4FA8E

Multi-pronged modulation of cytokine signaling
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
145
structure length
145
Chain Sequence
DPSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Multipronged attenuation of macrophage-colony stimulating factor signaling by Epstein-Barr virus BARF1.
pubmed doi rcsb
molecule keywords Secreted protein BARF1
molecule tags Viral protein/cytokine
source organism Human herpesvirus 4
total genus 48
structure length 145
sequence length 145
chains with identical sequence F, G
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF05337 CSF-1 Macrophage colony stimulating factor-1 (CSF-1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1250.10 Mainly Alpha Up-down Bundle Growth Hormone; Chain: A; Growth Hormone; Chain: A; 4fa8E00
4Z5RD 1M4BA 1QVNA 4YDYI 1J7VL 5L6YC 3NPZA 1PY2A 1CNT1 3NCBA 1I1RB 1KF9A 3SE3B 1IJZA 2H24A 2B8XA 3D48P 1GNCA 2CYKA 5D28B 1JLIA 1RCBA 2ERJD 1HWGA 1N1FA 1Z92A 2D48A 2E9WC 4YQXA 4YUEC 4YPGC 5D71A 3B5KA 1Z7CA 1NBPA 1BGDA 5C7XA 1ITFA 3G6DA 3PIWA 1EERA 2L3YA 5KNHI 1FYHA 1LK3A 1SCFA 3NCEA 2B5IA 2B8ZA 3VA2A 1ALUA 1ITLA 1F45B 3EW3A 1BGEA 3SE4B 1BBNA 3LB6B 4X51A 1RW5A 1ITMA 4CNIC 1IARA 1D9CA 4NEMA 5FHXA 1HULA 1PW6A 1V7NV 3INKC 4O6KA 3NCFA 3QAZA 4J4LC 2ILKA 1IL6A 4NKQC 1HIKA 3PIVA 4WRLB 1Y6ML 3BPOA 1LQSL 5D72A 1INRA 1YKBA 1HIJA 1PGRA 2LAGA 3LB6A 4GRWA 1BCNA 2IL6A 3QB7A 3BESL 1VLKA 2O27A 3D87A 1EXZA 2B8YA 1M48A 2KZ1A 1HUWA 2B91A 1ETEA 3UX9A 1HZIA 1D9GA 1PVHB 4NI9A 3BPLA 5FUCA 3NCCA 2Q7NB 2L3OA 1WU3I 1FG9A 3BPNA 3UEZE 3WCYI 4PS4A 3MZGA 1V7MV 1M4CA 1BP3A 1HWHA 5LQBA 4ZS7A 1RHGA 1GA3A 5D70A 2B90A 1AX8A 1BGCA 1P9MB 1CSGA 3N0PA 4ZF7A 1M4RA 1B5LA 1Y6NL 3OQ3A 2INTA 2O26A 5E4EA 1Y6KL 1M47A 1A7MA 1ILKA 3DUHC 3QWRB 3UF2A 4NEJA 1EMRA 2B8UA 4NI7A 2GMFA 3QT2C 1EVSA 1HGUA 5D22A 3EJJA 3HMXB 1A22A 4DOHA 4FA8E 3S9DA 1M4AA 4MHLA 3HHRA 1EKUA 3UF5A 3L5XA 4RS1A 1ITIA 1IRLA 1AU1A 1RFBA 3N06A 1IK0A 3D85C 3DGCL 4I77Z 1CD9A 1F6FA 3Q1SI 3L5WI 2Q98A 2LMSA 1BUYA 3G9VB 1M49A 2D9QA 1CN4C 3QB1A 1CYLA 3DLQI 1LKIA 2HYMB 4O9HA 1AXIA
