A 5J0BA 4JEGB 3TA3D 3TJHD 1EO8H 1T2XA 1S7UB 1T03H 1EEYA 4JO4L 3E6HB 2AJXH 1NCCL 3DGGA 1SBSH 4OGYH 4ZUVA 3P73A 4OZIA 1DQDL 2DQHH 2DYPD 4KRPB 5J12B 5IKCB 1YYML 2QSCH 1FRGL 2P8LB 5GSRA 3RVVD 4IRJC 5AG9A 3UEZA 3JV5A 4JREB 4F15C 4PLJC 5E2UL 3EDEA 5IM7A 5EO9A 1P7HL 4NC2B 3GK8H 1X5ZA 3WHXA 3RA7L 3P77A 4R2GD 3PABB 3VFGL 4UU9B 3AY4C 4UILH 3ULVL 4XZUA 4OCSL 3TBYB 5GS1B 4DK6A 3BOVA 4PGCA 1CL7H 5AG8A 2OJEA 5JHLH 4IM8A 4H26B 4TTGA 1WZ1L 4XWGH 5E9DE 4KK9D 3VXMD 2QQKH 4PJBE 3R1GL 3RRQA 1KTLA 5I6XB 1TLKA 4GKZB 5DD5L 5M7QA 4LGRB 5I2IA 5EA0L 1T2JA 5J3HD 1KCLA 1ZS8A 3RPIA 2UUDH 1P4IH 3MLTB 3TNMA 1AGDB 5HHQA 2HT3D 1A21A 2F58L 3AY4A 4IRZL 1MRFH 4Y4KD 1YJDL 3HAEA 4QTHB 3TC9A 5ID0B 3NFPB 1KCKA 1IM9D 1JL8A 3RIFK 2HWZH 5H2BB 3ZT5A 5I1DB 3C6LD 1F97A 1EZVX 4NNPH 4WI4A 3PL6C 4XBPB 1KLFA 1AFVL 3FCTB 5BMFH 1Z9SA 2JJUA 5IB5A 4IIQA 5DXWA 3VXUE 2ZSWA 2R0WH 3N1FC 2QADC 2NNAB 1A3QA 5CJQL 3TCLA 4KFZC 2BNQB 1X6LA 1WITA 5CZKA 5DJDA 1BZ7B 4HJJL 2P42B 4L4TB 1L7TH 5CINL 4V1DE 3ZDXE 3ARYA 5IVXB 4HBCL 3HUJA 1WIUA 4YHYC 3QRGH 2NX5B 3CK0L 4X99A 4D0CB 3PL6A 5JPNB 3BRFA 3HI6L 4NHUA 4GW4B 5CEZD 5DMYA 4MCYA 4PLOB 1Q0XL 2DQJL 2AKRA 4WI6A 5JR1L 2H8PA 2P5WD 3BQUD 4X4XA 1JRHL 2XXMB 1XAUA 3FQRA 5DK2B 2KBGA 5D7JD 2NY5L 4TSBL 1QA9B 4TVPE 4PB0H 2Y6SD 2WBKA 4L1HA 4WTZA 1KEGH 3LEXB 5D5MA 4UINH 4ETQA 2AS5M 4FFZH 3HE7B 4WWKC 1HSBA 5JUEH 2BSRB 2VDPH 3WN5C 2K3TA 4MCZA 4CBPA 4HIHA 4O02L 2F53D 1D9KD 3IDYB 4GUPA 4HFUL 4HUWA 1WBYB 4KPHH 4XNZC 1LP9E 1UH2A 1N64L 3CH1B 4KAQL 3O45B 4M7JH 3WS6A 3QXAA 3WFBL 1KC5H 5D2LA 4K8RH 1L0XA 5MEND 3O6FB 1S3KH 3DUSB 1L7IL 5FYJD 2V2TA 2QQLH 4WWKA 5CUSL 4Q58C 4MHHG 3WN5A 3BKML 2ORBL 4KVNL 4U7MA 3VFWB 4X6CF 3Q6FA 5DS8A 4JZNB 3F5WB 3UTTE 3L3JB 2XFXA 4JG0H 1IAIL 5E8DH 4HLZH 1BJ8A 4WUUE 5BQ7B 5IB3B 1JGUL 3ZDYE 2V7NB 5ESVA 1OT1A 3CSYB 3IFLL 3RKPA 1NCWH 2Z31B 4J3TA 3TYFB 4PRHE 4WFEE 5EU7C 4GRLA 1NC4D 1ES0A 1TCMA 5IEKA 2C1OB 5I19H 4JFQB 3ARFC 1DUYA 5BRZB 1SBBA 5KTEL 4JDZA 4P5KA 1G7MB 5F7YC 2VLME 1AP2B 2HN7A 1P9MC 5EUOA 3BZFB 4NT6B 5D7LA 4FQ2H 2X4TB 1KCRL 4D9LH 4OKVB 1HHHB 4TOYL 1T7XA 4QHKJ 2PN5A 4PV8A 4MAYD 4H1LG 1E0OB 4YR6A 3OBAA 3MCLL 2H32H 5I1JL 4X6EA 3SY0B 3QDJD 1D5XA 2DJSA 4JO4H 4WY7H 3QDGB 4M03A 5LQBH 5IVZB 3BEVB 4IRSB 4PLKD 2CQVA 3FT2A 1EXUA 3EGSA 1CGUA 4L8BA 5IB1A 1YY9C 1MI5D 2EDKA 3ARFA 3BD4A 4I5BB 1N8ZA 2ZG3A 1ORSA 1FRGH 4TRPH 4Z95L 4LLVA 2A0LD 3C5JA 5FF6A 2R0ZH 5FB8A 5E2UH 1UACH 4UDTA 4L4VD 3Q6GL 3LIZL 3O3DA 1RUPL 2JCCA 1K8IB 3ROOA 