4FANC

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 40 days
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
129
structure length
128
Chain Sequence
b'TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKASHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 32
structure length 128
sequence length 129
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4fanC00
2H3XB 1MDAL 2IUVD 2BBKL 2GC7B 2HJ4D 1MG3B 3PXWC 2HKRD 4K3IC 3L4MC 2HKMD 2J56L 3L4OC 1MG2B 2MTAL 3SXTC 3RMZC 2AGWD 2OK4D 2OIZD 2AGZD 2I0RD 3RN1C 2IUPD 2I0TD 2H47B 2IAAB 4Y5RC 2HXCD 4FA1C 2AGXD 3C75L 2OK6D 2Q7QD 4FAVC 3ORVC 2I0SD 3SVWC 1MAEL 2MADL 2HJBD 4L3HC 2OJYD 2AGYD 2IUQD 2IURD 3RLMC 4FB1C 3SJLC 1MAFL 2AGLD 4FA5C 3PXTC 3PXSC 2J57K 4L3GC 3RN0C 3SLEC 3SWSC 4L1QC 2GC4B 4FANC 2AH0D 4O1QC 4FA4C 2J55L 4FA9C 2AH1D
chains in the Genus database with same CATH superfamily
2H3XB 1MDAL 2IUVD 2BBKL 2GC7B 2HJ4D 1MG3B 3PXWC 2HKRD 4K3IC 3L4MC 2HKMD 2J56L 3L4OC 1MG2B 2MTAL 3SXTC 3RMZC 2AGWD 2OK4D 2OIZD 2AGZD 2I0RD 3RN1C 2IUPD 2I0TD 2H47B 2IAAB 4Y5RC 2HXCD 4FA1C 2AGXD 3C75L 2OK6D 2Q7QD 4FAVC 3ORVC 2I0SD 3SVWC 1MAEL 2MADL 2HJBD 4L3HC 2OJYD 2AGYD 2IUQD 2IURD 3RLMC 4FB1C 3SJLC 1MAFL 2AGLD 4FA5C 3PXTC 3PXSC 2J57K 4L3GC 3RN0C 3SLEC 3SWSC 4L1QC 2GC4B 4FANC 2AH0D 4O1QC 4FA4C 2J55L 4FA9C 2AH1D
chains in the Genus database with same CATH topology
2H3XB 1MDAL 2IUVD 2BBKL 2GC7B 2HJ4D 1MG3B 3PXWC 2HKRD 4K3IC 3L4MC 2HKMD 2J56L 3L4OC 1MG2B 2MTAL 3SXTC 3RMZC 2AGWD 2OK4D 2OIZD 2AGZD 2I0RD 3RN1C 2IUPD 2I0TD 2H47B 2IAAB 4Y5RC 2HXCD 4FA1C 2AGXD 3C75L 2OK6D 2Q7QD 4FAVC 3ORVC 2I0SD 3SVWC 1MAEL 2MADL 2HJBD 4L3HC 2OJYD 2AGYD 2IUQD 2IURD 3RLMC 4FB1C 3SJLC 1MAFL 2AGLD 4FA5C 3PXTC 3PXSC 2J57K 4L3GC 3RN0C 3SLEC 3SWSC 4L1QC 2GC4B 4FANC 2AH0D 4O1QC 4FA4C 2J55L 4FA9C 2AH1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3X B;  1MDA L;  2IUV D;  2BBK L;  2GC7 B;  2HJ4 D;  1MG3 B;  3PXW C;  2HKR D;  4K3I C;  3L4M C;  2HKM D;  2J56 L;  3L4O C;  1MG2 B;  2MTA L;  3SXT C;  3RMZ C;  2AGW D;  2OK4 D;  2OIZ D;  2AGZ D;  2I0R D;  3RN1 C;  2IUP D;  2I0T D;  2H47 B;  2IAA B;  4Y5R C;  2HXC D;  4FA1 C;  2AGX D;  3C75 L;  2OK6 D;  2Q7Q D;  4FAV C;  3ORV C;  2I0S D;  3SVW C;  1MAE L;  2MAD L;  2HJB D;  4L3H C;  2OJY D;  2AGY D;  2IUQ D;  2IUR D;  3RLM C;  4FB1 C;  3SJL C;  1MAF L;  2AGL D;  4FA5 C;  3PXT C;  3PXS C;  2J57 K;  4L3G C;  3RN0 C;  3SLE C;  3SWS C;  4L1Q C;  2GC4 B;  4FAN C;  2AH0 D;  4O1Q C;  4FA4 C;  2J55 L;  4FA9 C;  2AH1 D; 
#chains in the Genus database with same CATH topology
 2H3X B;  1MDA L;  2IUV D;  2BBK L;  2GC7 B;  2HJ4 D;  1MG3 B;  3PXW C;  2HKR D;  4K3I C;  3L4M C;  2HKM D;  2J56 L;  3L4O C;  1MG2 B;  2MTA L;  3SXT C;  3RMZ C;  2AGW D;  2OK4 D;  2OIZ D;  2AGZ D;  2I0R D;  3RN1 C;  2IUP D;  2I0T D;  2H47 B;  2IAA B;  4Y5R C;  2HXC D;  4FA1 C;  2AGX D;  3C75 L;  2OK6 D;  2Q7Q D;  4FAV C;  3ORV C;  2I0S D;  3SVW C;  1MAE L;  2MAD L;  2HJB D;  4L3H C;  2OJY D;  2AGY D;  2IUQ D;  2IUR D;  3RLM C;  4FB1 C;  3SJL C;  1MAF L;  2AGL D;  4FA5 C;  3PXT C;  3PXS C;  2J57 K;  4L3G C;  3RN0 C;  3SLE C;  3SWS C;  4L1Q C;  2GC4 B;  4FAN C;  2AH0 D;  4O1Q C;  4FA4 C;  2J55 L;  4FA9 C;  2AH1 D; 
#chains in the Genus database with same CATH homology
 2H3X B;  1MDA L;  2IUV D;  2BBK L;  2GC7 B;  2HJ4 D;  1MG3 B;  3PXW C;  2HKR D;  4K3I C;  3L4M C;  2HKM D;  2J56 L;  3L4O C;  1MG2 B;  2MTA L;  3SXT C;  3RMZ C;  2AGW D;  2OK4 D;  2OIZ D;  2AGZ D;  2I0R D;  3RN1 C;  2IUP D;  2I0T D;  2H47 B;  2IAA B;  4Y5R C;  2HXC D;  4FA1 C;  2AGX D;  3C75 L;  2OK6 D;  2Q7Q D;  4FAV C;  3ORV C;  2I0S D;  3SVW C;  1MAE L;  2MAD L;  2HJB D;  4L3H C;  2OJY D;  2AGY D;  2IUQ D;  2IUR D;  3RLM C;  4FB1 C;  3SJL C;  1MAF L;  2AGL D;  4FA5 C;  3PXT C;  3PXS C;  2J57 K;  4L3G C;  3RN0 C;  3SLE C;  3SWS C;  4L1Q C;  2GC4 B;  4FAN C;  2AH0 D;  4O1Q C;  4FA4 C;  2J55 L;  4FA9 C;  2AH1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...