chains in the Genus database with same CATH superfamily
4Z5RD 3I4ND 4EXNA 3SE3B 5D28B 1PV6A 1JLIA 2ERJD 1HWGA 1N1FA 4ZYRA 2PSMA 5C7XA 4D2CA 5C3ED 1ITLA 1F45B 3EW3A 3SE4B 4GBYA 4X51A 1RW5A 4GC0A 4YB9D 4A93D 1PW6A 1V7NV 3NCFA 4J4LC 4W6VA 1IL6A 1HIKA 5C65A 2Q14A 1BCNA 2IL6A 2JA7D 3BESL 5C4XD 3D87A 1M48A 1HUWA 2B91A 4A3GD 5FLMD 3WCYI 3MZGA 4IKZA 3WDOA 5LQBA 1Y1WD 4EXPA 4A3ID 2Z3QA 1Y6NL 5A2OA 3DI3A 1Y6KL 4U4TA 4NEJA 2B8UA 2GMFA 1HGUA 3HMXB 1A22A 3IRHA 4GBZA 3S9DA 1M4AA 4MHLA 1EKUA 3L5XA 3OG4A 2OQPA 1AU1A 4BXXD 1RFBA 3HOYD 1IK0A 4BY7D 2R7ZD 5GXBA 3L5WI 1BUYA 1M49A 5A2NA 1QVNA 4YDYI 1PY2A 1CNT1 3NCBA 1KF9A 2H24A 4IKYA 2D48A 4YQXA 5IP7D 4YUEC 3O7QA 1Z7CA 1NBPA 1EERA 2L3YA 1FYHA 1SCFA 3H0GD 3NCEA 4GS7A 2CFPA 3LB6B 4DKCA 4BBRD 4CNIC 5IYCD 1IARA 3QAZA 1Y6ML 3BPOA 4IKWA 5EQHA 4LDSA 5D72A 3LB6A 1HIJA 2LAGA 4LRLA 3H3VE 5EQGA 4ZWBA 3TGXB 4YBQA 1ETEA 2XQBA 4D2BA 1HZIA 1PVHB 4NI9A 3BPLA 2L3OA 3BPNA 1BP3A 1HWHA 1RHGA 5D70A 4D2DA 3N0PA 1CSGA 3O7PA 4BY1D 4ZF7A 2B63D 4J05A 4DKEA 2R92D 2INTA 2O26A 4A3MD 1A7MA 4LEPA 3QT2C 3HHCA 3EJJA 4A3BD 3HHRA 3DGCL 1CD9A 3HOWD 4NN5A 4QIQA 3Q1SI 4A3FD 4PYPA 5IYBD 3G9VB 2JA6D 2HYMB 1M4BA 2JA5D 5L6YC 5D58A 4ZW9A 2B8XA 3D48P 2CYKA 2Z3RA 4A3CD 5D71A 4A3DD 5D6KA 3AYHA 5KNHI 4NN7A 2B8ZA 1BBNA 3DI2A 1ITMA 1D9CA 5TS9A 4A3ED 5FHXA 1HULA 3INKC 4O6KA 2ILKA 4NKQC 3PIVA 3PO2D 1LQSL 1PW4A 1INRA 4GRWA 4IU8A 1VLKA 1Y14A 5C44D 2O27A 1EXZA 5EQIA 3UX9A 1D9GA 4UVMA 4IKXA 3NCCA 4A3KD 3UEZE 4PS4A 1V7MV 4ZS7A 4TPJA 1GA3A 2B90A 1AX8A 4JA3A 1BGCA 1M4RA 1B5LA 3HOVD 3PO3D 4U4VA 1M47A 1ILKA 3DUHC 4OH3A 3UF2A 3FKID 1EVSA 4DOHA 5IP9D 4BBSD 4IKVA 1IRLA 3N06A 3D85C 4A3JD 1F6FA 2Q98A 2LMSA 1Y1VD 1CN4C 1LKIA 4O9HA 4NEMA 3HOZD 4U4WA 1J7VL 3NPZA 4APSA 1I1RB 5IYDD 1IJZA 3HOUD 1GNCA 1PV7A 1RCBA 1Z92A 2E9WC 4YPGC 3B5KA 2C35A 1BGDA 4DKDA 1ITFA 3G6DA 3PIWA 1LK3A 2CFQA 2B5IA 2O6IA 4JR9A 3VA2A 1ALUA 1BGEA 2R93D 2Y5YA 5D59A 1WCMD 4WRLB 2JA8D 4OAAA 2V8NA 4A3LD 1YKBA 1PGRA 3QB7A 4TPHA 4ZWCA 2B8YA 2KZ1A 4NN6A 5FUCA 2Q7NB 1WU3I 1FG9A 4XNJA 3OG6A 3I4MD 1M4CA 4JREA 4Q65A 1P9MB 2VUMD 4XNIA 3OQ3A 5E4EA 3QWRB 1EMRA 4NI7A 5D22A 4FA8E 3UF5A 4RS1A 4TPGA 1ITIA 4IU9A 3HOXD 4I77Z 4DKFA 2XUTA 2D9QA 3QB1A 1CYLA 3DLQI 1AXIA
