4FAOC

Specificity and structure of a high affinity activin-like 1 (alk1) signaling complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
75
structure length
75
Chain Sequence
PLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Growth/differentiation factor 2
publication title Specificity and Structure of a High Affinity Activin Receptor-like Kinase 1 (ALK1) Signaling Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein/signaling protein
total genus 12
structure length 75
sequence length 75
chains with identical sequence D, I, J, O, P, U, V, c, d, i, j
ec nomenclature ec 2.7.11.30: Receptor protein serine/threonine kinase.
pdb deposition date 2012-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 4faoC00
2MUPA 2K3GA 1KL8A 2LCRA 1CODA 1CXOA 2OFSA 1CDTA 2MHYA 4FAOE 1V6PA 5IMTD 1IK8A 2JVEA 3NDSA 1NTNA 3LAQU 2H8UA 2QJAC 4OM5A 2H62D 3NH7A 1I02A 1TXAA 1IDGA 2X8BB 1LJZA 1QKDA 1TFSA 2BTXA 1FRAA 2H5FA 2BHIA 3QB4B 4XJJA 5DO6A 2MJYA 1JE9A 1HAAA 1LSIA 1W6BA 2HLRA 1MR6A 3BT2U 1LXHA 2H62C 2L03A 3FEVA 3NEQA 1IDIA 1RL5A 2H7ZB 1BXPA 1IQ9A 1PLOA 2CTXA 1VB0A 1YWHA 1CREA 2HLQA 4OM4A 1KS6A 2H7ZA 2N99A 2JQPA 2MUOA 1CVOA 2CRTA 1TXBA 1KC4A 1ZADA 1CRFA 1HC9A 2QJBC 1CDQA 1CB9A 1CDSA 1NTXA 1ABTA 3VTSA 1QKEA 3KFDI 1KBSA 1NYUA 2FD6U 1MAHF 2MJ0A 2ERAA 4LFTA 1F94A 1L4WA 1XT3A 2VLWA 1M9ZA 1CXNA 2PJYC 3EBXA 1CDRA 1BTEA 1FSSB 1KBTA 2J8BA 1KFHA 1QM7A 1FASA 3U73U 1FSCA 1LX5B 2H64C 1HOYA 1JBDA 1B41B 3BT1U 4QTIU 3U74U 1NYSA 1IJCA 1UG4A 4EY8B 2QJ9C 1CHVS 2QC1A 1NORA 4RUDA 2PJYB 4BDTB 5IMYC 1HAJA 1IDLA 1FF4A 5DU1A 5EBXA 1RGJA 1KBAA 3EVSC 1CCQA 2UWRA 2H64B 1REWC 4FAOC 1IKCA 1CTXA 4P7UA 2CRSA 1ERGA 1ERAA 4AEAA 1S4YA 1JGKA 4UY2C 1ES7B 2CCXA 1NXBA 4ZQYA 6EBXA 1IDHA 1FFJA 1TGXA 2MFAA 1KU6B 2MJ4A 1ONJA 2CDXA 1COEA 3KFDE 2GOOC 2NBTA 1KTZB 3ERAA 1G6MA 2LA1A 3PLCA 1F8UB 2ABXA 2I9BE 4IYEA 1NEAA 1H0JA 2UX2A 2GOOB 1DRSA 4DO8A 1LXGA 4BIKB 1HC9B 3HH7A 5DZ5A 2L5SA 4HQPF 1KXIA
chains in the Genus database with same CATH superfamily
