4FAPA

Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords FK506-BINDING PROTEIN
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4fapA00
2L2SA 2Q5AA 2F4EA 2XP8A 2RQSA 1FD9A 4TNSA 2DG4A 2PPNA 4TW7A 1D7JA 1BL4A 3O5IA 1FKKA 2LPVA 1EYMA 3KZ7A 1J4RA 3FAPA 2M2AA 4TW8A 3O5RA 3IHZA 2ZQSA 2PV2A 2K8IA 2AWGA 4DH0A 1YATA 4JFLA 2XP3A 4U86A 3RGCA 1FAPA 1U79A 3UF8A 2DG9A 1A7XA 2LJ4A 2KGJA 3OOBA 3O5LA 4MSPA 1ROTA 4FN2A 1ZK6A 3JXVA 3KAHA 4NNRA 3LUOA 3MDYB 4JFJA 3TC5A 2RSEA 4BF8A 4DROA 2FKEA 2M1IA 4G50A 2OFNA 4ITZA 1F8AB 4DRHA 2KR7A 1B6CA 3O5PA 3O5QA 4ODOA 3H9RB 3IKGA 1P5QA 4ODMA 3KAFA 3IK8A 3TDBA 4W9OA 1F40A 1D7IA 4QT3A 3UI5A 3NRKA 4IQ2A 1BKFA 1KT1A 1FKJA 1Q6UA 2ZQUA 1QPLA 3TCZA 2VN1A 1FJDA 1L1PA 3JYMA 4GIVA 1JNSA 4J4OA 1FKSA 3CGNA 4ODNA 4U85A 1D7HA 5B8IC 5J6EA 4DZ3A 2RURA 1TCOC 5HW7A 4DRMA 4QIBA 2PV1A 2XPBA 3KADA 3KCEA 4DZ2A 1HXVA 2XP5A 2XP4A 4QT2A 1Y0OA 5HW8A 2F2DA 1FKHA 4JFMA 3UQIA 2ZR5A 3I6CA 3ODKA 3PRBA 4G2PA 1J4IA 4ODRA 4TW6A 2F21A 4J4NA 2XP9A 4DRIA 4JYSA 2RUQA 2D9FA 4N19A 1T11A 1FKRA 1M5YA 2IF4A 4FAPA 1KT0A 1QPFA 3O5KA 4U84A 2MNTA 3UI4A 4ODKA 4LAVA 1Q6HA 2RUCA 4DRQA 5HKGA 3O5EA 1W26A 4DT4A 3NTPA 4TYOA 1JNTA 2N87A 2ZR4A 1FKDA 3EY6A 3O5OA 2VCDA 4JFIA 1EQ3A 4DRPA 1J6YA 1PBKA 4DRKA 2ZR6A 3UQBA 2MLXA 5HWCA 3KAGA 5BXJA 5I98A 3CGMA 4JFKA 4MGVA 2Y78A 4DRJA 2MPHA 3B7XA 4LAWA 2XPAA 3IKDA 2ZQVA 4ODQA 2PV3A 4R0XA 5HT1A 2M08A 4ODLA 3WH0A 1Q1CA 2LKNA 3PRDA 4DIPA 5HUAA 1FKIA 2PPPA 1N1AA 1NMWA 3KAIA 4ODPA 5DIVA 3JYJA 5DIUA 5HWBA 1D6OA 3NI6A 1C9HA 4TX0A 2LGOA 1FKBA 3GPKA 2DG3A 3KABA 3RFWA 1NMVA 3O5MA 1ROUA 3O5FA 2UZ5A 2KFWA 2PPOA 4IPXA 4O2TA 4W9QA 4W9PA 1ZCNA 2MF9A 2MLZA 5HW6A 1R9HA 1QZ2A 5DITA 5D75A 2PBCA 4IQCA 3O5DA 3UI6A 4DRNA 1Q6IA 2ZQTA 2XP6A 3UQAA 2ITKA 2KE0A 3O5GA 1FKFA 1JVWA 3VAWA 5HTGA 3KACA 4GGQA 3O5JA 4LAXA 2JZVA 4C02B 5GPGA 2KI3A 1FKLA 1YW5A 1FKGA 2FAPA 2MLYA 1NSGA 4LAYA 2RUDA 2KO7A 1PINA 1J4HA 3PA7A 2XP7A 1FKTA
chains in the Genus database with same CATH superfamily
4Z2IA 1FD9A 4TNSA 2DG4A 4Z2HA 3WD0A 1CTNA 1BL4A 1D7JA 1EYMA 1W9UA 1J4RA 3FAPA 2M2AA 2ZQSA 2PV2A 4AY1A 1YATA 2XP3A 5GQBA 4MPKA 1U79A 2LJ4A 2KGJA 3OOBA 4QZVB 1ROTA 3ARVA 3JXVA 4BF8A 4JFJA 1X6NA 3WIJA 1W9PA 3O5QA 3RM4A 1P5QA 2F23A 3KAFA 4ODMA 3TDBA 1D2KA 1F40A 4QT3A 3NRKA 1Q6UA 4ZPWR 2ZQUA 3TCZA 1X6LA 1JNSA 4ZPTR 3CGNA 1HKJA 4DZ3A 2AOSA 4WKFA 4DRMA 3KCEA 2DSZA 2XP5A 4QT2A 1W9VA 4JFMA 1HKKA 2G8ZA 3PRBA 1HJVA 1JNDA 1OGBA 2XP9A 4DRIA 1NWTA 4N19A 4DWSA 1L1PA 1QPFA 2MNTA 1Q6HA 1E6ZA 2WLYA 4DT4A 1JNTA 3EY6A 3B9AA 3WD2A 3B9EA 2DPEA 1NWUA 2MPHA 3B7XA 4LAWA 3EIPA 3IKDA 3WH0A 5HT1A 3ARXA 4ODLA 5HUAA 1NMWA 2OLHA 