4FAPA

Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4fapA00
2XP5A 2XP7A 5J6EA 2ZQUA 3JYMA 1FKKA 3O5QA 1JVWA 2LGOA 1ZK6A 3IK8A 4MGVA 4GGQA 4U84A 3KZ7A 1FJDA 2AWGA 2UZ5A 1D7JA 4R0XA 2DG4A 4DROA 1C9HA 5HWBA 5B8IC 4QIBA 1B6CA 3CGMA 3PRBA 1F8AB 2XPAA 3TDBA 2XPBA 4DRIA 1BKFA 5I98A 1FAPA 2PV2A 1FKFA 2ZR4A 3UI4A 2VN1A 3OOBA 1F40A 1U79A 5HWCA 4IPXA 3RFWA 2MF9A 2DG3A 2MNTA 2PPPA 2RSEA 5HT1A 1KT1A 2LKNA 1JNSA 1FKGA 2XP9A 4TNSA 4MSPA 4W9OA 1FKRA 1NMVA 1NSGA 1P5QA 2MLZA 4NNRA 3O5DA 4DRJA 2DG9A 4DZ2A 3JYJA 1T11A 5HTGA 1QPFA 4TW6A 4QT3A 1L1PA 4J4OA 4DRMA 4ODLA 1FKHA 2ZQTA 3PRDA 4ODRA 3MDYB 3UI6A 5HW8A 1A7XA 5HW7A 5BXJA 2PV1A 1NMWA 3WH0A 4LAWA 3UF8A 2ZR6A 3KAFA 3TC5A 2KO7A 4JFJA 1BL4A 2PBCA 2RQSA 4DIPA 3KCEA 4TW8A 2XP3A 2LJ4A 1EYMA 2M08A 5HUAA 4O2TA 2XP8A 3H9RB 3KAIA 3LUOA 3O5IA 4JFLA 5HKGA 1JNTA 3UQAA 1FKIA 3KABA 1YW5A 3O5RA 1J6YA 3KAHA 2Q5AA 1Q6UA 4W9QA 4ITZA 1HXVA 2MLXA 2PPOA 2ITKA 2OFNA 4LAXA 1D6OA 4ODMA 1ROUA 2F4EA 5DIUA 4FN2A 4QT2A 5DITA 4DH0A 5HW6A 1N1AA 1QPLA 2KGJA 2MPHA 3EY6A 1TCOC 3O5JA 4ODNA 4DRQA 3TCZA 1FKBA 5DIVA 4DRKA 2ZQVA 1FKLA 3KADA 2KFWA 4U86A 2IF4A 3UQIA 3IKGA 1FD9A 3O5EA 1FKDA 1Y0OA 2VCDA 2KR7A 1EQ3A 3GPKA 3RGCA 1J4IA 2F2DA 3CGNA 3ODKA 3PA7A 4J4NA 2FKEA 4JFIA 4ODPA 4TW7A 4ODOA 3KAGA 2PPNA 1FKJA 1ROTA 1Q1CA 1YATA 1J4HA 2RUCA 3O5PA 4U85A 3O5LA 2FAPA 2M2AA 3UQBA 2L2SA 4DT4A 4G50A 1M5YA 3O5FA 4LAYA 4TX0A 1QZ2A 3O5MA 4LAVA 3B7XA 4DRPA 2ZQSA 1PBKA 2LPVA 4GIVA 1D7IA 3FAPA 3O5KA 4N19A 3IHZA 2JZVA 4C02B 1FKTA 4IQCA 3NRKA 1R9HA 3KACA 4JFKA 5GPGA 4FAPA 3UI5A 1D7HA 1FKSA 1Q6IA 3I6CA 2MLYA 4ODKA 2XP4A 2RUDA 1W26A 4JYSA 4DRHA 2KI3A 4DRNA 2RUQA 1PINA 2K8IA 2KE0A 1KT0A 2PV3A 2N87A 3IKDA 1ZCNA 2XP6A 3JXVA 3O5GA 4BF8A 4DZ3A 4G2PA 5D75A 2D9FA 4IQ2A 3NI6A 2F21A 2Y78A 2ZR5A 3NTPA 4TYOA 4W9PA 1J4RA 4JFMA 3VAWA 4ODQA 1Q6HA 2RURA 3O5OA 2M1IA
chains in the Genus database with same CATH superfamily