1Z3GH 1J05B 3VFGH 1HIML 2PTVA 4M6MH 1F3JA 2GFBA 2VDQH 1F45A 3MRMB 5SX5K 2ZSVA 1GXEA 1KGCE 2IG2L 4PRDB 4PTUA 1EERB 4WEBL 5D7KE 3SE9L 4KHTH 1KNOB 2DTML 3O2WL 3SE8L 3KXFB 4HUUB 3GMMA 4R4NC 5LGHH 1WZ1H 1F3DH 1D5IL 3R1GH 1V7NL 1ZLSL 5DD5H 1GHFL 3O4OB 2J8UB 1S7RB 5GHWL 3GJEB 3MRIA 3HNTL 4H88L 4OZ4B 3V5DB 2C4XA 1RK0B 5BVJB 4X4MA 3P4MB 4LCIL 4OCXL 2MCPL 3MOBH 5BS0E 4IRZH 1YJDH 1ZT1B 4Z7WE 4Z78A 4KVCL 2GY7B 4MB4A 3NZ8B 4FABH 2OYPA 4B53A 4OF7A 1U2CA 5T1LA 4Z7OE 5AWNL 3W82A 2G2RA 1KELL 4LVEA 1NJ9A 2ED9A 1LO5B 5CJQH 1S7UA 5E9DD 2BVQB 3CVHA 3E6HA 3G6JF 4NZJA 4S1DC 1UENA 5GS1C 4BFEA 5C07E 2AQ1A 1BLNA 1X4YA 4HJJH 1WC7B 3NN8B 3O8XD 4HBCH 4GMTL 1PSKH 4H8WL 5IKCA 4HGMA 1NMAL 2VLJB 5E8OA 1OCWH 3CK0H 5LGJB 1S5IL 3SGDI 4JVPA 4KI5F 5I6XC 5E24E 2VE6A 2YBRB 3KPTA 2DB8A 2GI7A 1WK0A 5HI5D 4CN4A 3A6CL 4PJXB 3PABA 1JRHH 3X12A 2UZYB 1MHPL 1EGJL 4EI5D 1RZIB 4D9RE 1AQKL 2NY0D 3PGDB 3P4OB 2BNUB 3TBYA 3VXUD 1GC1H 5GS1A 4JN1L 2VNCA 1UM5H 4RGOL 4X8JB 4XNQB 3O3AB 5HBBA 3RVUD 2EC9T 4FP8L 4HHAA 4R3SB 5CEZH 4M1GL 3QI9B 1C16B 3QIBD 3LDBC 4LDLB 3VG9C 4H26A 1Y18A 1LO3H 3BE1L 2NY1D 4V1DD 1TVBB 2E9BA 3GKWL 5M95B 5E99L 1I8IB 3C2AL 4GKZA 2ENSA 4LSTH 4HFUH 3QPXH 3PV7A 4ODTL 1PW3A 2AEQL 4AT6B 1YC7A 2AEWA 5EU6E 4CDGC 1N64H 4X6FB 4HDIB 3NCEB 3IFOB 3MLTA 1P4BH 4OB5L 5AYUL 3WFBH 1EDQA 1RUAL 2IPKB 5GISH 2OCFD 5ID0A 4LMQI 3NFPA 3V5KB 2NW2A 4MJIB 3CXDL 1A7BA 2FEEL 5H2BA 5I1DA 4R7NA 1L7IH 3GBMH 5B39B 3BRDA 1T6WA 3ARDB 3NIFF 3FCTA 1N5YL 4TVPD 1H0DB 5LBSL 4OUUB 5CUSH 3LV3B 5CJXC 1MHEB 3QFDB 2DM3A 3BKMH 4KVNH 4KI1A 4PS4L 3WSQH 5INCA 2HJLB 1IAIH 3KYAA 3DX8B 2X89A 1JGUH 5CGTA 4PJ8B 2CLRB 3IFLH 1BZ7A 3M17B 1HK6A 4DEPB 4PR5A 2FLBT 5FYJH 4BSJA 3HE7C 1OTTC 5ITBH 5EBWB 4TVPL 1HEZA 5DZOA 2NX5A 4Z5RA 2DICA 1CFSB 4D0CA 1JZ3A 4U6TA 1KPUB 3MXVH 3S8WA 1A6TB 2B1HL 3BP6B 5CJXA 3GMRB 1LEIA 3GGWA 4NKOB 4M6NL 3EYFB 3QEQE 3O6LH 3W0WE 3HS0A 4GG8B 1IILE 1QA9A 1V3LA 4QOKE 3FAWA 3T0AA 4JHAL 3QJFB 2I9LA 3UTTD 3QHTC 4G9DB 3DX7B 3EO1A 1X5AA 4JKKA 4WUUD 3PJSB 3HE7A 1ZEAH 5I1JH 4P2QB 3VA6A 2BSRA 2JB6B 1MCIA 1ZLVK 5E4EB 2DDQL 5J13C 2VZ3A 1ZHLB 1W72B 5C70A 2MOVA 4PRHD 4WFED 5DJXB 3X11B 1OB1B 1FNAA 4OZFB 3BRGC 2DM2A 2IQAB 5KSBE 4WUKL 3CH1A 4XP6L 2AQ2A 2XZQL 3O45A 4Z95H 1KB5H 1CG9B 4LNRA 1Y6NR 3ZHLA 2Z31C 1U8JB 4FFWD 2VLMD 5GGUB 3MV11 3Q6GH 3LIZH 1KV3A 3UC0H 1RUPH 3O41B 3DUSA 1F90L 2AK1H 2NR6D 1QRNE 5C0CE 2OSLB 3G5VB 1J0JA 1L9NA 4JKPL 4XVSL 2MJWA 3VFWA 1WZKA 2IG2H 2NTFA 4DCQB 4JZNA 3K3QA 3F5WA 