5HBFA 3GU0A 3O5MA 1VF8A 2WM0A 5DITA 4IQCA 2IUZA 2ZQTA 3UQAA 1JVWA 5HTGA 2DSWA 3G6LA 4Q7NA 2JZVA 4NSBA 2A3CA 1ZBWA 1NWSA 1YW5A 3ARRA 4WKAA 1PINA 4WJXA 2L2SA 2RQSA 4HBEA 4TW7A 1FKKA 2LPVA 1TFVA 1ZB5A 3IHZA 4L3NA 4DH0A 4JFLA 1OGGA 2DT2A 4HBOA 1A7XA 1ZK6A 3KAHA 4DROA 3MDYB 2RSEA 4P8WA 1EHNA 2FKEA 3ALGA 3WQVA 3WQWA 4DRHA 2A3AA 3H9RB 3PR9A 3RM9A 4DWSB 1D7IA 3FY1A 1HJXA 4URIA 5DO2A 4Z2JA 4ODNA 5B8IC 5HW7A 4QIBA 2PV1A 2XPBA 5HW8A 1FKHA 4L72B 4Z2LA 1J4IA 4ODRA 4TW6A 2F21A 4LGXA 2RUQA 4MNKA 1FKRA 3CZ8A 4ODKA 4LAVA 4MNMA 1ITXA 4XAKA 4S3JA 1FKDA 3G6MA 4IT4A 3O5OA 1HKMA 4JFIA 1EQ3A 1PBKA 3CHFA 3ARQA 3ARPA 4JFKA 4MNJA 2EULA 4MGVA 3AS0A 3AS3A 2QF8A 4ODQA 2PV3A 4R0XA 2PPPA 1N1AA 4NZCA 5DIVA 1D6OA 3NI6A 1C9HA 1LL7A 1FKBA 3GPKA 3ALFA 1ROUA 2PPOA 4IPXA 3WL1A 1ZCNA 2MF9A 2MLZA 1WNOA 1WB0A 2XP6A 2DT3A 2ITKA 3O5GA 3VAWA 1FKFA 1ZL1A 3KACA 4LAXA 1E6PA 3O5JA 3B8SA 3GTYX 4WK9A 2KI3A 1FKGA 3AQUA 5GPRA 1FKTA 2Q5AA 1E6RA 2XP8A 2PPNA 4KQZA 1RD6A 3KZ7A 4HARA 4UDMA 1W1PA 1H0GA 3BMBA 1UR8A 2A3BA 1ZU8A 1FAPA 3UF8A 2DG9A 2DSUA 3O5LA 3TC5A 3LUOA 3ARZA 1XHGA 4G50A 2OFNA 4ITZA 1B6CA 3O5PA 4ODOA 2P4VA 3IK8A 1BKFA 1KT1A 1FJDA 1QPLA 2VN1A 1JCHB 1FKSA 1D7HA 1W1YA 1ZBKA 5J6EA 4ZS6A 2RURA 4DZ2A 1HXVA 3RMEA 1Y0OA 1OWQA 2F2DA 3ARWA 3UQIA 2ZR5A 3I6CA 4G2PA 3RM8A 4J4NA 2O9OA 2DSVA 1T11A 4DWSC 1M5YA 2IF4A 4W5UA 1KT0A 4R5EA 4Z2KA 4FAPA 2RUCA 5HKGA 2DT0A 1W1VA 3O5EA 3PRAA 3NTPA 4TYOA 1LQ0A 3WD4A 2VCDA 3B9DA 3FXYA 1LG2A 4DRPA 3WKZA 3AS1A 3UQBA 1NH6A 5BXJA 3CGMA 2WK2A 3AS2A 2PN0A 1LG1A 1H0IA 2ETNA 2B31A 2XPAA 2ZQVA 1Q1CA 2LKNA 1ZBCA 2B5UB 1FFQA 1FKIA 3PRDA 4DIPA 3KAIA 4P8UA 3JYJA 1GUVA 2LGOA 4PTMA 2ESCA 2DG3A 3KABA 2A3EA 3QOKA 4ZPVR 2UZ5A 2KFWA 4O2TA 4W9PA 3OA5A 4KR0B 1O6IA 1R9HA 2PBCA 3O5DA 1Q6IA 1EDQA 2KE0A 4GGQA 1HJWA 4C02B 1LJYA 3ARUA 2PI6A 1SYTA 5DEZA 4P8VA 2YBTA 3WL0A 1J4HA 1ZBVA 5JH8A 1UR9A 2XP7A 1LL6A 2F4EA 3CHCA 3O5IA 1EIBA 3CHDA 4TW8A 3O5RA 2FDMA 2K8IA 2AWGA 1LL4A 4U86A 3RGCA 3ARYA 2G41A 4MSPA 4FN2A 1SR0A 4NNRA 1E6NA 3ARTA 2M1IA 1XRVA 1F8AB 2KR7A 3IKGA 4ML4A 4W9OA 3UI5A 1GPFA 1NWRA 4IQ2A 1FKJA 4WKHA 3ARSA 3JYMA 4GIVA 1FFRA 4J4OA 4U85A 1E15A 1TCOC 3KADA 3W4RA 2XP4A 2YBUA 4WIWA 1GOIA 3ODKA 1K9TA 4JYSA 4S3KA 3BXWA 2D9FA 4P8XA 4Q22A 3O5KA 4U84A 3UI4A 4IT6A 1W1TA 1E44A 4DRQA 1HKIA 3CHEA 1W26A 3AROA 2N87A 2ZR4A 4Z2GA 1J6YA 2DT1A 4DRKA 2ZR6A 2MLXA 4DWSD 3KAGA 5HWCA 4MNLA 1KFWA 5I98A 3CH9A 3WD3A 2Y78A 4DRJA 2M08A 1GRJA 4ODPA 1WAWA 5DIUA 2O92A 5HWBA 1E9LA 4TX0A 3RFWA 1NMVA 3O5FA 4W9QA 1IX5A 5HW6A 1QZ2A 5D75A 3UI6A 4DRNA 1JNEA 2WLZA 3WD1A 4MTVA 5GPGA 1FKLA 2FAPA 2MLYA 1NSGA 4LAYA 4MAVA 2RUDA 2KO7A 5DF0A 3PA7A