chains in the Genus database with same CATH topology
4Z5RD 1M4BA 1QVNA 5IYDD 3I4ND 4YDYI 3HOZD 1J7VL 5L6YC 2JA5D 3NPZA 1PY2A 1CNT1 3NCBA 1I1RB 1KF9A 3SE3B 1IJZA 2H24A 2B8XA 3D48P 4EXNA 2CYKA 5D28B 1JLIA 3HOUD 1GNCA 1RCBA 2ERJD 1HWGA 1N1FA 1Z92A 2D48A 2E9WC 2Z3RA 4YQXA 5IP7D 4YUEC 4YPGC 4A3CD 5D71A 3B5KA 2C35A 4A3DD 1Z7CA 3AYHA 2PSMA 1NBPA 1BGDA 4DKDA 5C7XA 1ITFA 3G6DA 3PIWA 1EERA 2L3YA 5KNHI 1FYHA 4NN7A 1LK3A 1SCFA 5C3ED 3H0GD 3NCEA 2B5IA 2B8ZA 2O6IA 3VA2A 1ALUA 4GS7A 1ITLA 1F45B 3EW3A 1BGEA 3SE4B 1BBNA 3LB6B 4X51A 3DI2A 1RW5A 1ITMA 2R93D 4DKCA 4BBRD 4CNIC 5IYCD 1IARA 1D9CA 4NEMA 5TS9A 4A3ED 5FHXA 1HULA 4A93D 1PW6A 1V7NV 3INKC 4O6KA 3NCFA 3QAZA 4J4LC 2ILKA 1WCMD 1IL6A 4NKQC 1HIKA 3PIVA 4WRLB 1Y6ML 3BPOA 2JA8D 3PO2D 4A3LD 1LQSL 5D72A 1INRA 2Q14A 1YKBA 1HIJA 1PGRA 2LAGA 3LB6A 4GRWA 4LRLA 3H3VE 1BCNA 2IL6A 3QB7A 2JA7D 3BESL 3TGXB 1VLKA 5C4XD 1Y14A 5C44D 2O27A 3D87A 1EXZA 2B8YA 1M48A 2KZ1A 1HUWA 2B91A 4A3GD 1ETEA 3UX9A 2XQBA 5FLMD 4NN6A 1HZIA 1D9GA 1PVHB 4NI9A 3BPLA 5FUCA 3NCCA 2Q7NB 2L3OA 4A3KD 1WU3I 1FG9A 3BPNA 3UEZE 3WCYI 4PS4A 3MZGA 3OG6A 1V7MV 3I4MD 1M4CA 1BP3A 1HWHA 5LQBA 4ZS7A 1RHGA 1GA3A 5D70A 2B90A 1AX8A 1Y1WD 1BGCA 4EXPA 1P9MB 1CSGA 2Z3QA 3N0PA 4A3ID 4BY1D 4ZF7A 2VUMD 1M4RA 1B5LA 2B63D 1Y6NL 3HOVD 4DKEA 3OQ3A 2R92D 2INTA 2O26A 3DI3A 5E4EA 1Y6KL 3PO3D 4A3MD 1M47A 1A7MA 1ILKA 3DUHC 3QWRB 3UF2A 4NEJA 1EMRA 2B8UA 4NI7A 3FKID 2GMFA 3QT2C 1EVSA 1HGUA 3HHCA 5D22A 3EJJA 3HMXB 1A22A 4DOHA 3IRHA 4FA8E 5IP9D 3S9DA 4A3BD 1M4AA 4MHLA 3HHRA 1EKUA 3UF5A 4BBSD 3L5XA 3OG4A 4RS1A 1ITIA 1IRLA 2OQPA 3HOXD 1AU1A 4BXXD 1RFBA 3N06A 3HOYD 1IK0A 3D85C 3DGCL 4A3JD 4I77Z 1CD9A 4BY7D 3HOWD 1F6FA 4NN5A 2R7ZD 3Q1SI 3L5WI 4A3FD 2Q98A 2LMSA 5IYBD 1Y1VD 1BUYA 3G9VB 