2X4OB 3SE9H 2DTMH 3SE8H 3L3DA 3O2WH 1PDKA 3I3DA 4U6VL 5IB3A 2V7NA 2XWBB 3KHQA 2HT4D 3S7GA 1JZ7A 3CSYA 1JJUA 4X6DF 4Y16D 1H3XA 3B2UD 1ZHBB 3AU1B 1V7NH 2Z31A 1ZLSH 1L6ZA 1GHFH 3KLAB 5GJTL 3HNTH 4PJEF 3BDXA 5I1KL 3UBXB 4OCXH 5FCSH 2MCPH 5CKGA 3I2CH 4JFQA 5D96C 5BRZA 1G7MA 2HA1A 4OSUL 4K94H 1AP2A 3BO8B 5CCKL 3BZFA 4NT6A 2X4TA 1KGCD 5JW5B 1BQLH 5AWNH 1OLZA 4OKVA 4QRRB 1HHHA 4KKAD 4JB9L 3H9SA 4LFHD 5D7KD 4AJ0A 3OQ3B 5IOPB 1S78D 2YZ1A 2HTLD 4WENB 3MFFA 3B3IA 5DDHB 1IGCL 3V7AG 4HKXB 5IVZA 3BEVA 4MDJA 3ARED 2K1MA 2CDGA 2OR9L 4P4KB 4I5BA 1F4XL 1FL5B 4YHIA 2YD9A 2QKIB 5BS0D 4WI8A 1BF2A 2VLRE 3G5ZB 4QWWC 3ULUC 1QLFB 4L3EE 1UM6H 4H0HB 3QDMB 5CS7A 5DQJB 4AIXA 5GRYA 2EO1A 1CL7I 1B4JH 3LKQB 1T7YA 1HWGB 1FVDB 2ED8A 4KZEH 2D7QA 4HEME 1A7QH 2DMBA 4JN1H 4LSUL 4RGOH 5DVMA 3T2QA 3UPCA 1BQHA 4TQEH 3KXFA 4HUUA 3I6GA 4UB0H 4M1GH 5F1IB 2MSPA 1N2RB 5C07D 2P48B 2NY2D 2IAMB 3GKWH 3LY6A 1MFNA 3P11L 1F6AB 3H3PL 4ONOA 4W6WB 5T3XL 1JNNL 3QXDB 2FJHB 2AEQH 2J8UA 4KY1L 5F6IC 1S7RA 3WXVL 4OZ4A 3V5DA 4WW2F 4R4BB 1RK0A 1CVSC 3FZUD 5BVJA 3P4MA 2PYEE 4OB5H 2OQJB 5AYUH 1RUAH 2R9HC 1ZT1A 2GHWB 1FH5H 3U30C 4J3XA 1FZKA 4YHKH 4WI9A 3I75A 3NZ8A 1WAAE 5K33A 5GGQH 1KJ2L 4G9FB 1PZ5B 4W6YB 4D9RD 4KROD 2F8XC 3S88L 3V5HB 4DOHB 1A6WL 3PWJB 4RMWA 2YUXA 3SBWC 1JYXA 1OP9A 3QISA 3T65B 3MLVL 3Q5OA 1I7TA 1FORL 1LO5A 1UA6L 4EKXA 5HYJB 5L7XH 1AR1C 1MHHB 2LV4A 2XA8L 3T0WA 2XKSA 3VI4E 1BECA 1T21A 1HH9B 3QHZH 3QIUC 5EU6D 3EYSL 4P2YA 4TVPH 1XGTB 3ELAT 1HHKA 5ETUB 3VWKB 3MXWL 4GOSA 1X5HA 5LGJA 3FT3B 4QRPB 2YBRA 2ESVE 32C2B 2B1HH 1MCQA 3AGVA 4MQXC 3HCVA 1M1SA 4PJXA 5DC9B 3HMWH 1INDH 2OJZL 3K74B 4BK5A 1KULA 1JI1A 1IGML 3PGDA 3P4OA 2BNUA 4Z76B 4HS3A 2VAJA 4XNQA 3ZZ1A 4QRQA 4R3SA 5C2BH 4QF1B 3ARZA 3QI9A 4APQB 3IXAA 4UTAL 4PUBH 3CCHB 4S10A 4LOUD 2VDRL 1TVBA 2C1PB 1QSEE 1JTPA 4I0PC 2AJVL 1YNKL 5HGGS 3BUYB 5EZLB 4AT6A 1PG7X 4YPJA 4OV6F 4X6FA 5C0AB 1QFOA 1G7LB 2DTSA 2D3VA 3IFOA 4DEPC 4HG4J 2IPKA 3MC0A 2OI9B 1EO7A 3V5KA 3QEQD 5D7SH 4MJIA 1NGPL 2P45B 3W0WD 3S4SB 3DO7B 1FIEA 3EFFB 3VFNB 3FB8B 1FLTX 2IFFH 2CUMA 3ABZA 1H0DA 4QOKD 3VXOB 4OUUA 1JV5B 4JQIH 4XXCC 3NIGF 2Q87A 5BZDB 2OS7A 1QNZH 5JXEC 3DYOA 5J11C 3VXRE 1MFBL 1NGWB 1BMGA 3QQNA 4NQEE 4I0PA 4HQQL 2HJLA 1ZT4A 3OJDB 3DX8A 4U1HB 5I73B 4U6VH 3M17A 4JFZL 4OTXL 2SEBB 2BY2A 2CXGA 3EYVB 3W9DB 2AXFA 4BKLB 5I1KH 2A73A 1KPUA 4I18B 4KJQD 1DTUA 4U6HB 5GIRB 3GSRB 3GMRA 3GHBL 4JN2B 4XPTL 12E8L 4OSUH 1QRND 4MD5A 5C0CD 3TBWA 4WJ5B 5CCKH 4GG8A 