5J6EA 1ZK6A 4U84A 1LL6A 2WM0A 2UZ5A 1D7JA 2P4VA 5B8IC 2G41A 2A3AA 3PRBA 2XPBA 4DRIA 4Z2GA 2ZR4A 1JNEA 3ARVA 2OLHA 5HWCA 1VF8A 4IPXA 2MNTA 1KT1A 1ZB5A 2LKNA 4W9OA 1GPFA 4NNRA 2AOSA 3AROA 3ARWA 1T11A 1QPFA 4QT3A 1L1PA 3EIPA 3WQVA 1A7XA 1SYTA 4URIA 2ZR6A 2DT3A 3KAFA 2KO7A 3TC5A 5DF0A 4DIPA 3KCEA 2LJ4A 1EYMA 4ZPVR 3H9RB 2DSVA 5HKGA 1FKIA 3KABA 1W1PA 1YW5A 3O5RA 4W9QA 4Q22A 1TFVA 3ARZA 1OGGA 3BXWA 1RD6A 4W5UA 1ROUA 3PR9A 2F4EA 5HW6A 1N1AA 4NSBA 4DWSA 2KGJA 2MPHA 3EY6A 3O5JA 4DRQA 3TCZA 5DIVA 1HKKA 4DRKA 3WKZA 3ARRA 2IF4A 1FD9A 2VCDA 3RGCA 1J4IA 2F2DA 3CGNA 3PA7A 3B9AA 3WL0A 1Q1CA 4U85A 1YATA 3RM8A 3O5PA 3ARSA 2M2AA 4DT4A 4G50A 4LAVA 2DT0A 1D7IA 3WD1A 5GQBA 4C02B 1SR0A 4Q7NA 1HJVA 1JNDA 1Q6IA 3AS0A 1NWSA 4IT4A 1E6NA 1X6NA 4DRHA 4DRNA 1PINA 3JXVA 2K8IA 3O5GA 4BF8A 4G2PA 4DWSD 4TYOA 3VAWA 1LL7A 4JFMA 3O5OA 2XP5A 2XP7A 1LL4A 3JYMA 3O5QA 1ZBWA 1EDQA 2LGOA 4WKFA 4P8WA 4GGQA 4DROA 2DG4A 1C9HA 5HWBA 3WD4A 1B6CA 4DWSB 1H0IA 1F8AB 1FAPA 3UI4A 3RFWA 2DSUA 2F23A 4MSPA 2WLZA 1NMVA 2MLZA 1WNOA 1E6RA 1K9TA 1LG1A 3RMEA 4TW6A 3WIJA 5JH8A 4J4OA 4DRMA 2ZQTA 3PRDA 1E15A 3MDYB 1XRVA 5HW8A 1KFWA 4AY1A 4ML4A 1NWTA 3UF8A 2ESCA 2RQSA 2XP8A 4NZCA 4MTVA 3LUOA 3O5IA 2B31A 3KAHA 4IT6A 2Q5AA 1LG2A 1ZBKA 2ITKA 1W9PA 2OFNA 1GRJA 5DIUA 1XHGA 4QT2A 4ODNA 3KADA 4R5EA 1FKDA 4DWSC 2WLYA 1LJYA 3ARQA 1NH6A 3ODKA 4J4NA 4ODPA 2FKEA 3WL1A 1OGBA 3UQBA 4Z2IA 1M5YA 4LAYA 4TX0A 4HBOA 1PBKA 2LPVA 3FAPA 1E9LA 4N19A 2JZVA 4IQCA 2A3EA 3KACA 5GPGA 3UI5A 1D7HA 1FKSA 2MLYA 3AS1A 1O6IA 1W26A 4JYSA 2G8ZA 2KE0A 4P8XA 1ZCNA 2XP6A 4IQ2A 2F21A 2Y78A 2ZR5A 4W9PA 2A3CA 3G6LA 1BKFA 2RURA 3BMBA 1JVWA 3IK8A 4UDMA 1HJXA 1FJDA 4WKAA 2AWGA 2DSWA 3ARTA 3QOKA 1ZBCA 2DSZA 3TDBA 3CH9A 4WK9A 4L3NA 2QF8A 1FKFA 1LQ0A 2VN1A 1F40A 4Z2LA 4QZVB 2DG3A 2RSEA 4Z2JA 4KR0B 1JNSA 1W9VA 1P5QA 1EIBA 4DRJA 3O5DA 4ODLA 4ODRA 1W9UA 1UR8A 5BXJA 2PV1A 4LAWA 3ARPA 1BL4A 4TW8A 2DT1A 3CHFA 3ARYA 4O2TA 3PRAA 1GUVA 4JFLA 1JNTA 4Z2KA 4MNLA 1OWQA 4LAXA 1D6OA 2B5UB 4DH0A 1HKIA 2YBTA 3AQUA 1QPLA 3CZ8A 3AS3A 1FKBA 1ZL1A 3CHCA 1FKLA 4U86A 3IKGA 4ZPWR 1EQ3A 3GPKA 4TW7A 4JFIA 3OA5A 3WD2A 1X6LA 1NWRA 