1M49A 4DKFA 2D9QA 2JA6D 1CN4C 3QB1A 1CYLA 3DLQI 1LKIA 2HYMB 4O9HA 1AXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z5R D;  1M4B A;  1QVN A;  4YDY I;  1J7V L;  5L6Y C;  3NPZ A;  1PY2 A;  1CNT 1;  3NCB A;  1I1R B;  1KF9 A;  3SE3 B;  1IJZ A;  2H24 A;  2B8X A;  3D48 P;  1GNC A;  2CYK A;  5D28 B;  1JLI A;  1RCB A;  2ERJ D;  1HWG A;  1N1F A;  1Z92 A;  2D48 A;  2E9W C;  4YQX A;  4YUE C;  4YPG C;  5D71 A;  3B5K A;  1Z7C A;  1NBP A;  1BGD A;  5C7X A;  1ITF A;  3G6D A;  3PIW A;  1EER A;  2L3Y A;  5KNH I;  1FYH A;  1LK3 A;  1SCF A;  3NCE A;  2B5I A;  2B8Z A;  3VA2 A;  1ALU A;  1ITL A;  1F45 B;  3EW3 A;  1BGE A;  3SE4 B;  1BBN A;  3LB6 B;  4X51 A;  1RW5 A;  1ITM A;  4CNI C;  1IAR A;  1D9C A;  4NEM A;  5FHX A;  1HUL A;  1PW6 A;  1V7N V;  3INK C;  4O6K A;  3NCF A;  3QAZ A;  4J4L C;  2ILK A;  1IL6 A;  4NKQ C;  1HIK A;  3PIV A;  4WRL B;  1Y6M L;  3BPO A;  1LQS L;  5D72 A;  1INR A;  1YKB A;  1HIJ A;  1PGR A;  2LAG A;  3LB6 A;  4GRW A;  1BCN A;  2IL6 A;  3QB7 A;  3BES L;  1VLK A;  2O27 A;  3D87 A;  1EXZ A;  2B8Y A;  1M48 A;  2KZ1 A;  1HUW A;  2B91 A;  1ETE A;  3UX9 A;  1HZI A;  1D9G A;  1PVH B;  4NI9 A;  3BPL A;  5FUC A;  3NCC A;  2Q7N B;  2L3O A;  1WU3 I;  1FG9 A;  3BPN A;  3UEZ E;  3WCY I;  4PS4 A;  3MZG A;  1V7M V;  1M4C A;  1BP3 A;  1HWH A;  5LQB A;  4ZS7 A;  1RHG A;  1GA3 A;  5D70 A;  2B90 A;  1AX8 A;  1BGC A;  1P9M B;  1CSG A;  3N0P A;  4ZF7 A;  1M4R A;  1B5L A;  1Y6N L;  3OQ3 A;  2INT A;  2O26 A;  5E4E A;  1Y6K L;  1M47 A;  1A7M A;  1ILK A;  3DUH C;  3QWR B;  3UF2 A;  4NEJ A;  1EMR A;  2B8U A;  4NI7 A;  2GMF A;  3QT2 C;  1EVS A;  1HGU A;  5D22 A;  3EJJ A;  3HMX B;  1A22 A;  4DOH A;  4FA8 E;  3S9D A;  1M4A A;  4MHL A;  3HHR A;  1EKU A;  3UF5 A;  3L5X A;  4RS1 A;  1ITI A;  1IRL A;  1AU1 A;  1RFB A;  3N06 A;  1IK0 A;  3D85 C;  3DGC L;  4I77 Z;  1CD9 A;  1F6F A;  3Q1S I;  3L5W I;  2Q98 A;  2LMS A;  1BUY A;  3G9V B;  1M49 A;  2D9Q A;  1CN4 C;  3QB1 A;  1CYL A;  3DLQ I;  1LKI A;  2HYM B;  4O9H A;  1AXI A; 