3NA4A 1C7SA 3MRCB 3OJ2C 4JB9H 1GIGL 1VGKA 1E6JH 4G9DA 1CGXA 1MNUL 3VD4A 3QEHB 3PJSA 4JPKL 4P2QA 1OPGH 1DJSA 1U0QA 3VXNA 2JB6A 4RMQA 4X9FA 3TZVB 2YD6A 3BMVA 1ZHLA 1W72A 3ZHKA 4ALAH 1FPTL 4AQOA 4BELD 3STBA 3X11A 5DJXA 4OFKA 1JBJA 1OB1A 2YPLA 3OKLB 2IQAA 2YN5A 4Y2DD 3UCRA 3AFLA 3GBNL 4TSAL 1PEWA 1QBML 4ZXBC 4HUXB 3QQ3A 1CG9A 4CVZB 5CJ8A 5DEFB 3IAGC 3PP3H 2DQDH 4NCDA 3O41A 1FYTD 5CIPA 2LQRA 2HTKC 1LE5B 1H3GA 4UT7L 4MX7A 4OIIH 2OSLA 5FGCB 1FFPA 3G5VA 1TPXC 3LKPB 4X7CC 4YHLL 5GGRB 4LSUH 5EU5B 1BEYL 4DCQA 4S0TD 2X4OA 1Z0MA 3IDNB 5I9QB 3D85D 3JZ7A 2X2YA 4JFHE 4EJ1C 4MZ2A 3S9DB 1ZHBA 3AU1A 1MCSA 4RFEB 5D72L 5KJRL 4NKMB 1IGJA 3T77B 1QFPA 3KLAA 3WXVH 2VLRD 4CKVX 4L3ED 3UBXA 3QG6B 1ZGLB 3D39E 4P4KC 4XP9H 4PJGE 2W91A 3BGMB 1JGLL 4YBHA 2EDLA 3ZKXB 2EKSA 4MNHA 3WD5H 3BO8A 1DVFD 1Q9KA 2XV6B 1KJ2H 3X13B 1B0GB 4Q9BA 4TUJA 4PTTA 3S88H 5JW5A 3FO1B 1X5LA 4QRRA 3EJYD 5KAQF 4Z7VF 1DBBL 3MLVH 4ZFFA 1QHPA 3MRKA 5DFVC 3UTSE 1ZTXH 1RSFA 2IEPA 4AG4H 5DDHA 4YE4L 2GK2A 2XYCA 3MO1A 4HKXA 1QSZA 2XA8H 1MWAB 4ZS6D 3D3VB 5C6WH 3GRWA 1A9BB 4P4KA 1XGUB 3ARUA 3EYSH 3MV9B 1M05B 3JV4B 1FL5A 1JRHI 2QKIA 5GRJH 2PYED 3EIFA 4NJ9L 1VFAB 4QRTA 4ZTPH 2ZOKB 4HIXL 1VACA 2AABL 4LCCC 1QLFA 4GRWH 3MLSL 4NRXA 3BEWB 5JNYB 3OB8A 2IBZX 3HR5A 2BOCB 4KMQA 3P30H 5E7BA 3F58H 1XH3B 5DQJA 3ZDZE 1W0VB 2OJZH 3DSNA 3LKQA 1TJGL 3R06B 5ACZB 5KS9E 3QPQC 3QNZB 3TA3C 4KQ3L 3TJHC 5DYOA 2O61B 1YMMA 4HFWB 4PJ7F 5F1IA 1N2RA 4WV1B 1CDHA 4GXUN 4UTAH 3C5ZB 2W07A 4F9LC 2VDRH 1V8HA 5HHMB 1JN6B 3OAYK 2IAMA 3CX5J 3MUZ1 3KS0J 3B9AA 1ROWA 1QFUL 5CP3H 1S9WB 1I9IL 3QXDA 4K71B 3RVVC 2ZCHL 2FX7L 4YC2C 4RDQF 2OZ4A 3VWJB 2ZUVA 2P43B 2NZ9C 3MBEB 2IANE 4PJCE 4HJ0C 4R4BA 4ZDHB 4H1LH 2ESVD 5HGBB 1NFDB 4MXWL 2OQJA 4R2GC 1ZANL 2EXWD 1NGPH 3CZFB 3SKUD 1IAII 1PZ5A 4OI9A 1PFCA 5I1EL 3KR3L 4JFEE 3W81A 3V5HA 3FOMB 3S98A 3PWJA 1U58B 4F9LA 3K80A 5IF0B 2A38A 3F65A 1MCDA 2DYPA 3QUYD 1MFBH 5DQDL 4BH8B 1A6PA 4HQQH 4KK9C 3BN9D 4ZUTB 3M1BA 1EH9A 4F33B 1KXQE 5E0QA 5HYJA 4M00A 5IWLC 5J6GB 1QSED 1B2WH 1MHHA 5J3HC 3NVQA 1DUZB 2F19H 4Y19B 2GW5A 4OTXH 5IEHA 4G6KH 1HDMB 1MCBA 1UWXH 1XGTA 1RUML 4LGPB 5ETUA 2HT3C 3DXAE 3U4EB 4Y4KC 1JGVL 2L7UA 3FT3A 4HXAL 4NQCE 2HRLA 2D7TH 1CBVH 3C6LC 3ILPB 32C2A 1HNGA 2AK4B 4LHUB 2VOTA 3GHBH 4XPTH 5E2JA 3VRLF 2CLZB 2F5AL 12E8H 4OLUH 4DKDC 1G9MC 1FE8L 3O11B 3KPMB 2V2WA 2OI9C 2BHZA 5A2LH 5IWLA 3VXRD 4ERSL 5E6ZA 4C83B 4PRIE 4F7PB 2VYRE 4G80B 1GIGH 4NQED 3U7YH 5DD0H 4JPKH 1RZ7H 3PDDA 