1W1VA 2RUCA 1ZU8A 2PN0A 3B7XA 2FDMA 4PTMA 3O5KA 1FFRA 1FKTA 4S3KA 4JFKA 1R9HA 3W4RA 3I6CA 4LGXA 2KI3A 4MNJA 4XAKA 5D75A 4MAVA 5HBFA 3NI6A 2YBUA 3WQWA 4S3JA 2ZQUA 1GOIA 1FKKA 4MGVA 4ZPTR 4Z2HA 3KZ7A 4R0XA 4P8VA 4QIBA 3RM4A 4HBEA 3CGMA 2XPAA 4MNKA 5DO2A 4KQZA 5I98A 2PV2A 2PI6A 3ARUA 3ALFA 3OOBA 1U79A 3G6MA 1IX5A 2IUZA 2MF9A 2PPPA 4ZS6A 5HT1A 4L72B 4WIWA 1FKGA 2XP9A 4TNSA 1FKRA 1NSGA 5DEZA 2DG9A 4DZ2A 3JYJA 5HTGA 4MPKA 1FKHA 3UI6A 5GPRA 5HW7A 1NMWA 3WH0A 1EHNA 1W1YA 3B8SA 4JFJA 2PBCA 2XP3A 2DPEA 2WK2A 5HUAA 2M08A 3KAIA 1JCHB 3UQAA 2O9OA 3CHEA 1J6YA 4P8UA 1HKJA 1Q6UA 4ITZA 1HXVA 2MLXA 2PPOA 4ODMA 1ITXA 3RM9A 1E6PA 1HKMA 4HARA 3FXYA 4FN2A 5DITA 3ALGA 1FFQA 1TCOC 2ZQVA 2KFWA 4WKHA 3UQIA 3O5EA 1H0GA 1Y0OA 2KR7A 2DT2A 3GU0A 1HJWA 1WAWA 3AS2A 2O92A 4ODOA 3KAGA 1D2KA 2PPNA 1FKJA 1ROTA 1WB0A 1J4HA 3CHDA 3WD3A 3O5LA 2FAPA 2EULA 4MNMA 4WJXA 1NWUA 1CTNA 2L2SA 1UR9A 3FY1A 3O5FA 3WD0A 4DRPA 1QZ2A 3O5MA 1E44A 2ZQSA 4GIVA 1E6ZA 1ZBVA 3IHZA 3NRKA 4FAPA 3B9DA 4ODKA 2XP4A 2RUDA 2RUQA 3GTYX 3ARXA 3IKDA 2PV3A 1KT0A 1W1TA 2N87A 2A3BA 4DZ3A 2ETNA 2D9FA 3NTPA 3B9EA 1J4RA 4ODQA 1Q6HA 2M1IA
chains in the Genus database with same CATH topology
5J6EA 1ZK6A 4U84A 1LL6A 2WM0A 2UZ5A 1D7JA 5B8IC 2G41A 2A3AA 3PRBA 2XPBA 4DRIA 4Z2GA 2ZR4A 1JNEA 3ARVA 2OLHA 5HWCA 1VF8A 4IPXA 2MNTA 1KT1A 1ZB5A 2LKNA 4W9OA 1GPFA 4NNRA 2AOSA 3AROA 3ARWA 1T11A 1QPFA 4QT3A 1L1PA 3WQVA 1A7XA 1SYTA 4URIA 2ZR6A 2DT3A 3KAFA 2KO7A 3TC5A 5DF0A 4DIPA 3KCEA 2LJ4A 1EYMA 4ZPVR 3H9RB 2DSVA 5HKGA 1FKIA 3KABA 1W1PA 1YW5A 3O5RA 4W9QA 4Q22A 1TFVA 3ARZA 1OGGA 3BXWA 1RD6A 4W5UA 1ROUA 3PR9A 2F4EA 5HW6A 1N1AA 4NSBA 4DWSA 2KGJA 2MPHA 3EY6A 3O5JA 4DRQA 3TCZA 5DIVA 1HKKA 4DRKA 3WKZA 3ARRA 2IF4A 1FD9A 2VCDA 3RGCA 1J4IA 2F2DA 3CGNA 3PA7A 3B9AA 3WL0A 1Q1CA 4U85A 1YATA 3RM8A 3O5PA 3ARSA 2M2AA 4DT4A 4G50A 4LAVA 2DT0A 1D7IA 3WD1A 5GQBA 4C02B 1SR0A 4Q7NA 1HJVA 1JNDA 1Q6IA 3AS0A 1NWSA 4IT4A 1E6NA 1X6NA 4DRHA 4DRNA 1PINA 3JXVA 2K8IA 3O5GA 4BF8A 4G2PA 4DWSD 4TYOA 3VAWA 1LL7A 