chains in the Genus database with same CATH topology
4Z2IA 1FD9A 4TNSA 2DG4A 4Z2HA 3WD0A 1CTNA 1BL4A 1D7JA 1EYMA 1W9UA 1J4RA 3FAPA 2M2AA 2ZQSA 2PV2A 4AY1A 1YATA 2XP3A 5GQBA 4MPKA 1U79A 2LJ4A 2KGJA 3OOBA 4QZVB 1ROTA 3ARVA 3JXVA 4BF8A 4JFJA 1X6NA 3WIJA 1W9PA 3O5QA 3RM4A 1P5QA 4ODMA 3KAFA 3TDBA 1F40A 1D2KA 4QT3A 3NRKA 1Q6UA 4ZPWR 2ZQUA 3TCZA 1X6LA 1JNSA 4ZPTR 3CGNA 1HKJA 4DZ3A 2AOSA 4WKFA 4DRMA 3KCEA 2DSZA 2XP5A 4QT2A 1W9VA 4JFMA 1HKKA 2G8ZA 3PRBA 1HJVA 1JNDA 1OGBA 2XP9A 4DRIA 1NWTA 4N19A 4DWSA 1L1PA 1QPFA 2MNTA 1Q6HA 1E6ZA 2WLYA 4DT4A 1JNTA 3EY6A 3B9AA 3WD2A 3B9EA 2DPEA 1NWUA 2MPHA 3B7XA 4LAWA 3IKDA 3WH0A 5HT1A 3ARXA 4ODLA 5HUAA 1NMWA 2OLHA 5HBFA 3O5MA 1VF8A 2WM0A 5DITA 4IQCA 2IUZA 2ZQTA 3UQAA 1JVWA 5HTGA 2DSWA 3G6LA 4Q7NA 2JZVA 4NSBA 2A3CA 1ZBWA 1NWSA 1YW5A 3ARRA 4WKAA 1PINA 4WJXA 2L2SA 2RQSA 4HBEA 4TW7A 1FKKA 2LPVA 1TFVA 1ZB5A 3IHZA 4L3NA 4DH0A 4JFLA 1OGGA 2DT2A 4HBOA 1A7XA 1ZK6A 3KAHA 4DROA 3MDYB 2RSEA 4P8WA 1EHNA 2FKEA 3ALGA 3WQVA 3WQWA 4DRHA 2A3AA 3H9RB 3PR9A 3RM9A 4DWSB 1D7IA 3FY1A 1HJXA 4URIA 5DO2A 4Z2JA 4ODNA 5B8IC 5HW7A 4QIBA 2PV1A 2XPBA 5HW8A 1FKHA 4L72B 4Z2LA 1J4IA 4ODRA 4TW6A 2F21A 4LGXA 2RUQA 4MNKA 1FKRA 3CZ8A 4ODKA 4LAVA 4MNMA 1ITXA 4XAKA 4S3JA 1FKDA 3G6MA 4IT4A 3O5OA 1HKMA 4JFIA 1EQ3A 1PBKA 3CHFA 3ARQA 3ARPA 4JFKA 4MNJA 4MGVA 3AS0A 3AS3A 2QF8A 4ODQA 2PV3A 4R0XA 2PPPA 1N1AA 4NZCA 5DIVA 1D6OA 3NI6A 1C9HA 1LL7A 1FKBA 3GPKA 3ALFA 1ROUA 2PPOA 4IPXA 3WL1A 1ZCNA 2MF9A 2MLZA 1WNOA 1WB0A 2XP6A 2DT3A 2ITKA 3O5GA 3VAWA 1FKFA 1ZL1A 3KACA 4LAXA 1E6PA 3O5JA 3B8SA 4WK9A 2KI3A 1FKGA 3AQUA 5GPRA 1FKTA 2Q5AA 1E6RA 2XP8A 2PPNA 4KQZA 1RD6A 3KZ7A 4HARA 1W1PA 1H0GA 1UR8A 2A3BA 1ZU8A 1FAPA 3UF8A 2DG9A 2DSUA 3O5LA 3TC5A 3LUOA 3ARZA 1XHGA 4G50A 2OFNA 4ITZA 1B6CA 3O5PA 4ODOA 3IK8A 1BKFA 1KT1A 1FJDA 1QPLA 2VN1A 1FKSA 1D7HA 1W1YA 1ZBKA 5J6EA 4ZS6A 2RURA 4DZ2A 1HXVA 3RMEA 1Y0OA 1OWQA 2F2DA 3ARWA 3UQIA 2ZR5A 3I6CA 4G2PA 3RM8A 4J4NA 2O9OA 2DSVA 1T11A 4DWSC 1M5YA 2IF4A 4W5UA 1KT0A 4R5EA 4Z2KA 4FAPA 2RUCA 5HKGA 2DT0A 1W1VA 3O5EA 3PRAA 3NTPA 4TYOA 1LQ0A 3WD4A 2VCDA 3B9DA 3FXYA 1LG2A 4DRPA 3WKZA 3AS1A 3UQBA 1NH6A 5BXJA 3CGMA 2WK2A 3AS2A 1LG1A 1H0IA 2B31A 2XPAA 2ZQVA 1Q1CA 2LKNA 1ZBCA 3PRDA 1FFQA 1FKIA 4DIPA 3KAIA 4P8UA 3JYJA 1GUVA 2LGOA 4PTMA 2ESCA 2DG3A 3KABA 2A3EA 3QOKA 4ZPVR 2UZ5A 2KFWA 4O2TA 4W9PA 3OA5A 4KR0B 1O6IA 1R9HA 2PBCA 3O5DA 1Q6IA 1EDQA 2KE0A 4GGQA 1HJWA 4C02B 1LJYA 3ARUA 2PI6A 1SYTA 5DEZA 4P8VA 2YBTA 3WL0A 1J4HA 1ZBVA 5JH8A 1UR9A 2XP7A 1LL6A 2F4EA 3CHCA 3O5IA 1EIBA 3CHDA 4TW8A 3O5RA 2FDMA 2K8IA 2AWGA 1LL4A 4U86A 3RGCA 3ARYA 2G41A 4MSPA 4FN2A 1SR0A 4NNRA 1E6NA 3ARTA 2M1IA 