2MUPA 2K3GA 1KL8A 2LCRA 1CODA 1CXOA 2OFSA 1CDTA 2MHYA 4FAOE 1V6PA 5IMTD 1IK8A 2JVEA 3NDSA 1NTNA 3LAQU 2H8UA 2QJAC 4OM5A 2H62D 3NH7A 1I02A 1TXAA 1IDGA 2X8BB 1LJZA 1QKDA 1TFSA 2BTXA 1FRAA 2H5FA 2BHIA 3QB4B 4XJJA 5DO6A 2MJYA 1JE9A 1HAAA 1LSIA 1W6BA 2HLRA 1MR6A 3BT2U 1LXHA 2H62C 2L03A 3FEVA 3NEQA 1IDIA 1RL5A 2H7ZB 1BXPA 1IQ9A 1PLOA 2CTXA 1VB0A 1YWHA 1CREA 2HLQA 4OM4A 1KS6A 2H7ZA 2N99A 2JQPA 2MUOA 1CVOA 2CRTA 1TXBA 1KC4A 1ZADA 1CRFA 1HC9A 2QJBC 1CDQA 1CB9A 1CDSA 1NTXA 1ABTA 3VTSA 1QKEA 3KFDI 1KBSA 1NYUA 2FD6U 1MAHF 2MJ0A 2ERAA 4LFTA 1F94A 1L4WA 1XT3A 2VLWA 1M9ZA 1CXNA 2PJYC 3EBXA 1CDRA 1BTEA 1FSSB 1KBTA 2J8BA 1KFHA 1QM7A 1FASA 3U73U 1FSCA 1LX5B 2H64C 4KSNA 1HOYA 1JBDA 1B41B 3BT1U 4QTIU 3U74U 1NYSA 1IJCA 1UG4A 4EY8B 2QJ9C 1CHVS 2QC1A 1NORA 4RUDA 2PJYB 4BDTB 5IMYC 1HAJA 1IDLA 1FF4A 5DU1A 5EBXA 1RGJA 1KBAA 3EVSC 1CCQA 2UWRA 2H64B 1REWC 4FAOC 1IKCA 1CTXA 4P7UA 2CRSA 1ERGA 1ERAA 4AEAA 1S4YA 1JGKA 4UY2C 1ES7B 2CCXA 1NXBA 4ZQYA 6EBXA 1IDHA 1FFJA 1TGXA 2MFAA 1KU6B 2MJ4A 1ONJA 2CDXA 1COEA 3KFDE 2GOOC 2NBTA 1KTZB 3ERAA 1G6MA 2LA1A 3PLCA 1F8UB 2ABXA 2I9BE 4IYEA 1NEAA 1H0JA 2UX2A 2GOOB 1DRSA 4DO8A 1LXGA 4BIKB 1HC9B 3HH7A 5DZ5A 2L5SA 4HQPF 1KXIA
chains in the Genus database with same CATH topology
2MUPA 2K3GA 1KL8A 2LCRA 1CODA 1CXOA 2OFSA 1CDTA 2MHYA 4FAOE 1V6PA 5IMTD 1IK8A 2JVEA 3NDSA 1NTNA 3LAQU 2H8UA 2QJAC 4OM5A 2H62D 3NH7A 1I02A 1TXAA 1IDGA 2X8BB 1LJZA 1QKDA 1TFSA 2BTXA 1FRAA 2H5FA 2BHIA 3QB4B 4XJJA 5DO6A 2MJYA 1JE9A 1HAAA 1LSIA 1W6BA 2HLRA 1MR6A 3BT2U 1LXHA 2H62C 2L03A 3FEVA 3NEQA 1IDIA 1RL5A 2H7ZB 1BXPA 1IQ9A 1PLOA 2CTXA 1VB0A 1YWHA 1CREA 2HLQA 4OM4A 1KS6A 2H7ZA 2N99A 2JQPA 2MUOA 1CVOA 2CRTA 1TXBA 1KC4A 1ZADA 1CRFA 1HC9A 2QJBC 1CDQA 1CB9A 1CDSA 1NTXA 1ABTA 3VTSA 1QKEA 3KFDI 1KBSA 1NYUA 2FD6U 1MAHF 2MJ0A 2ERAA 4LFTA 1F94A 1L4WA 1XT3A 2VLWA 1M9ZA 1CXNA 2PJYC 3EBXA 1CDRA 1BTEA 1FSSB 1KBTA 2J8BA 1KFHA 1QM7A 1FASA 3U73U 1FSCA 1LX5B 2H64C 4KSNA 1HOYA 1JBDA 1B41B 3BT1U 4QTIU 3U74U 1NYSA 1IJCA 1UG4A 4EY8B 2QJ9C 