#chains in the Genus database with same CATH topology
 4Z5R D;  3I4N D;  4EXN A;  3SE3 B;  5D28 B;  1PV6 A;  1JLI A;  2ERJ D;  1HWG A;  1N1F A;  4ZYR A;  2PSM A;  5C7X A;  4D2C A;  5C3E D;  1ITL A;  1F45 B;  3EW3 A;  3SE4 B;  4GBY A;  4X51 A;  1RW5 A;  4GC0 A;  4YB9 D;  4A93 D;  1PW6 A;  1V7N V;  3NCF A;  4J4L C;  4W6V A;  1IL6 A;  1HIK A;  5C65 A;  2Q14 A;  1BCN A;  2IL6 A;  2JA7 D;  3BES L;  5C4X D;  3D87 A;  1M48 A;  1HUW A;  2B91 A;  4A3G D;  5FLM D;  3WCY I;  3MZG A;  4IKZ A;  3WDO A;  5LQB A;  1Y1W D;  4EXP A;  4A3I D;  2Z3Q A;  1Y6N L;  5A2O A;  3DI3 A;  1Y6K L;  4U4T A;  4NEJ A;  2B8U A;  2GMF A;  1HGU A;  3HMX B;  1A22 A;  3IRH A;  4GBZ A;  3S9D A;  1M4A A;  4MHL A;  1EKU A;  3L5X A;  3OG4 A;  2OQP A;  1AU1 A;  4BXX D;  1RFB A;  3HOY D;  1IK0 A;  4BY7 D;  2R7Z D;  5GXB A;  3L5W I;  1BUY A;  1M49 A;  5A2N A;  1QVN A;  4YDY I;  1PY2 A;  1CNT 1;  3NCB A;  1KF9 A;  2H24 A;  4IKY A;  2D48 A;  4YQX A;  5IP7 D;  4YUE C;  3O7Q A;  1Z7C A;  1NBP A;  1EER A;  2L3Y A;  1FYH A;  1SCF A;  3H0G D;  3NCE A;  4GS7 A;  2CFP A;  3LB6 B;  4DKC A;  4BBR D;  4CNI C;  5IYC D;  1IAR A;  3QAZ A;  1Y6M L;  3BPO A;  4IKW A;  5EQH A;  4LDS A;  5D72 A;  3LB6 A;  1HIJ A;  2LAG A;  4LRL A;  3H3V E;  5EQG A;  4ZWB A;  3TGX B;  4YBQ A;  1ETE A;  2XQB A;  4D2B A;  1HZI A;  1PVH B;  4NI9 A;  3BPL A;  2L3O A;  3BPN A;  1BP3 A;  1HWH A;  1RHG A;  5D70 A;  4D2D A;  3N0P A;  1CSG A;  3O7P A;  4BY1 D;  4ZF7 A;  2B63 D;  4J05 A;  4DKE A;  2R92 D;  2INT A;  2O26 A;  4A3M D;  1A7M A;  4LEP A;  3QT2 C;  3HHC A;  3EJJ A;  4A3B D;  3HHR A;  3DGC L;  1CD9 A;  3HOW D;  4NN5 A;  4QIQ A;  3Q1S I;  4A3F D;  4PYP A;  5IYB D;  3G9V B;  2JA6 D;  2HYM B;  1M4B A;  2JA5 D;  5L6Y C;  5D58 A;  4ZW9 A;  2B8X A;  3D48 P;  2CYK A;  2Z3R A;  4A3C D;  5D71 A;  4A3D D;  5D6K A;  3AYH A;  5KNH I;  4NN7 A;  2B8Z A;  1BBN A;  3DI2 A;  1ITM A;  1D9C A;  5TS9 A;  4A3E D;  5FHX A;  1HUL A;  3INK C;  4O6K A;  2ILK A;  4NKQ C;  3PIV A;  3PO2 D;  1LQS