1XRVA 1F8AB 2KR7A 3IKGA 4ML4A 4W9OA 3UI5A 1GPFA 1NWRA 4IQ2A 1FKJA 4WKHA 3ARSA 3JYMA 4GIVA 1FFRA 4J4OA 4U85A 1E15A 1TCOC 3KADA 3W4RA 2XP4A 2YBUA 4WIWA 1GOIA 3ODKA 1K9TA 4JYSA 4S3KA 3BXWA 2D9FA 4P8XA 4Q22A 3O5KA 4U84A 3UI4A 4IT6A 1W1TA 4DRQA 1HKIA 3CHEA 1W26A 3AROA 2N87A 2ZR4A 4Z2GA 1J6YA 2DT1A 4DRKA 2ZR6A 2MLXA 4DWSD 3KAGA 5HWCA 4MNLA 1KFWA 5I98A 3CH9A 3WD3A 2Y78A 4DRJA 2M08A 4ODPA 1WAWA 5DIUA 2O92A 5HWBA 1E9LA 4TX0A 3RFWA 1NMVA 3O5FA 4W9QA 1IX5A 5HW6A 1QZ2A 5D75A 3UI6A 4DRNA 1JNEA 2WLZA 3WD1A 4MTVA 5GPGA 1FKLA 2FAPA 2MLYA 1NSGA 4LAYA 4MAVA 2RUDA 2KO7A 5DF0A 3PA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L2S A;  2Q5A A;  2F4E A;  2XP8 A;  2RQS A;  1FD9 A;  4TNS A;  2DG4 A;  2PPN A;  4TW7 A;  1D7J A;  1BL4 A;  3O5I A;  1FKK A;  2LPV A;  1EYM A;  3KZ7 A;  1J4R A;  3FAP A;  2M2A A;  4TW8 A;  3O5R A;  3IHZ A;  2ZQS A;  2PV2 A;  2K8I A;  2AWG A;  4DH0 A;  1YAT A;  4JFL A;  2XP3 A;  4U86 A;  3RGC A;  1FAP A;  1U79 A;  3UF8 A;  2DG9 A;  1A7X A;  2LJ4 A;  2KGJ A;  3OOB A;  3O5L A;  4MSP A;  1ROT A;  4FN2 A;  1ZK6 A;  3JXV A;  3KAH A;  4NNR A;  3LUO A;  3MDY B;  4JFJ A;  3TC5 A;  2RSE A;  4BF8 A;  4DRO A;  2FKE A;  2M1I A;  4G50 A;  2OFN A;  4ITZ A;  1F8A B;  4DRH A;  2KR7 A;  1B6C A;  3O5P A;  3O5Q A;  4ODO A;  3H9R B;  3IKG A;  1P5Q A;  4ODM A;  3KAF A;  3IK8 A;  3TDB A;  4W9O A;  1F40 A;  1D7I A;  4QT3 A;  3UI5 A;  3NRK A;  4IQ2 A;  1BKF A;  1KT1 A;  1FKJ A;  1Q6U A;  2ZQU A;  1QPL A;  3TCZ A;  2VN1 A;  1FJD A;  1L1P A;  3JYM A;  4GIV A;  1JNS A;  4J4O A;  1FKS A;  3CGN A;  4ODN A;  4U85 A;  1D7H A;  5B8I C;  5J6E A;  4DZ3 A;  2RUR A;  1TCO C;  5HW7 A;  4DRM A;  4QIB A;  2PV1 A;  2XPB A;  3KAD A;  3KCE A;  4DZ2 A;  1HXV A;  2XP5 A;  2XP4 A;  4QT2 A;  1Y0O A;  5HW8 A;  2F2D A;  1FKH A;  4JFM A;  3UQI A;  2ZR5 A;  3I6C A;  3ODK A;  3PRB A;  4G2P A;  1J4I A;  4ODR A;  4TW6 A;  2F21 A;  4J4N A;  2XP9 A;  4DRI A;  4JYS A;  2RUQ A;  2D9F A;  4N19 A;  1T11 A;  1FKR A;  1M5Y A;  2IF4 A;  4FAP A;  1KT0 A;  1QPF A;  3O5K A;  4U84 A;  2MNT A;  3UI4 A;  4ODK A;  4LAV A;  1Q6H A;  2RUC A;  4DRQ A;  5HKG A;  3O5E A;  1W26 A;  4DT4 A;  3NTP A;  4TYO A;  1JNT A;  2N87 A;  2ZR4 A;  1FKD A;  3EY6 A;  3O5O A;  2VCD A;  4JFI A;  1EQ3 A;  4DRP A;  1J6Y A;  1PBK A;  4DRK A;  2ZR6 A;  3UQB A;  2MLX A;  5HWC A;  3KAG A;  5BXJ A;  5I98 A;  3CGM A;  4JFK A;  4MGV A;  2Y78 A;  4DRJ A;  2MPH A;  3B7X A;  4LAW A;  2XPA A;  3IKD A;  2ZQV A;  4ODQ A;  2PV3 A;  4R0X A;  5HT1 A;  2M08 A;  4ODL A;  3WH0 A;  1Q1C A;  2LKN A;  3PRD A;  4DIP A;  5HUA A;  1FKI A;  2PPP A;  1N1A A;  1NMW A;  