4FANC

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 40 days
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
128
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 32
structure length 128
sequence length 129
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4fanC00
4L3HC 3RLMC 3RMZC 2HJBD 1MG3B 1MG2B 3PXTC 3RN0C 2OIZD 2OK4D 4K3IC 4FAVC 3RN1C 2J57K 3SLEC 2I0TD 3SWSC 3SXTC 2AGYD 2BBKL 3L4OC 2GC4B 1MDAL 4L1QC 2HXCD 1MAEL 2AH0D 2I0RD 2AGLD 2HKMD 2OK6D 2HJ4D 4FANC 2AGXD 1MAFL 2AGWD 2I0SD 3PXSC 3L4MC 2GC7B 2IUPD 2J55L 2OJYD 2IAAB 4Y5RC 2H3XB 4O1QC 2AH1D 3C75L 2MTAL 4FB1C 2HKRD 2MADL 2H47B 4FA9C 3SJLC 2J56L 4FA4C 3SVWC 4FA1C 2AGZD 2IUVD 3ORVC 4L3GC 4FA5C 2Q7QD 3PXWC 2IUQD 2IURD
chains in the Genus database with same CATH superfamily
4L3HC 3RLMC 3RMZC 2HJBD 1MG3B 1MG2B 3PXTC 3RN0C 2OIZD 2OK4D 4K3IC 4FAVC 3RN1C 2J57K 3SLEC 2I0TD 3SWSC 3SXTC 2AGYD 2BBKL 3L4OC 2GC4B 1MDAL 4L1QC 2HXCD 1MAEL 2AH0D 2I0RD 2AGLD 2HKMD 2OK6D 2HJ4D 4FANC 2AGXD 1MAFL 2AGWD 2I0SD 3PXSC 3L4MC 2GC7B 2IUPD 2J55L 2OJYD 2IAAB 4Y5RC 2H3XB 4O1QC 2AH1D 3C75L 2MTAL 4FB1C 2HKRD 2MADL 2H47B 4FA9C 3SJLC 2J56L 4FA4C 3SVWC 4FA1C 2AGZD 2IUVD 3ORVC 4L3GC 4FA5C 2Q7QD 3PXWC 2IUQD 2IURD
chains in the Genus database with same CATH topology
4L3HC 3RLMC 3RMZC 2HJBD 1MG3B 1MG2B 3PXTC 3RN0C 2OIZD 2OK4D 4K3IC 4FAVC 3RN1C 2J57K 3SLEC 2I0TD 3SWSC 3SXTC 2AGYD 2BBKL 3L4OC 2GC4B 1MDAL 4L1QC 2HXCD 1MAEL 2AH0D 2I0RD 2AGLD 2HKMD 2OK6D 2HJ4D 4FANC 2AGXD 1MAFL 2AGWD 2I0SD 3PXSC 3L4MC 2GC7B 2IUPD 2J55L 2OJYD 2IAAB 4Y5RC 2H3XB 4O1QC 2AH1D 3C75L 2MTAL 4FB1C 2HKRD 2MADL 2H47B 4FA9C 3SJLC 2J56L 4FA4C 3SVWC 4FA1C 2AGZD 2IUVD 3ORVC 4L3GC 4FA5C 2Q7QD 3PXWC 2IUQD 2IURD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L3H C;  3RLM C;  3RMZ C;  2HJB D;  1MG3 B;  1MG2 B;  3PXT C;  3RN0 C;  2OIZ D;  2OK4 D;  4K3I C;  4FAV C;  3RN1 C;  2J57 K;  3SLE C;  2I0T D;  3SWS C;  3SXT C;  2AGY D;  2BBK L;  3L4O C;  2GC4 B;  1MDA L;  4L1Q C;  2HXC D;  1MAE L;  2AH0 D;  2I0R D;  2AGL D;  2HKM D;  2OK6 D;  2HJ4 D;  4FAN C;  2AGX D;  1MAF L;  2AGW D;  2I0S D;  3PXS C;  3L4M C;  2GC7 B;  2IUP D;  2J55 L;  2OJY D;  2IAA B;  4Y5R C;  2H3X B;  4O1Q C;  2AH1 D;  3C75 L;  2MTA L;  4FB1 C;  2HKR D;  2MAD L;  2H47 B;  4FA9 C;  3SJL C;  2J56 L;  4FA4 C;  3SVW C;  4FA1 C;  2AGZ D;  2IUV D;  3ORV C;  4L3G C;  4FA5 C;  2Q7Q D;  3PXW C;  2IUQ D;  2IUR D; 
#chains in the Genus database with same CATH topology
 4L3H C;  3RLM C;  3RMZ C;  2HJB D;  1MG3 B;  1MG2 B;  3PXT C;  3RN0 C;  2OIZ D;  2OK4 D;  4K3I C;  4FAV C;  3RN1 C;  2J57 K;  3SLE C;  2I0T D;  3SWS C;  3SXT C;  2AGY D;  2BBK L;  3L4O C;  2GC4 B;  1MDA L;  4L1Q C;  2HXC D;  1MAE L;  2AH0 D;  2I0R D;  2AGL D;  2HKM D;  2OK6 D;  2HJ4 D;  4FAN C;  2AGX D;  1MAF L;  2AGW D;  2I0S D;  3PXS C;  3L4M C;  2GC7 B;  2IUP D;  2J55 L;  2OJY D;  2IAA B;  4Y5R C;  2H3X B;  4O1Q C;  2AH1 D;  3C75 L;  2MTA L;  4FB1 C;  2HKR D;  2MAD L;  2H47 B;  4FA9 C;  3SJL C;  2J56 L;  4FA4 C;  3SVW C;  4FA1 C;  2AGZ D;  2IUV D;  3ORV C;  4L3G C;  4FA5 C;  2Q7Q D;  3PXW C;  2IUQ D;  2IUR D; 
#chains in the Genus database with same CATH homology
 4L3H C;  3RLM C;  3RMZ C;  2HJB D;  1MG3 B;  1MG2 B;  3PXT C;  3RN0 C;  2OIZ D;  2OK4 D;  4K3I C;  4FAV C;  3RN1 C;  2J57 K;  3SLE C;  2I0T D;  3SWS C;  3SXT C;  2AGY D;  2BBK L;  3L4O C;  2GC4 B;  1MDA L;  4L1Q C;  2HXC D;  1MAE L;  2AH0 D;  2I0R D;  2AGL D;  2HKM D;  2OK6 D;  2HJ4 D;  4FAN C;  2AGX D;  1MAF L;  2AGW D;  2I0S D;  3PXS C;  3L4M C;  2GC7 B;  2IUP D;  2J55 L;  2OJY D;  2IAA B;  4Y5R C;  2H3X B;  4O1Q C;  2AH1 D;  3C75 L;  2MTA L;  4FB1 C;  2HKR D;  2MAD L;  2H47 B;  4FA9 C;  3SJL C;  2J56 L;  4FA4 C;  3SVW C;  4FA1 C;  2AGZ D;  2IUV D;  3ORV C;  4L3G C;  4FA5 C;  2Q7Q D;  3PXW C;  2IUQ D;  2IUR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...