L;  1PW4 A;  1INR A;  4GRW A;  4IU8 A;  1VLK A;  1Y14 A;  5C44 D;  2O27 A;  1EXZ A;  5EQI A;  3UX9 A;  1D9G A;  4UVM A;  4IKX A;  3NCC A;  4A3K D;  3UEZ E;  4PS4 A;  1V7M V;  4ZS7 A;  4TPJ A;  1GA3 A;  2B90 A;  1AX8 A;  4JA3 A;  1BGC A;  1M4R A;  1B5L A;  3HOV D;  3PO3 D;  4U4V A;  1M47 A;  1ILK A;  3DUH C;  4OH3 A;  3UF2 A;  3FKI D;  1EVS A;  4DOH A;  5IP9 D;  4BBS D;  4IKV A;  1IRL A;  3N06 A;  3D85 C;  4A3J D;  1F6F A;  2Q98 A;  2LMS A;  1Y1V D;  1CN4 C;  1LKI A;  4O9H A;  4NEM A;  3HOZ D;  4U4W A;  1J7V L;  3NPZ A;  4APS A;  1I1R B;  5IYD D;  1IJZ A;  3HOU D;  1GNC A;  1PV7 A;  1RCB A;  1Z92 A;  2E9W C;  4YPG C;  3B5K A;  2C35 A;  1BGD A;  4DKD A;  1ITF A;  3G6D A;  3PIW A;  1LK3 A;  2CFQ A;  2B5I A;  2O6I A;  4JR9 A;  3VA2 A;  1ALU A;  1BGE A;  2R93 D;  2Y5Y A;  5D59 A;  1WCM D;  4WRL B;  2JA8 D;  4OAA A;  2V8N A;  4A3L D;  1YKB A;  1PGR A;  3QB7 A;  4TPH A;  4ZWC A;  2B8Y A;  2KZ1 A;  4NN6 A;  5FUC A;  2Q7N B;  1WU3 I;  1FG9 A;  4XNJ A;  3OG6 A;  3I4M D;  1M4C A;  4JRE A;  4Q65 A;  1P9M B;  2VUM D;  4XNI A;  3OQ3 A;  5E4E A;  3QWR B;  1EMR A;  4NI7 A;  5D22 A;  4FA8 E;  3UF5 A;  4RS1 A;  4TPG A;  1ITI A;  4IU9 A;  3HOX D;  4I77 Z;  4DKF A;  2XUT A;  2D9Q A;  3QB1 A;  1CYL A;  3DLQ I;  1AXI A; 
#chains in the Genus database with same CATH homology
 4Z5R D;  1M4B A;  1QVN A;  5IYD D;  3I4N D;  4YDY I;  3HOZ D;  1J7V L;  5L6Y C;  2JA5 D;  3NPZ A;  1PY2 A;  1CNT 1;  3NCB A;  1I1R B;  1KF9 A;  3SE3 B;  1IJZ A;  2H24 A;  2B8X A;  3D48 P;  4EXN A;  2CYK A;  5D28 B;  1JLI A;  3HOU D;  1GNC A;  1RCB A;  2ERJ D;  1HWG A;  1N1F A;  1Z92 A;  2D48 A;  2E9W C;  2Z3R A;  4YQX A;  5IP7 D;  4YUE C;  4YPG C;  4A3C D;  5D71 A;  3B5K A;  2C35 A;  4A3D D;  1Z7C A;  3AYH A;  2PSM A;  1NBP A;  1BGD A;  4DKD A;  5C7X A;  1ITF A;  3G6D A;  3PIW A;  1EER A;  2L3Y A;  5KNH I;  1FYH A;  4NN7 A;  1LK3 A;  1SCF A;  5C3E D;  3H0G D;  3NCE A;  2B5I A;  2B8Z A;  2O6I A;  3VA2 A;  1ALU A;  4GS7 A;  1ITL A;  1F45 B;  3EW3 