3KAI A;  4ODP A;  5DIV A;  3JYJ A;  5DIU A;  5HWB A;  1D6O A;  3NI6 A;  1C9H A;  4TX0 A;  2LGO A;  1FKB A;  3GPK A;  2DG3 A;  3KAB A;  3RFW A;  1NMV A;  3O5M A;  1ROU A;  3O5F A;  2UZ5 A;  2KFW A;  2PPO A;  4IPX A;  4O2T A;  4W9Q A;  4W9P A;  1ZCN A;  2MF9 A;  2MLZ A;  5HW6 A;  1R9H A;  1QZ2 A;  5DIT A;  5D75 A;  2PBC A;  4IQC A;  3O5D A;  3UI6 A;  4DRN A;  1Q6I A;  2ZQT A;  2XP6 A;  3UQA A;  2ITK A;  2KE0 A;  3O5G A;  1FKF A;  1JVW A;  3VAW A;  5HTG A;  3KAC A;  4GGQ A;  3O5J A;  4LAX A;  2JZV A;  4C02 B;  5GPG A;  2KI3 A;  1FKL A;  1YW5 A;  1FKG A;  2FAP A;  2MLY A;  1NSG A;  4LAY A;  2RUD A;  2KO7 A;  1PIN A;  1J4H A;  3PA7 A;  2XP7 A;  1FKT A; 
#chains in the Genus database with same CATH topology
 4Z2I A;  1FD9 A;  4TNS A;  2DG4 A;  4Z2H A;  3WD0 A;  1CTN A;  1BL4 A;  1D7J A;  1EYM A;  1W9U A;  1J4R A;  3FAP A;  2M2A A;  2ZQS A;  2PV2 A;  4AY1 A;  1YAT A;  2XP3 A;  5GQB A;  4MPK A;  1U79 A;  2LJ4 A;  2KGJ A;  3OOB A;  4QZV B;  1ROT A;  3ARV A;  3JXV A;  4BF8 A;  4JFJ A;  1X6N A;  3WIJ A;  1W9P A;  3O5Q A;  3RM4 A;  1P5Q A;  2F23 A;  3KAF A;  4ODM A;  3TDB A;  1D2K A;  1F40 A;  4QT3 A;  3NRK A;  1Q6U A;  4ZPW R;  2ZQU A;  3TCZ A;  1X6L A;  1JNS A;  4ZPT R;  3CGN A;  1HKJ A;  4DZ3 A;  2AOS A;  4WKF A;  4DRM A;  3KCE A;  2DSZ A;  2XP5 A;  4QT2 A;  1W9V A;  4JFM A;  1HKK A;  2G8Z A;  3PRB A;  1HJV A;  1JND A;  1OGB A;  2XP9 A;  4DRI A;  1NWT A;  4N19 A;  4DWS A;  1L1P A;  1QPF A;  2MNT A;  1Q6H A;  1E6Z A;  2WLY A;  4DT4 A;  1JNT A;  3EY6 A;  3B9A A;  3WD2 A;  3B9E A;  2DPE A;  1NWU A;  2MPH A;  3B7X A;  4LAW A;  3EIP A;  3IKD A;  3WH0 A;  5HT1 A;  3ARX A;  4ODL A;  5HUA A;  1NMW A;  2OLH A;  5HBF A;  3GU0 A;  3O5M A;  1VF8 A;  2WM0 A;  5DIT A;  4IQC A;  2IUZ A;  2ZQT A;  3UQA A;  1JVW A;  5HTG A;  2DSW A;  3G6L A;  4Q7N A;  2JZV A;  4NSB A;  2A3C A;  1ZBW A;  1NWS A;  1YW5 A;  3ARR A;  4WKA A;  1PIN A;  4WJX A;  2L2S A;  2RQS A;  4HBE A;  4TW7 A;  1FKK A;  2LPV A;  1TFV A;  1ZB5 A;  3IHZ A;  4L3N A;  4DH0 A;  4JFL A;  1OGG A;  2DT2 A;  4HBO A;  1A7X A;  1ZK6 A;  3KAH A;  4DRO A;  3MDY B;  2RSE A;  4P8W A;  1EHN A;  2FKE A;  3ALG A;  3WQV A;  3WQW A;  4DRH A;  2A3A A;  3H9R B;  3PR9 A;  3RM9 A;  4DWS B;  1D7I A;  3FY1 A;  1HJX A;  4URI A;  5DO2 A;  4Z2J A;  4ODN A;  5B8I C;  5HW7 A;  4QIB A;  2PV1 A;  2XPB A;  5HW8 A;  1FKH A;  4L72 B;  4Z2L A;  1J4I A;  4ODR A;  4TW6 A;  2F21 A;  4LGX A;  2RUQ A;  4MNK A;  1FKR A;  3CZ8 A;  4ODK A;  4LAV A;  4MNM A;  1ITX A;  4XAK A;  4S3J A;  1FKD A;  3G6M A;  4IT4 A;  3O5O A;  1HKM A;  4JFI A;  1EQ3 A;  1PBK A;  3CHF A;  