4LKXB 4C57C 4L8SC 3CCHA 3IU4L 1NGZA 3I85A 5DQ9B 2C1PA 4JG1L 4JZJC 1IM9A 3ZE2E 4HC1A 1FPTH 5HGAB 2P8PA 3QZWA 2W0FB 5I73C 3BUYA 3MJ9A 2EE6A 1AC0A 4TSAH 3GBNH 1QBMH 5C0AA 1G7LA 4BUGA 4OCRH 4P49A 1A6ZB 4NBZB 3LKSB 3RHWF 4AH2B 1EFQA 1HCFX 3OAYH 5D7JC 1Q94B 3S4SA 3V0AC 3DO7A 3VFNA 3EFFA 3C09B 3DI2B 4UT7H 1MREL 1P53A 3VXOA 1YEFH 4AEFA 3O6ML 1U3HB 1UB6B 2DKSA 4JFFE 5BZDA 3PF2A 1BZ9B 6FABH 1BEYH 4ONFH 1QO3B 4ORGB 4LEOA 2OL3L 1GZPA 3OJDA 4U1HA 3RNKB 3H7LA 1OAYL 4HIJB 3REVB 2QV2A 2NY6D 1LDPL 4OZIF 1C5CL 2K9UA 4WDIB 3SDXF 5D2NB 1XR9A 2P5WA 3VD9A 2AERT 2P5EB 2BDNL 4RSVA 3EYVA 5D7JA 2HLAA 4HWBA 5HY9A 4BKLA 1A4KB 3V6BR 5DHVH 3NABL 4I18A 3VGBA 4JFPB 5GIRA 3GSRA 3ET9F 1YEKL 3RU8H 1Q1JH 4DGYL 4JN2A 2R4SH 4M7KL 2VXQL 1AJ7L 3EO9H 1J1OH 4HF5L 4XGZB 5E2VL 1ADQL 2EDTA 1BD2E 1JMZA 3MRCA 1KCUL 4HCRL 1SEQL 2DI8A 2DWDB 5TFSL 1N6QL 2DWEB 5GS0L 3TZVA 1IFHL 4JFHD 4YE4H 3WHE0 4E5XB 4RDQG 5L2JB 2W38A 3STZB 1FNGB 4NM8L 5IHZB 1R3LB 1A02N 3V2AR 3TBSA 4JM2B 1AC6A 2VDLL 2XTJB 4NJ9H 4NZTL 3D39D 2GAZB 4HUXA 2H3NB 1PLGL 4RBPH 3Q1SL 5DEFA 4CVZA 1L6XA 4UI2A 1JYWA 3WFEL 3JSSA 4UV7L 4BH7B 3SJVE 1LE5A 3B9EA 2HKHL 3CDYA 3DBXB 1TJGH 3LKPA 5HYSB 4MAYC 2FECL 2M1KA 5JQ6L 5EU5A 1YQVL 3UTSD 3ESUF 3GO1L 4GRMA 4GXVL 1AXTL 2J6EH 1NC4A 4PLKC 1CK0L 2BFVH 3PWLB 1Q9LB 1U6AL 4N0YH 4YPGA 1JF1B 5JHDE 2UWEF 5E2TL 4IOIB 4ONGH 1S7WB 4RFEA 3QUKB 4G43A 2A0LC 2ZCHH 2FX7H 4NKMA 3NGBB 3ZL4L 4U2ZA 3QG6A 4MXWH 1FG2B 4PJHE 4A2MA 1ZANH 3BGMA 1NEZG 1FO0L 4MAYA 4FQLL 4ENED 1C1EH 1HQRB 3I9GL 3X13A 1B0GA 5DZLA 1U91A 3KR3H 3CJJA 5J57B 3FO1A 5D5MF 5HGHB 4JRYB 3CPLB 5DQDH 1QPXA 3BJLA 1NBQA 3KJ4B 1NCAH 2CIKB 1F8TH 3VCLB 4UIKL 2G9HB 5B38B 1NL0L 1MWAA 4TUKL 3D3VA 2XN9B 3KLSA 4N68A 5HHOE 1NCUA 3NH7H 1XGUA 2EICA 3MV9A 1PKQB 3IJYB 2IAND 3JBG7 3JV4A 3FN3A 5HHXL 1IZKA 3BXNB 4OLXL 5D1QB 1XCTB 1M7IB 1JGVH 3RUGE 4HXAH 5D2LF 3BEWA 5JNYA 1B88A 3IVKB 2BOCA 1J8HE 1XCQB 2BRQA 3MBEC 2F5AH 3NFSH 4JDTL 1XH3A 2ICEA 1VB9A 1HXYA 1W0VA 5C71A 4TPRL 3KAAA 1CN4A 4KKCD 1KCSH 1XIWB 1W2KT 3R06A 3AM8C 5ACZA 2B39A 3U36A 4M5YL 4HG4K 4CRPA 4I3GA 7FABL 4ZPVB 4FTVB 4W6XB 1EHLH 3SGJA 4HFWA 1RJYA 2YSSB 1RMFL 4KJPD 3TWCH 4YHML 3P2TA 3IU4H 4WNQB 1UJTA 1IAKB 5I30L 3U46B 1NCBH 3HI1B 3O8XC 3FB7B 1CFTB 1GVIA 1S9WA 3DXAD 3QUZB 1EUUA 5HDBE 4L5FH 3VWJA 4NQCD 4P9HC 4PJ9D 5A40E 2VRAA 3MBEA 3HRPA 5KSAB 4OD1L 5HGBA 4XC3H 1NUGA 2Q76A 1NFDA 1U95B 4HUMB 4DTGL 5HI5C 1WFOA 5DT1L 3AM8A 4YXKL 4PRPE 4PJIB 3GM8A 3RNQB 4EI5C 4UT9L 5EUOF 4ZO9A 