4JFMA 3O5OA 2XP5A 2XP7A 1LL4A 3JYMA 3O5QA 1ZBWA 1EDQA 2LGOA 4WKFA 4P8WA 4GGQA 4DROA 2DG4A 1C9HA 5HWBA 3WD4A 1B6CA 4DWSB 1H0IA 1F8AB 1FAPA 3UI4A 3RFWA 2DSUA 4MSPA 2WLZA 1NMVA 2MLZA 1WNOA 1E6RA 1K9TA 1LG1A 3RMEA 4TW6A 3WIJA 5JH8A 4J4OA 4DRMA 2ZQTA 3PRDA 1E15A 3MDYB 1XRVA 5HW8A 1KFWA 4AY1A 4ML4A 1NWTA 3UF8A 2ESCA 2RQSA 2XP8A 4NZCA 4MTVA 3LUOA 3O5IA 2B31A 3KAHA 4IT6A 2Q5AA 1LG2A 1ZBKA 2ITKA 1W9PA 2OFNA 5DIUA 1XHGA 4QT2A 4ODNA 3KADA 4R5EA 1FKDA 4DWSC 2WLYA 1LJYA 3ARQA 1NH6A 3ODKA 4J4NA 4ODPA 2FKEA 3WL1A 1OGBA 3UQBA 4Z2IA 1M5YA 4LAYA 4TX0A 4HBOA 1PBKA 2LPVA 3FAPA 1E9LA 4N19A 2JZVA 4IQCA 2A3EA 3KACA 5GPGA 3UI5A 1D7HA 1FKSA 2MLYA 3AS1A 1O6IA 1W26A 4JYSA 2G8ZA 2KE0A 4P8XA 1ZCNA 2XP6A 4IQ2A 2F21A 2Y78A 2ZR5A 4W9PA 2A3CA 3G6LA 1BKFA 2RURA 1JVWA 3IK8A 1HJXA 1FJDA 4WKAA 2AWGA 2DSWA 3ARTA 3QOKA 1ZBCA 2DSZA 3TDBA 3CH9A 4WK9A 4L3NA 2QF8A 1FKFA 1LQ0A 2VN1A 1F40A 4Z2LA 4QZVB 2DG3A 2RSEA 4Z2JA 4KR0B 1JNSA 1W9VA 1P5QA 1EIBA 4DRJA 3O5DA 4ODLA 4ODRA 1W9UA 1UR8A 5BXJA 2PV1A 4LAWA 3ARPA 1BL4A 4TW8A 2DT1A 3CHFA 3ARYA 4O2TA 3PRAA 1GUVA 4JFLA 1JNTA 4Z2KA 4MNLA 1OWQA 4LAXA 1D6OA 4DH0A 1HKIA 2YBTA 3AQUA 1QPLA 3CZ8A 3AS3A 1FKBA 1ZL1A 3CHCA 1FKLA 4U86A 3IKGA 4ZPWR 1EQ3A 3GPKA 4TW7A 4JFIA 3OA5A 3WD2A 1X6LA 1NWRA 1W1VA 2RUCA 1ZU8A 3B7XA 2FDMA 4PTMA 3O5KA 1FFRA 1FKTA 4S3KA 4JFKA 1R9HA 3W4RA 3I6CA 4LGXA 2KI3A 4MNJA 4XAKA 5D75A 4MAVA 5HBFA 3NI6A 2YBUA 3WQWA 4S3JA 2ZQUA 1GOIA 1FKKA 4MGVA 4ZPTR 4Z2HA 3KZ7A 4R0XA 4P8VA 4QIBA 3RM4A 4HBEA 3CGMA 2XPAA 4MNKA 5DO2A 4KQZA 5I98A 2PV2A 2PI6A 3ARUA 3ALFA 3OOBA 1U79A 3G6MA 1IX5A 2IUZA 2MF9A 2PPPA 4ZS6A 5HT1A 4L72B 4WIWA 1FKGA 2XP9A 4TNSA 1FKRA 1NSGA 5DEZA 2DG9A 4DZ2A 3JYJA 5HTGA 4MPKA 1FKHA 3UI6A 5GPRA 5HW7A 1NMWA 3WH0A 1EHNA 1W1YA 3B8SA 4JFJA 2PBCA 2XP3A 2DPEA 2WK2A 5HUAA 2M08A 3KAIA 3UQAA 2O9OA 3CHEA 1J6YA 4P8UA 1HKJA 1Q6UA 4ITZA 1HXVA 2MLXA 2PPOA 4ODMA 1ITXA 3RM9A 1E6PA 1HKMA 4HARA 3FXYA 4FN2A 5DITA 3ALGA 1FFQA 1TCOC 2ZQVA 2KFWA 4WKHA 3UQIA 3O5EA 1H0GA 1Y0OA 2KR7A 2DT2A 1HJWA 1WAWA 