3ARQ A;  3ARP A;  4JFK A;  4MNJ A;  2EUL A;  4MGV A;  3AS0 A;  3AS3 A;  2QF8 A;  4ODQ A;  2PV3 A;  4R0X A;  2PPP A;  1N1A A;  4NZC A;  5DIV A;  1D6O A;  3NI6 A;  1C9H A;  1LL7 A;  1FKB A;  3GPK A;  3ALF A;  1ROU A;  2PPO A;  4IPX A;  3WL1 A;  1ZCN A;  2MF9 A;  2MLZ A;  1WNO A;  1WB0 A;  2XP6 A;  2DT3 A;  2ITK A;  3O5G A;  3VAW A;  1FKF A;  1ZL1 A;  3KAC A;  4LAX A;  1E6P A;  3O5J A;  3B8S A;  3GTY X;  4WK9 A;  2KI3 A;  1FKG A;  3AQU A;  5GPR A;  1FKT A;  2Q5A A;  1E6R A;  2XP8 A;  2PPN A;  4KQZ A;  1RD6 A;  3KZ7 A;  4HAR A;  4UDM A;  1W1P A;  1H0G A;  3BMB A;  1UR8 A;  2A3B A;  1ZU8 A;  1FAP A;  3UF8 A;  2DG9 A;  2DSU A;  3O5L A;  3TC5 A;  3LUO A;  3ARZ A;  1XHG A;  4G50 A;  2OFN A;  4ITZ A;  1B6C A;  3O5P A;  4ODO A;  2P4V A;  3IK8 A;  1BKF A;  1KT1 A;  1FJD A;  1QPL A;  2VN1 A;  1JCH B;  1FKS A;  1D7H A;  1W1Y A;  1ZBK A;  5J6E A;  4ZS6 A;  2RUR A;  4DZ2 A;  1HXV A;  3RME A;  1Y0O A;  1OWQ A;  2F2D A;  3ARW A;  3UQI A;  2ZR5 A;  3I6C A;  4G2P A;  3RM8 A;  4J4N A;  2O9O A;  2DSV A;  1T11 A;  4DWS C;  1M5Y A;  2IF4 A;  4W5U A;  1KT0 A;  4R5E A;  4Z2K A;  4FAP A;  2RUC A;  5HKG A;  2DT0 A;  1W1V A;  3O5E A;  3PRA A;  3NTP A;  4TYO A;  1LQ0 A;  3WD4 A;  2VCD A;  3B9D A;  3FXY A;  1LG2 A;  4DRP A;  3WKZ A;  3AS1 A;  3UQB A;  1NH6 A;  5BXJ A;  3CGM A;  2WK2 A;  3AS2 A;  2PN0 A;  1LG1 A;  1H0I A;  2ETN A;  2B31 A;  2XPA A;  2ZQV A;  1Q1C A;  2LKN A;  1ZBC A;  2B5U B;  1FFQ A;  1FKI A;  3PRD A;  4DIP A;  3KAI A;  4P8U A;  3JYJ A;  1GUV A;  2LGO A;  4PTM A;  2ESC A;  2DG3 A;  3KAB A;  2A3E A;  3QOK A;  4ZPV R;  2UZ5 A;  2KFW A;  4O2T A;  4W9P A;  3OA5 A;  4KR0 B;  1O6I A;  1R9H A;  2PBC A;  3O5D A;  1Q6I A;  1EDQ A;  2KE0 A;  4GGQ A;  1HJW A;  4C02 B;  1LJY A;  3ARU A;  2PI6 A;  1SYT A;  5DEZ A;  4P8V A;  2YBT A;  3WL0 A;  1J4H A;  1ZBV A;  5JH8 A;  1UR9 A;  2XP7 A;  1LL6 A;  2F4E A;  3CHC A;  3O5I A;  1EIB A;  3CHD A;  4TW8 A;  3O5R A;  2FDM A;  2K8I A;  2AWG A;  1LL4 A;  4U86 A;  3RGC A;  3ARY A;  2G41 A;  4MSP A;  4FN2 A;  1SR0 A;  4NNR A;  1E6N A;  3ART A;  2M1I A;  1XRV A;  1F8A B;  2KR7 A;  3IKG A;  4ML4 A;  4W9O A;  3UI5 A;  1GPF A;  1NWR A;  4IQ2 A;  1FKJ A;  4WKH A;  3ARS A;  3JYM A;  4GIV A;  1FFR A;  4J4O A;  4U85 A;  1E15 A;  1TCO C;  3KAD A;  3W4R A;  2XP4 A;  2YBU A;  4WIW A;  1GOI A;  3ODK A;  1K9T A;  4JYS A;  4S3K A;  3BXW A;  2D9F A;  4P8X A;  4Q22 A;  3O5K A;  4U84 A;  3UI4 A;  4IT6 A;  1W1T A;  1E44 A;  4DRQ A;  1HKI A;  3CHE A;  1W26 A;  3ARO A;  2N87 A;  2ZR4 A;  4Z2G A;  1J6Y A;  2DT1 A;  4DRK A;  2ZR6 A;  2MLX A;  4DWS D;  3KAG A;  5HWC A;  4MNL A;  1KFW A;  5I98 A;  3CH9 A;  3WD3 A;  2Y78 A;  4DRJ A;  2M08 A;  1GRJ A;  4ODP A;  1WAW A;  5DIU A;  2O92 A;  5HWB A;  1E9L A;  4TX0 A;  3RFW A;  1NMV A;  3O5F A;  4W9Q A;  1IX5 A;  5HW6 A;  1QZ2 A;  5D75 A;  3UI6 A;  4DRN A;  1JNE A;  2WLZ A;  3WD1 A;  4MTV A;  5GPG A;  1FKL A;  2FAP A;  2MLY A;  1NSG A;  4LAY A;  4MAV A;  2RUD A;  2KO7 A;  5DF0 A;  3PA7 A; 