A;  1BGE A;  3SE4 B;  1BBN A;  3LB6 B;  4X51 A;  3DI2 A;  1RW5 A;  1ITM A;  2R93 D;  4DKC A;  4BBR D;  4CNI C;  5IYC D;  1IAR A;  1D9C A;  4NEM A;  5TS9 A;  4A3E D;  5FHX A;  1HUL A;  4A93 D;  1PW6 A;  1V7N V;  3INK C;  4O6K A;  3NCF A;  3QAZ A;  4J4L C;  2ILK A;  1WCM D;  1IL6 A;  4NKQ C;  1HIK A;  3PIV A;  4WRL B;  1Y6M L;  3BPO A;  2JA8 D;  3PO2 D;  4A3L D;  1LQS L;  5D72 A;  1INR A;  2Q14 A;  1YKB A;  1HIJ A;  1PGR A;  2LAG A;  3LB6 A;  4GRW A;  4LRL A;  3H3V E;  1BCN A;  2IL6 A;  3QB7 A;  2JA7 D;  3BES L;  3TGX B;  1VLK A;  5C4X D;  1Y14 A;  5C44 D;  2O27 A;  3D87 A;  1EXZ A;  2B8Y A;  1M48 A;  2KZ1 A;  1HUW A;  2B91 A;  4A3G D;  1ETE A;  3UX9 A;  2XQB A;  5FLM D;  4NN6 A;  1HZI A;  1D9G A;  1PVH B;  4NI9 A;  3BPL A;  5FUC A;  3NCC A;  2Q7N B;  2L3O A;  4A3K D;  1WU3 I;  1FG9 A;  3BPN A;  3UEZ E;  3WCY I;  4PS4 A;  3MZG A;  3OG6 A;  1V7M V;  3I4M D;  1M4C A;  1BP3 A;  1HWH A;  5LQB A;  4ZS7 A;  1RHG A;  1GA3 A;  5D70 A;  2B90 A;  1AX8 A;  1Y1W D;  1BGC A;  4EXP A;  1P9M B;  1CSG A;  2Z3Q A;  3N0P A;  4A3I D;  4BY1 D;  4ZF7 A;  2VUM D;  1M4R A;  1B5L A;  2B63 D;  1Y6N L;  3HOV D;  4DKE A;  3OQ3 A;  2R92 D;  2INT A;  2O26 A;  3DI3 A;  5E4E A;  1Y6K L;  3PO3 D;  4A3M D;  1M47 A;  1A7M A;  1ILK A;  3DUH C;  3QWR B;  3UF2 A;  4NEJ A;  1EMR A;  2B8U A;  4NI7 A;  3FKI D;  2GMF A;  3QT2 C;  1EVS A;  1HGU A;  3HHC A;  5D22 A;  3EJJ A;  3HMX B;  1A22 A;  4DOH A;  3IRH A;  4FA8 E;  5IP9 D;  3S9D A;  4A3B D;  1M4A A;  4MHL A;  3HHR A;  1EKU A;  3UF5 A;  4BBS D;  3L5X A;  3OG4 A;  4RS1 A;  1ITI A;  1IRL A;  2OQP A;  3HOX D;  1AU1 A;  4BXX D;  1RFB A;  3N06 A;  3HOY D;  1IK0 A;  3D85 C;  3DGC L;  4A3J D;  4I77 Z;  1CD9 A;  4BY7 D;  3HOW D;  1F6F A;  4NN5 A;  2R7Z D;  3Q1S I;  3L5W I;  4A3F D;  2Q98 A;  2LMS A;  5IYB D;  1Y1V D;  1BUY A;  3G9V B;  1M49 A;  4DKF A;  2D9Q A;  2JA6 D;  1CN4 C;  3QB1 A;  1CYL A;  3DLQ I;  1LKI A;  2HYM B;  4O9H A;  1AXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...