2NY0C 5E9DA 3CZFA 1A3LH 3CFCL 2YOCA 3QG7H 3CMOL 4PJBA 1MY5A 5KW9L 5CKAA 5B3NA 4G3YH 4PRID 3IJHB 5F3BB 1U58A 5J8OA 5IF0A 3O8XA 3QIBC 1NAKL 1YUHB 2NY1C 4ZUTA 2OL3H 5K59E 4F33A 1YEHH 4PJAB 1KJ3L 1OAYH 5J6GA 3UZEA 4R0LB 4Y19A 5D8JL 1BFOB 1UADC 3HAEG 1MLCA 1H3PL 5C3LD 1MHCB 35C8H 3WO4B 4F9PC 3U4EA 5IQ7H 4EI5A 2EDJA 1NANH 5D6DC 3NABH 1RZGB 3PQYD 3VXUA 4AY0A 3KPSE 1CDYA 2JCCF 2P8MB 2E6JA 2NTSP 1JPTH 2AK4A 4LHUA 1U8OA 4DGYH 4OF3A 4LSPL 4M7KH 3MRDA 4HF5H 3O11A 3KPMA 4JFFD 1QR4A 1DL7L 1DANT 1ETZA 4ZFGL 4HCRH 4F7PA 4X5XB 3C09C 4I13B 3NPSC 3OKMB 1SEQH 1QPPA 1S7QB 3QXUA 1RVFH 4R26L 4LKXA 3STLB 4CNIA 5GS0H 1TVHA 4F9PA 1I7ZB 3H2WA 1IFHH 1CLZH 5DQ9A 1CGTA 5D6DA 3EFDH 4OQTL 2FYYB 1EA9C 5C86A 4N8CL 3A6OA 4LARL 5HGAA 1I3GL 3B83A 2W0FA 2VJXA 1WWCA 5BOZG 4UV4L 1E4XL 3MA7B 3AS0A 3O6KH 4URTB 3OR7B 5ANMB 3LKSA 5DJYA 3WFEH 1Q94A 4WCYL 4WTZG 3L7FB 5MERA 1BD2D 2HKHH 2DMCA 1KF9B 2GYSA 2R2BB 2XZZA 1EMTH 4PJ5B 1U3HA 4KK8D 4PJDF 2O93L 2G75B 5IIEB 5KSUB 1LP9A 4NZUL 5JQ6H 2BJMH 5KSBB 3R0NA 1YQVH 1DQJA 4G6AD 2GCYB 1LK2B 2JKXA 4ORGA 2CDEA 2EDFA 4LCWE 1ACZA 1CK0H 1ZVSB 1U6AH 2CGRL 5EORL 1R3IH 1KJVB 2VZVA 3KWWA 4IMKA 3HPLA 3LQAL 4WDIA 5D2NA 4MQTB 1MCFA 1EHAA 2YRZA 2Z4QB 1UB5A 4U1LB 4XC1L 2P5EA 4FFWC 1C5BL 5I71C 1A4KA 1RIUL 3MGOB 1JIBA 1CZ8L 2VQ1A 5DMGD 4JFPA 3FMGL 4Q6IB 3BN3B 3UTTA 2NR6C 4KXZH 1FO0H 3SJVD 3DHJA 3GSNB 1KYOJ 3DMMD 1GGYA 1U42A 1VHPA 3I9GH 3TF7C 4YHZL 1FV1A 1KG0A 3H42H 1X5XA 1JHKH 1MIEL 2WMPA 1AHWB 3RWFB 3BPLB 3JWOL 4PRHA 4QHMB 4QY8B 5DD3L 4MHHI 3MLXL 2DWDA 4TUOB 1T4KB 2HT4C 1TQBB 3GMNB 2DWEA 4YFEA 4Y16C 3B2UC 2V9QA 4E5XA 4UIKH 2XKNB 1QUNA 3KYOB 3STZA 4I77H 1R3LA 4GW5B 1AY1L 4PGEB 4LASL 2V17L 2DLFH 5EO0B 3SCMD 3MRBA 2A9NL 5A43C 1OT2A 1I1YA 1T83C 3CX5K 2AJ3B 1HN1A 4JDTH 1MFDL 4XPFH 4TPRH 1RURL 2V5TA 4KKAC 5DUPL 1X5IA 1CGSL 1UH4A 4D9QE 5HYSA 4HS8H 1DP0A 4HULB 2WBJB 2HTLC 5FKPB 2YD4A 2ZUQC 4XNUL 5FEBA 2R69H 2IBGA 3D69B 4C4KT 1M6OB 3AREC 5C0RH 5J06A 3PWLA 4X5LA 4FFYL 4HK0A 5TPWL 4KK6D 4XPHL 5D71H 2BRRH 3HZYA 5HHOD 3C6SA 2FO1A 2E8ZA 4HAGA 5CLTA 3OWEA 3O0RH 1T83A 1S7WA 5BXFB 2H1PH 4JQXC 5D1XD 4QKXB 4ONHB 2FHFA 3SDYL 1GPOH 3QYCA 4OD1H 5F9WC 3WXWL 1CXKA 4DTGH 1WBXB 3OJMB 1J8HD 2R1WB 1FG2A 5DT1H 3TESA 2PTTA 3SE3A 2IH3B 1JK8A 1HKLH 4NQDE 4U1IA 5B21A 1J5OL 4HJGB 3S34H 3CFCH 5FOBB 3EOAB 1UXSB 4CMMB 1ZHNA 2R4RL 3AREA 5IMKB 4NO5B 4RGNB 2YN3A 5HGHA 1FNSL 1MEXL 1A6UL 4JRYA 2DRUA 3QXWA 4X7SH 3T0BA 3HUJE 4FQCL 2NY2C 5BS0A 4ZQKB 4MD0B 4LSVH 4JQXA 