3AS2A 2O92A 4ODOA 3KAGA 1D2KA 2PPNA 1FKJA 1ROTA 1WB0A 1J4HA 3CHDA 3WD3A 3O5LA 2FAPA 4MNMA 4WJXA 1NWUA 1CTNA 2L2SA 1UR9A 3FY1A 3O5FA 3WD0A 4DRPA 1QZ2A 3O5MA 2ZQSA 4GIVA 1E6ZA 1ZBVA 3IHZA 3NRKA 4FAPA 3B9DA 4ODKA 2XP4A 2RUDA 2RUQA 3ARXA 3IKDA 2PV3A 1KT0A 1W1TA 2N87A 2A3BA 4DZ3A 2D9FA 3NTPA 3B9EA 1J4RA 4ODQA 1Q6HA 2M1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XP5 A;  2XP7 A;  5J6E A;  2ZQU A;  3JYM A;  1FKK A;  3O5Q A;  1JVW A;  2LGO A;  1ZK6 A;  3IK8 A;  4MGV A;  4GGQ A;  4U84 A;  3KZ7 A;  1FJD A;  2AWG A;  2UZ5 A;  1D7J A;  4R0X A;  2DG4 A;  4DRO A;  1C9H A;  5HWB A;  5B8I C;  4QIB A;  1B6C A;  3CGM A;  3PRB A;  1F8A B;  2XPA A;  3TDB A;  2XPB A;  4DRI A;  1BKF A;  5I98 A;  1FAP A;  2PV2 A;  1FKF A;  2ZR4 A;  3UI4 A;  2VN1 A;  3OOB A;  1F40 A;  1U79 A;  5HWC A;  4IPX A;  3RFW A;  2MF9 A;  2DG3 A;  2MNT A;  2PPP A;  2RSE A;  5HT1 A;  1KT1 A;  2LKN A;  1JNS A;  1FKG A;  2XP9 A;  4TNS A;  4MSP A;  4W9O A;  1FKR A;  1NMV A;  1NSG A;  1P5Q A;  2MLZ A;  4NNR A;  3O5D A;  4DRJ A;  2DG9 A;  4DZ2 A;  3JYJ A;  1T11 A;  5HTG A;  1QPF A;  4TW6 A;  4QT3 A;  1L1P A;  4J4O A;  4DRM A;  4ODL A;  1FKH A;  2ZQT A;  3PRD A;  4ODR A;  3MDY B;  3UI6 A;  5HW8 A;  1A7X A;  5HW7 A;  5BXJ A;  2PV1 A;  1NMW A;  3WH0 A;  4LAW A;  3UF8 A;  2ZR6 A;  3KAF A;  3TC5 A;  2KO7 A;  4JFJ A;  1BL4 A;  2PBC A;  2RQS A;  4DIP A;  3KCE A;  4TW8 A;  2XP3 A;  2LJ4 A;  1EYM A;  2M08 A;  5HUA A;  4O2T A;  2XP8 A;  3H9R B;  3KAI A;  3LUO A;  3O5I A;  4JFL A;  5HKG A;  1JNT A;  3UQA A;  1FKI A;  3KAB A;  1YW5 A;  3O5R A;  1J6Y A;  3KAH A;  2Q5A A;  1Q6U A;  4W9Q A;  4ITZ A;  1HXV A;  2MLX A;  2PPO A;  2ITK A;  2OFN A;  4LAX A;  1D6O A;  4ODM A;  1ROU A;  2F4E A;  5DIU A;  4FN2 A;  4QT2 A;  5DIT A;  4DH0 A;  5HW6 A;  1N1A A;  1QPL A;  2KGJ A;  2MPH A;  3EY6 A;  1TCO C;  3O5J A;  4ODN A;  4DRQ A;  3TCZ A;  1FKB A;  5DIV A;  4DRK A;  2ZQV A;  1FKL A;  3KAD A;  2KFW A;  4U86 A;  2IF4 A;  3UQI A;  3IKG A;  1FD9 A;  3O5E A;  1FKD