1CHVS 2QC1A 1NORA 4RUDA 2PJYB 4BDTB 5IMYC 1HAJA 1IDLA 1FF4A 5DU1A 5EBXA 1RGJA 1KBAA 3EVSC 1CCQA 2UWRA 2H64B 1REWC 4FAOC 1IKCA 1CTXA 4P7UA 2CRSA 1ERGA 1ERAA 4AEAA 1S4YA 1JGKA 4UY2C 1ES7B 2CCXA 1NXBA 4ZQYA 6EBXA 1IDHA 1FFJA 1TGXA 2MFAA 1KU6B 2MJ4A 1ONJA 2CDXA 1COEA 3KFDE 2GOOC 2NBTA 1KTZB 3ERAA 1G6MA 2LA1A 3PLCA 1F8UB 2ABXA 2I9BE 4IYEA 1NEAA 1H0JA 2UX2A 2GOOB 1DRSA 4DO8A 1LXGA 4BIKB 1HC9B 3HH7A 5DZ5A 2L5SA 4HQPF 1KXIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MUP A;  2K3G A;  1KL8 A;  2LCR A;  1COD A;  1CXO A;  2OFS A;  1CDT A;  2MHY A;  4FAO E;  1V6P A;  5IMT D;  1IK8 A;  2JVE A;  3NDS A;  1NTN A;  3LAQ U;  2H8U A;  2QJA C;  4OM5 A;  2H62 D;  3NH7 A;  1I02 A;  1TXA A;  1IDG A;  2X8B B;  1LJZ A;  1QKD A;  1TFS A;  2BTX A;  1FRA A;  2H5F A;  2BHI A;  3QB4 B;  4XJJ A;  5DO6 A;  2MJY A;  1JE9 A;  1HAA A;  1LSI A;  1W6B A;  2HLR A;  1MR6 A;  3BT2 U;  1LXH A;  2H62 C;  2L03 A;  3FEV A;  3NEQ A;  1IDI A;  1RL5 A;  2H7Z B;  1BXP A;  1IQ9 A;  1PLO A;  2CTX A;  1VB0 A;  1YWH A;  1CRE A;  2HLQ A;  4OM4 A;  1KS6 A;  2H7Z A;  2N99 A;  2JQP A;  2MUO A;  1CVO A;  2CRT A;  1TXB A;  1KC4 A;  1ZAD A;  1CRF A;  1HC9 A;  2QJB C;  1CDQ A;  1CB9 A;  1CDS A;  1NTX A;  1ABT A;  3VTS A;  1QKE A;  3KFD I;  1KBS A;  1NYU A;  2FD6 U;  1MAH F;  2MJ0 A;  2ERA A;  4LFT A;  1F94 A;  1L4W A;  1XT3 A;  2VLW A;  1M9Z A;  1CXN A;  2PJY C;  3EBX A;  1CDR A;  1BTE A;  1FSS B;  1KBT A;  2J8B A;  1KFH A;  1QM7 A;  1FAS A;  3U73 U;  1FSC A;  1LX5 B;  2H64 C;  1HOY A;  1JBD A;  1B41 B;  3BT1 U;  4QTI U;  3U74 U;  1NYS A;  1IJC A;  1UG4 A;  4EY8 B;  2QJ9 C;  1CHV S;  2QC1 A;  1NOR A;  4RUD A;  2PJY B;  4BDT B;  5IMY C;  1HAJ A;  1IDL A;  1FF4 A;  5DU1 A;  5EBX A;  1RGJ A;  1KBA A;  3EVS C;  1CCQ A;  2UWR A;  2H64 B;  1REW C;  4FAO C;  1IKC A;  1CTX A;  4P7U A;  2CRS A;  1ERG A;  1ERA A;  4AEA A;  1S4Y A;  1JGK A;  4UY2 C;  1ES7 B;  2CCX A;  1NXB A;  4ZQY A;  6EBX A;  1IDH A;  1FFJ A;  1TGX A;  2MFA A;  1KU6 B;  2MJ4 A;  1ONJ A;  2CDX A;  1COE A;  3KFD E;  2GOO C;  2NBT A;  1KTZ B;  3ERA A;  1G6M A;  2LA1 A;  3PLC A;  1F8U B;  2ABX A;  2I9B E;  4IYE A;  1NEA A;  1H0J A;  2UX2 A;  2GOO B;  1DRS A;  4DO8 A;  1LXG A;  4BIK B;  1HC9 B;  3HH7 A;  5DZ5 A;  2L5S A;  4HQP F;  1KXI A; 