1RFDH 3VCLA 5T3ZE 3T04D 4Z7WA 1TXKA 2G9HA 3GMQB 5B38A 4K3DL 2XN9A 1CE1L 5DFTA 5K9OB 1H3PH 3VXSE 4JO3H 2EO9A 4KUCF 3FO2B 3BXNA 3U9UA 4G8GB 2OXHA 2XWJB 1QVOB 3V95A 5BW7C 5AAWA 4MD4A 4PRPD 1GGBL 4JAMB 1VERA 2MQ0A 3PG2A 1QLRA 3FB5A 3IVKA 1XCQA 4KROC 3W5MA 1A14H 3IF1A 1XF1A 1RUQL 5KSAC 2HT2D 1JMXA 4EVNB 1TVDA 4ZFOL 2HRPL 2UZXB 5FYLL 1KLGA 1XIWA 5HI3D 5GRVK 1WFUA 1VEMA 1YNTB 2H26B 5CSZB 2VAAA 4NGHL 4CVWA 3GMLB 3VD7A 4ZPVA 3G08B 5CEYA 2VXUL 2YSSA 3KS0H 3QBTB 4R26H 3IDMA 2AGJL 4I4WB 3DVIA 2FCBA 3MGTA 1B0RB 4PD4J 3HI1A 3FB7A 5ACMA 3QCVH 4OQTH 5I8OL 4U1KB 3LB6D 1CFTA 3RZCD 1NC2B 3SO3B 2ED7A 3P9WB 2DL2A 1I3GH 3QUZA 5DURD 2O5YL 2Y06L 4UV4H 4WHDA 3GDBA 4R0LC 4UNTA 4DN3L 3KPSD 5T5FL 5KSAA 1Y0LB 5EU4B 1E4XH 2BXYA 1K9TA 1U95A 1IGIL 1EBPA 4HLJA 4JY5L 3RNQA 5ESQB 4WCYH 1OGTA 5E00A 5ICZB 2LTQC 2FZ3B 2NXZD 1A6VL 5CP7B 3B9KD 1EVUA 1AI1H 2Y72A 2VO5A 5EBMB 4M1CC 3AB0B 3IJHA 4GW1A 1BAFH 3BZDA 4ZYKA 5I1LB 3ZKSD 4EDXB 5INDB 4XXDB 3RTQD 2V9TA 1F00I 1YMHA 4LOUC 4NN6B 4LPYA 3DWTA 1A1NB 1LEKB 2CGRH 5EORH 1T1XB 4R0LA 4R97C 3LQAH 4NFBA 2PO6B 1WSST 1RZJL 1H3UA 2PF6A 2X09A 1I8LC 1MCEA 5F21B 1H3WM 1U8HA 5M94B 1MHCA 5DA4A 4XC1H 2ZNXA 5CP3A 3MX0A 4YWGL 1JWSA 1C5BH 5C9KA 3RBSA 1RIUH 2AEPL 4KU1A 4NN5C 1EIBA 3IDIB 3GSOB 3REWA 3FMGH 4KJWD 5MEQA 5L8KB 2NY3B 4JPVL 2Z91B 2ZPKL 4O9HL 1LEGB 1RZ8B 4KUZL 1DQQA 2A6KA 4O51B 2CRIA 5IMOB 3OB0K 5F1KC 1D6VL 3L3KB 3JWOH 4P3DA 4U1JB 3ZYZA 1C7TA 3NCCB 3P9LB 3MLXH 1OD9A 1XR8B 3GSVA 1I8LA 2E8YA 4Z7UB 1I7ZA 4X0KB 3P4LA 4GO6B 4UBDC 5T1DH 3ULUF 4RFNB 3BPNC 3DOSA 2FYYA 3QEQA 1MRDL 4C59B 1AY1H 4LASH 1R5WB 1GGUA 2V17H 4JHWL 1HI6A 1SMAA 3C87A 3WIFB 4FRWA 2NW3B 3MA7A 1NBVL 3S96B 1RUKH 4HWNA 4L3AA 3TV3L 2ADGB 3L7FA 1A1MB 2UY7A 4KRLB 1TMCB 1U8PB 4OGXH 3SKJL 5HVGB 3OF6D 2R2BA 4PJ5A 1XFPA 3HNSL 3I84A 4CU6A 2G75A 5KSUA 5C08E 5IIEA 1T3FA 2VWEE 3QNXB 4J3UA 2VN4A 5KSBA 1R5IA 4L9LC 4MA1B 2B5IC 2GCYA 4K7PH 4LLMB 3FFDB 1ZVSA 1X44A 3OKKA 1KJVA 3BPLC 4NDMB 4X4ME 4JFDE 1QR1A 4DFHA 2DIJA 2ZJSL 1QYGH 3PDGA 2XT1B 3K46A 3QH3B 4U1LA 4CMHC 1KBGH 5ELIA 3MLYL 3LSOB 2YXMA 5AZEL 4U6XB 1F4WL 1OL0A 2B8OT 3GSNA 1NAMH 2UYLB 5F7LB 5IFJA 1SJHB 1ZOXA 3ULSA 1J5OH 2V7HA 4J3SA 4L9LA 4YH6A 5CFHA 1NCNA 2R4RH 1ZLUH 5T33L 1AHWA 2JTDA 4QHMA 3RWFA 4AYFA 5I18H 4LSQL 4TUOA 3QAZC 1T4KA 3PGCA 1ZMYA 4BQ9A 2DLGA 5LAXA 5DRWB 4NPYB 3T0EB 4IJ3B 2XKNA 3KYOA 4DFIA 2D4FA 3WDHA 2OMBA 4GW5A 4PGEA 4YQXL 1IKNC 1I7RB 3TO4D 1H15A 5EO0A 1R24B 1BVLB 4F7EB 3RWJB 2APVA 3PDOA 