A;  1Y0O A;  2VCD A;  2KR7 A;  1EQ3 A;  3GPK A;  3RGC A;  1J4I A;  2F2D A;  3CGN A;  3ODK A;  3PA7 A;  4J4N A;  2FKE A;  4JFI A;  4ODP A;  4TW7 A;  4ODO A;  3KAG A;  2PPN A;  1FKJ A;  1ROT A;  1Q1C A;  1YAT A;  1J4H A;  2RUC A;  3O5P A;  4U85 A;  3O5L A;  2FAP A;  2M2A A;  3UQB A;  2L2S A;  4DT4 A;  4G50 A;  1M5Y A;  3O5F A;  4LAY A;  4TX0 A;  1QZ2 A;  3O5M A;  4LAV A;  3B7X A;  4DRP A;  2ZQS A;  1PBK A;  2LPV A;  4GIV A;  1D7I A;  3FAP A;  3O5K A;  4N19 A;  3IHZ A;  2JZV A;  4C02 B;  1FKT A;  4IQC A;  3NRK A;  1R9H A;  3KAC A;  4JFK A;  5GPG A;  4FAP A;  3UI5 A;  1D7H A;  1FKS A;  1Q6I A;  3I6C A;  2MLY A;  4ODK A;  2XP4 A;  2RUD A;  1W26 A;  4JYS A;  4DRH A;  2KI3 A;  4DRN A;  2RUQ A;  1PIN A;  2K8I A;  2KE0 A;  1KT0 A;  2PV3 A;  2N87 A;  3IKD A;  1ZCN A;  2XP6 A;  3JXV A;  3O5G A;  4BF8 A;  4DZ3 A;  4G2P A;  5D75 A;  2D9F A;  4IQ2 A;  3NI6 A;  2F21 A;  2Y78 A;  2ZR5 A;  3NTP A;  4TYO A;  4W9P A;  1J4R A;  4JFM A;  3VAW A;  4ODQ A;  1Q6H A;  2RUR A;  3O5O A;  2M1I A; 
#chains in the Genus database with same CATH topology
 5J6E A;  1ZK6 A;  4U84 A;  1LL6 A;  2WM0 A;  2UZ5 A;  1D7J A;  2P4V A;  5B8I C;  2G41 A;  2A3A A;  3PRB A;  2XPB A;  4DRI A;  4Z2G A;  2ZR4 A;  1JNE A;  3ARV A;  2OLH A;  5HWC A;  1VF8 A;  4IPX A;  2MNT A;  1KT1 A;  1ZB5 A;  2LKN A;  4W9O A;  1GPF A;  4NNR A;  2AOS A;  3ARO A;  3ARW A;  1T11 A;  1QPF A;  4QT3 A;  1L1P A;  3EIP A;  3WQV A;  1A7X A;  1SYT A;  4URI A;  2ZR6 A;  2DT3 A;  3KAF A;  2KO7 A;  3TC5 A;  5DF0 A;  4DIP A;  3KCE A;  2LJ4 A;  1EYM A;  4ZPV R;  3H9R B;  2DSV A;  5HKG A;  1FKI A;  3KAB A;  1W1P A;  1YW5 A;  3O5R A;  4W9Q A;  4Q22 A;  1TFV A;  3ARZ A;  1OGG A;  3BXW A;  1RD6 A;  4W5U A;  1ROU A;  3PR9 A;  2F4E A;  5HW6 A;  1N1A A;  4NSB A;  4DWS A;  2KGJ A;  2MPH A;  3EY6 A;  3O5J A;  4DRQ A;  3TCZ A;  5DIV A;  1HKK A;  4DRK A;  3WKZ A;  3ARR A;  2IF4 A;  1FD9 A;  2VCD A;  3RGC A;  1J4I A;  2F2D A;  3CGN A;  3PA7 A;  3B9A A;  3WL0 A;  1Q1C A;  4U85 A;  