#chains in the Genus database with same CATH homology
 4Z2I A;  1FD9 A;  4TNS A;  2DG4 A;  4Z2H A;  3WD0 A;  1CTN A;  1BL4 A;  1D7J A;  1EYM A;  1W9U A;  1J4R A;  3FAP A;  2M2A A;  2ZQS A;  2PV2 A;  4AY1 A;  1YAT A;  2XP3 A;  5GQB A;  4MPK A;  1U79 A;  2LJ4 A;  2KGJ A;  3OOB A;  4QZV B;  1ROT A;  3ARV A;  3JXV A;  4BF8 A;  4JFJ A;  1X6N A;  3WIJ A;  1W9P A;  3O5Q A;  3RM4 A;  1P5Q A;  4ODM A;  3KAF A;  3TDB A;  1F40 A;  1D2K A;  4QT3 A;  3NRK A;  1Q6U A;  4ZPW R;  2ZQU A;  3TCZ A;  1X6L A;  1JNS A;  4ZPT R;  3CGN A;  1HKJ A;  4DZ3 A;  2AOS A;  4WKF A;  4DRM A;  3KCE A;  2DSZ A;  2XP5 A;  4QT2 A;  1W9V A;  4JFM A;  1HKK A;  2G8Z A;  3PRB A;  1HJV A;  1JND A;  1OGB A;  2XP9 A;  4DRI A;  1NWT A;  4N19 A;  4DWS A;  1L1P A;  1QPF A;  2MNT A;  1Q6H A;  1E6Z A;  2WLY A;  4DT4 A;  1JNT A;  3EY6 A;  3B9A A;  3WD2 A;  3B9E A;  2DPE A;  1NWU A;  2MPH A;  3B7X A;  4LAW A;  3IKD A;  3WH0 A;  5HT1 A;  3ARX A;  4ODL A;  5HUA A;  1NMW A;  2OLH A;  5HBF A;  3O5M A;  1VF8 A;  2WM0 A;  5DIT A;  4IQC A;  2IUZ A;  2ZQT A;  3UQA A;  1JVW A;  5HTG A;  2DSW A;  3G6L A;  4Q7N A;  2JZV A;  4NSB A;  2A3C A;  1ZBW A;  1NWS A;  1YW5 A;  3ARR A;  4WKA A;  1PIN A;  4WJX A;  2L2S A;  2RQS A;  4HBE A;  4TW7 A;  1FKK A;  2LPV A;  1TFV A;  1ZB5 A;  3IHZ A;  4L3N A;  4DH0 A;  4JFL A;  1OGG A;  2DT2 A;  4HBO A;  1A7X A;  1ZK6 A;  3KAH A;  4DRO A;  3MDY B;  2RSE A;  4P8W A;  1EHN A;  2FKE A;  3ALG A;  3WQV A;  3WQW A;  4DRH A;  2A3A A;  3H9R B;  3PR9 A;  3RM9 A;  4DWS B;  1D7I A;  3FY1 A;  1HJX A;  4URI A;  5DO2 A;  4Z2J A;  4ODN A;  5B8I C;  5HW7 A;  4QIB A;  2PV1 A;  2XPB A;  5HW8 A;  1FKH A;  4L72 B;  4Z2L A;  1J4I A;  4ODR A;  4TW6 A;  2F21 A;  4LGX A;  2RUQ A;  4MNK A;  1FKR A;  3CZ8 A;  4ODK A;  4LAV A;  4MNM A;  1ITX A;  4XAK A;  4S3J A;  1FKD A;  3G6M A;  4IT4 A;  3O5O A;  1HKM A;  4JFI A;  1EQ3 A;  1PBK A;  3CHF A;  3ARQ A;  3ARP A;  4JFK A;  4MNJ A;  4MGV A;  3AS0 A;  3AS3 A;  2QF8 A;  4ODQ A;  2PV3 A;  4R0X A;  2PPP A;  1N1A A;  4NZC A;  5DIV A;  1D6O A;  3NI6 A;  1C9H A;  1LL7 A;  1FKB A;  3GPK A;  3ALF A;  1ROU A;  2PPO A;  4IPX A;  3WL1 A;  1ZCN A;  2MF9 A;  2MLZ A;  1WNO A;  1WB0 A;  2XP6 A;  2DT3 A;  2ITK A;  3O5G A;  3VAW