5MI0B 3GJFB 3VG0L 1DVFC 5FDYA 4XT1C 3LEYH 2AJUH 4NQDD 4ZO8A 4UNVA 3MJ7A 1TETL 2I9TB 2HRPH 4NIKB 2BY0A 2EE9A 4FN0A 4LF3A 1RK1B 5FKPA 5JLZB 3WDIA 3S37L 3G9AB 3PIQA 1Q72H 4J12A 3CLFL 4N5EC 3WIHA 5DSCB 3D69A 3X3FL 5T3ZD 2AJZB 4ZS6C 1M6OA 2AGJH 4L3EA 1OOAA 4Z0XB 3G9VA 2C4FU 5D7IB 5I8OH 3U83A 5F93C 2OR7A 2VL5B 3VXSD 2R0LL 5C09B 4LU5L 5BXFA 4RMUA 1CLYL 5GXBB 2A1WL 4ONHA 2Y06H 3D18B 2XA3A 3W9EB 5T5FH 4G6ML 1FNEB 5ICXB 3RWDB 4EN3B 4LAJH 3TVMB 1IGIH 2IH3A 1QLEL 5IHBA 2YPVL 4KK5D 4IDJL 3K4AA 1BQHG 1FFQA 4YDJA 4HJGA 1F13A 2VTFA 4U6YB 3MRHA 2BNQE 1UXSA 2M2DA 2YRPA 1KXVC 1J1XH 4NO5A 5HHVH 4L4TE 5IJVB 1WWBX 4XP1H 5IVXE 1UYWL 1NFIB 3MLUH 5JW4Q 4MB3A 2ICES 5FO9A 2PYEA 2BVPA 3THMH 4JY6A 4RNRB 3X14B 1A0QL 4MD0A 1NANI 2NX5E 3TH4T 4MWFB 1FL3B 5CBEA 3GMQA 2CJUL 1YDPB 3WCYA 4NUGL 1CI5A 6CGTA 4LPCA 4JFEB 3FO2A 1T5WB 4M8QA 2XWJA 4YWGH 4RGMB 2AEPH 2EXWC 3NAAH 5CSGA 3VXPB 5KVMC 5ADPL 5DUBA 1AO7B 1CCZA 1HXMB 2X4UB 1QZ1A 2ZPKH 3VI3F 4EVNA 1T66D 1WEJL 3QXVA 2W65B 3QUYC 1DEDA 1YNTA 4OCNC 2CRYA 2B1AL 2H26A 5CSZA 3ARBB 3QFJB 2YZ8A 4WI2A 3GMLA 4HZLB 2RR3A 3G08A 5C0JB 3V6ZB 4GRLD 1F58L 1NMBH 3AB0C 2ESVA 4JRXB 5F8QC 3QWQB 4OZGF 1BBDH 2X4PB 4RIRB 2R29L 4KKNA 1E6OH 3MLWL 4FFVD 5E7FA 3FQWB 3GMOA 2XQYG 4U1KA 4XNYL 1MRDH 1NC2A 4UAOC 2EH7H 3WFCH 5KOMC 2VZSA 4JHWH 4NSKA 4P23B 1SJVA 4WFHE 2QHLA 2PO6C 3MV7B 1NBVH 2FECI 5F72S 3QUYA 3TV3H 1J88A 4M5ZH 4BFBD 3UZVB 2NMSA 5ESQA 2J4WL 1NEUA 1YPZF 2FZ3A 3T3PF 1MCOH 4S1RL 5FO7B 4XPBL 4K3GA 4JPWH 3HNSH 4NKIH 1CR9L 2NY3C 3P0GB 3PV6A 4U0QB 5F1OB 4LEXH 5IK3B 1EEZB 5INDA 4EDXA 1D6EB 5I1LA 4PYHA 2YPKB 1A1NA 3OAZK 2DQTL 1KIQB 1JHLH 5C3TA 5K9KB 1U8QA 2PO6A 2ZJSH 4KXZI 1CF8L 5BV7H 1IAMA 1RIHL 3D25B 4MZ3A 2YD5A 3AXLB 1BGXL 1QFHA 3U4BL 3MLYH 3OX8A 3UXFA 1FNLA 3O2DA 3GSOA 3VXRA 1F4AA 3VGGA 1P4LA 1V3KA 4NQEA 3BWAB 1F4WH 4NJAL 3ULVC 3FJTA 3BT2L 1G9NC 1VFBB 5DEZA 3MUY1 1LEGA 1RZ8A 4F8QA 2B4CL 5C08D 1H3VA 3QDGE 1BFTA 3QHFL 1KN2H 4O51A 5IMOA 3QWRA 3V4PL 5IHUL 3P9LA 4LSQH 1XR8A 2NY6C 2W9EL 5F70A 4NKQB 4Z7UA 3L7EB 4U49A 4GH7B 3DROB 5F9JB 4X0KA 2GSIB 4YX2L 5EWIL 3MCKB 2COQA 1PEZA 1NH6A 4WHCA 3EBAA 1CICB 4AENA 5CD3A 1R5WA 2ARWA 2BK8A 2JK5A 4OD2B 2DM4A 5E8PA 5T1LD 2XKUA 4N0CC 1ZAGA 4BYHA 4MJ2A 4OLVL 3S96A 3VG0H 5CZVL 1VDGA 1WTGT 3CUPA 1P69B 5CWSB 2X9WA 4P2OB 4PJFF 3HAEH 1XGQA 4U0RC 3D2UB 3W2DL 1SVZA 2WQ8A 2ZUTA 5IR1A 1ED3B 5GRZA 4QRUB 4LLWB 4PB9H 3UJIH 3QNXA 4ZS7H 5J1AB 4KRPD 1I9EA 3FAXA 2YD8A 4Y88A 4Z7QF 1TJHL 4OM1L 2J8UE 2CKBH