#chains in the Genus database with same CATH topology
 2MUP A;  2K3G A;  1KL8 A;  2LCR A;  1COD A;  1CXO A;  2OFS A;  1CDT A;  2MHY A;  4FAO E;  1V6P A;  5IMT D;  1IK8 A;  2JVE A;  3NDS A;  1NTN A;  3LAQ U;  2H8U A;  2QJA C;  4OM5 A;  2H62 D;  3NH7 A;  1I02 A;  1TXA A;  1IDG A;  2X8B B;  1LJZ A;  1QKD A;  1TFS A;  2BTX A;  1FRA A;  2H5F A;  2BHI A;  3QB4 B;  4XJJ A;  5DO6 A;  2MJY A;  1JE9 A;  1HAA A;  1LSI A;  1W6B A;  2HLR A;  1MR6 A;  3BT2 U;  1LXH A;  2H62 C;  2L03 A;  3FEV A;  3NEQ A;  1IDI A;  1RL5 A;  2H7Z B;  1BXP A;  1IQ9 A;  1PLO A;  2CTX A;  1VB0 A;  1YWH A;  1CRE A;  2HLQ A;  4OM4 A;  1KS6 A;  2H7Z A;  2N99 A;  2JQP A;  2MUO A;  1CVO A;  2CRT A;  1TXB A;  1KC4 A;  1ZAD A;  1CRF A;  1HC9 A;  2QJB C;  1CDQ A;  1CB9 A;  1CDS A;  1NTX A;  1ABT A;  3VTS A;  1QKE A;  3KFD I;  1KBS A;  1NYU A;  2FD6 U;  1MAH F;  2MJ0 A;  2ERA A;  4LFT A;  1F94 A;  1L4W A;  1XT3 A;  2VLW A;  1M9Z A;  1CXN A;  2PJY C;  3EBX A;  1CDR A;  1BTE A;  1FSS B;  1KBT A;  2J8B A;  1KFH A;  1QM7 A;  1FAS A;  3U73 U;  1FSC A;  1LX5 B;  2H64 C;  4KSN A;  1HOY A;  1JBD A;  1B41 B;  3BT1 U;  4QTI U;  3U74 U;  1NYS A;  1IJC A;  1UG4 A;  4EY8 B;  2QJ9 C;  1CHV S;  2QC1 A;  1NOR A;  4RUD A;  2PJY B;  4BDT B;  5IMY C;  1HAJ A;  1IDL A;  1FF4 A;  5DU1 A;  5EBX A;  1RGJ A;  1KBA A;  3EVS C;  1CCQ A;  2UWR A;  2H64 B;  1REW C;  4FAO C;  1IKC A;  1CTX A;  4P7U A;  2CRS A;  1ERG A;  1ERA A;  4AEA A;  1S4Y A;  1JGK A;  4UY2 C;  1ES7 B;  2CCX A;  1NXB A;  4ZQY A;  6EBX A;  1IDH A;  1FFJ A;  1TGX A;  2MFA A;  1KU6 B;  2MJ4 A;  1ONJ A;  2CDX A;  1COE A;  3KFD E;  2GOO C;  2NBT A;  1KTZ B;  3ERA A;  1G6M A;  2LA1 A;  3PLC A;  1F8U B;  2ABX A;  2I9B E;  4IYE A;  1NEA A;  1H0J A;  2UX2 A;  2GOO B;  1DRS A;  4DO8 A;  1LXG A;  4BIK B;  1HC9 B;  3HH7 A;  5DZ5 A;  2L5S A;  4HQP F;  1KXI A; 