A;  1FKF A;  1ZL1 A;  3KAC A;  4LAX A;  1E6P A;  3O5J A;  3B8S A;  4WK9 A;  2KI3 A;  1FKG A;  3AQU A;  5GPR A;  1FKT A;  2Q5A A;  1E6R A;  2XP8 A;  2PPN A;  4KQZ A;  1RD6 A;  3KZ7 A;  4HAR A;  1W1P A;  1H0G A;  1UR8 A;  2A3B A;  1ZU8 A;  1FAP A;  3UF8 A;  2DG9 A;  2DSU A;  3O5L A;  3TC5 A;  3LUO A;  3ARZ A;  1XHG A;  4G50 A;  2OFN A;  4ITZ A;  1B6C A;  3O5P A;  4ODO A;  3IK8 A;  1BKF A;  1KT1 A;  1FJD A;  1QPL A;  2VN1 A;  1FKS A;  1D7H A;  1W1Y A;  1ZBK A;  5J6E A;  4ZS6 A;  2RUR A;  4DZ2 A;  1HXV A;  3RME A;  1Y0O A;  1OWQ A;  2F2D A;  3ARW A;  3UQI A;  2ZR5 A;  3I6C A;  4G2P A;  3RM8 A;  4J4N A;  2O9O A;  2DSV A;  1T11 A;  4DWS C;  1M5Y A;  2IF4 A;  4W5U A;  1KT0 A;  4R5E A;  4Z2K A;  4FAP A;  2RUC A;  5HKG A;  2DT0 A;  1W1V A;  3O5E A;  3PRA A;  3NTP A;  4TYO A;  1LQ0 A;  3WD4 A;  2VCD A;  3B9D A;  3FXY A;  1LG2 A;  4DRP A;  3WKZ A;  3AS1 A;  3UQB A;  1NH6 A;  5BXJ A;  3CGM A;  2WK2 A;  3AS2 A;  1LG1 A;  1H0I A;  2B31 A;  2XPA A;  2ZQV A;  1Q1C A;  2LKN A;  1ZBC A;  3PRD A;  1FFQ A;  1FKI A;  4DIP A;  3KAI A;  4P8U A;  3JYJ A;  1GUV A;  2LGO A;  4PTM A;  2ESC A;  2DG3 A;  3KAB A;  2A3E A;  3QOK A;  4ZPV R;  2UZ5 A;  2KFW A;  4O2T A;  4W9P A;  3OA5 A;  4KR0 B;  1O6I A;  1R9H A;  2PBC A;  3O5D A;  1Q6I A;  1EDQ A;  2KE0 A;  4GGQ A;  1HJW A;  4C02 B;  1LJY A;  3ARU A;  2PI6 A;  1SYT A;  5DEZ A;  4P8V A;  2YBT A;  3WL0 A;  1J4H A;  1ZBV A;  5JH8 A;  1UR9 A;  2XP7 A;  1LL6 A;  2F4E A;  3CHC A;  3O5I A;  1EIB A;  3CHD A;  4TW8 A;  3O5R A;  2FDM A;  2K8I A;  2AWG A;  1LL4 A;  4U86 A;  3RGC A;  3ARY A;  2G41 A;  4MSP A;  4FN2 A;  1SR0 A;  4NNR A;  1E6N A;  3ART A;  2M1I A;  1XRV A;  1F8A B;  2KR7 A;  3IKG A;  4ML4 A;  4W9O A;  3UI5 A;  1GPF A;  1NWR A;  4IQ2 A;  1FKJ A;  4WKH A;  3ARS A;  3JYM A;  4GIV A;  1FFR A;  4J4O A;  4U85 A;  1E15 A;  1TCO C;  3KAD A;  3W4R A;  2XP4 A;  2YBU A;  4WIW A;  1GOI A;  3ODK A;  1K9T A;  4JYS A;  4S3K A;  3BXW A;  2D9F A;  4P8X A;  4Q22 A;  3O5K A;  4U84 A;  3UI4 A;  4IT6 A;  1W1T A;  4DRQ A;  1HKI A;  3CHE A;  1W26 A;  3ARO A;  2N87 A;  2ZR4 A;  4Z2G A;  1J6Y A;  2DT1 A;  4DRK A;  2ZR6 A;  2MLX A;  4DWS D;  3KAG A;  5HWC A;  4MNL A;  1KFW A;  5I98 A;  3CH9 A;  3WD3 A;  2Y78 A;  4DRJ A;  2M08 A;  4ODP A;  1WAW A;  5DIU A;  2O92 A;  5HWB A;  1E9L A;  4TX0 A;  3RFW A;  1NMV A;  3O5F A;  4W9Q A;  1IX5 A;  5HW6 A;  1QZ2 A;  5D75 A;  3UI6 A;  4DRN A;  1JNE A;  2WLZ A;  3WD1 A;  4MTV A;  5GPG A;  1FKL A;  2FAP A;  2MLY A;  1NSG A;  4LAY A;  4MAV A;  2RUD A;  2KO7 A;  5DF0 A;  3PA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...