#chains in the Genus database with same CATH homology
 2MUP A;  2K3G A;  1KL8 A;  2LCR A;  1COD A;  1CXO A;  2OFS A;  1CDT A;  2MHY A;  4FAO E;  1V6P A;  5IMT D;  1IK8 A;  2JVE A;  3NDS A;  1NTN A;  3LAQ U;  2H8U A;  2QJA C;  4OM5 A;  2H62 D;  3NH7 A;  1I02 A;  1TXA A;  1IDG A;  2X8B B;  1LJZ A;  1QKD A;  1TFS A;  2BTX A;  1FRA A;  2H5F A;  2BHI A;  3QB4 B;  4XJJ A;  5DO6 A;  2MJY A;  1JE9 A;  1HAA A;  1LSI A;  1W6B A;  2HLR A;  1MR6 A;  3BT2 U;  1LXH A;  2H62 C;  2L03 A;  3FEV A;  3NEQ A;  1IDI A;  1RL5 A;  2H7Z B;  1BXP A;  1IQ9 A;  1PLO A;  2CTX A;  1VB0 A;  1YWH A;  1CRE A;  2HLQ A;  4OM4 A;  1KS6 A;  2H7Z A;  2N99 A;  2JQP A;  2MUO A;  1CVO A;  2CRT A;  1TXB A;  1KC4 A;  1ZAD A;  1CRF A;  1HC9 A;  2QJB C;  1CDQ A;  1CB9 A;  1CDS A;  1NTX A;  1ABT A;  3VTS A;  1QKE A;  3KFD I;  1KBS A;  1NYU A;  2FD6 U;  1MAH F;  2MJ0 A;  2ERA A;  4LFT A;  1F94 A;  1L4W A;  1XT3 A;  2VLW A;  1M9Z A;  1CXN A;  2PJY C;  3EBX A;  1CDR A;  1BTE A;  1FSS B;  1KBT A;  2J8B A;  1KFH A;  1QM7 A;  1FAS A;  3U73 U;  1FSC A;  1LX5 B;  2H64 C;  4KSN A;  1HOY A;  1JBD A;  1B41 B;  3BT1 U;  4QTI U;  3U74 U;  1NYS A;  1IJC A;  1UG4 A;  4EY8 B;  2QJ9 C;  1CHV S;  2QC1 A;  1NOR A;  4RUD A;  2PJY B;  4BDT B;  5IMY C;  1HAJ A;  1IDL A;  1FF4 A;  5DU1 A;  5EBX A;  1RGJ A;  1KBA A;  3EVS C;  1CCQ A;  2UWR A;  2H64 B;  1REW C;  4FAO C;  1IKC A;  1CTX A;  4P7U A;  2CRS A;  1ERG A;  1ERA A;  4AEA A;  1S4Y A;  1JGK A;  4UY2 C;  1ES7 B;  2CCX A;  1NXB A;  4ZQY A;  6EBX A;  1IDH A;  1FFJ A;  1TGX A;  2MFA A;  1KU6 B;  2MJ4 A;  1ONJ A;  2CDX A;  1COE A;  3KFD E;  2GOO C;  2NBT A;  1KTZ B;  3ERA A;  1G6M A;  2LA1 A;  3PLC A;  1F8U B;  2ABX A;  2I9B E;  4IYE A;  1NEA A;  1H0J A;  2UX2 A;  2GOO B;  1DRS A;  4DO8 A;  1LXG A;  4BIK B;  1HC9 B;  3HH7 A;  5DZ5 A;  2L5S A;  4HQP F;  1KXI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...