1YAT A;  3RM8 A;  3O5P A;  3ARS A;  2M2A A;  4DT4 A;  4G50 A;  4LAV A;  2DT0 A;  1D7I A;  3WD1 A;  5GQB A;  4C02 B;  1SR0 A;  4Q7N A;  1HJV A;  1JND A;  1Q6I A;  3AS0 A;  1NWS A;  4IT4 A;  1E6N A;  1X6N A;  4DRH A;  4DRN A;  1PIN A;  3JXV A;  2K8I A;  3O5G A;  4BF8 A;  4G2P A;  4DWS D;  4TYO A;  3VAW A;  1LL7 A;  4JFM A;  3O5O A;  2XP5 A;  2XP7 A;  1LL4 A;  3JYM A;  3O5Q A;  1ZBW A;  1EDQ A;  2LGO A;  4WKF A;  4P8W A;  4GGQ A;  4DRO A;  2DG4 A;  1C9H A;  5HWB A;  3WD4 A;  1B6C A;  4DWS B;  1H0I A;  1F8A B;  1FAP A;  3UI4 A;  3RFW A;  2DSU A;  2F23 A;  4MSP A;  2WLZ A;  1NMV A;  2MLZ A;  1WNO A;  1E6R A;  1K9T A;  1LG1 A;  3RME A;  4TW6 A;  3WIJ A;  5JH8 A;  4J4O A;  4DRM A;  2ZQT A;  3PRD A;  1E15 A;  3MDY B;  1XRV A;  5HW8 A;  1KFW A;  4AY1 A;  4ML4 A;  1NWT A;  3UF8 A;  2ESC A;  2RQS A;  2XP8 A;  4NZC A;  4MTV A;  3LUO A;  3O5I A;  2B31 A;  3KAH A;  4IT6 A;  2Q5A A;  1LG2 A;  1ZBK A;  2ITK A;  1W9P A;  2OFN A;  1GRJ A;  5DIU A;  1XHG A;  4QT2 A;  4ODN A;  3KAD A;  4R5E A;  1FKD A;  4DWS C;  2WLY A;  1LJY A;  3ARQ A;  1NH6 A;  3ODK A;  4J4N A;  4ODP A;  2FKE A;  3WL1 A;  1OGB A;  3UQB A;  4Z2I A;  1M5Y A;  4LAY A;  4TX0 A;  4HBO A;  1PBK A;  2LPV A;  3FAP A;  1E9L A;  4N19 A;  2JZV A;  4IQC A;  2A3E A;  3KAC A;  5GPG A;  3UI5 A;  1D7H A;  1FKS A;  2MLY A;  3AS1 A;  1O6I A;  1W26 A;  4JYS A;  2G8Z A;  2KE0 A;  4P8X A;  1ZCN A;  2XP6 A;  4IQ2 A;  2F21 A;  2Y78 A;  2ZR5 A;  4W9P A;  2A3C A;  3G6L A;  1BKF A;  2RUR A;  3BMB A;  1JVW A;  3IK8 A;  4UDM A;  1HJX A;  1FJD A;  4WKA A;  2AWG A;  2DSW A;  3ART A;  3QOK A;  1ZBC A;  2DSZ A;  3TDB A;  3CH9 A;  4WK9 A;  4L3N A;  2QF8 A;  1FKF A;  1LQ0 A;  2VN1 A;  1F40 A;  4Z2L A;  4QZV B;  2DG3 A;  2RSE A;  4Z2J A;  4KR0 B;  1JNS A;  1W9V A;  1P5Q A;  1EIB A;  4DRJ A;  3O5D A;  4ODL A;  4ODR A;  1W9U A;  1UR8 A;  5BXJ A;  2PV1 A;  4LAW A;  3ARP A;  1BL4 A;  4TW8 A;  2DT1 A;  3CHF A;  3ARY A;  4O2T A;  3PRA A;  1GUV A;  4JFL A;  1JNT A;  4Z2K A;  4MNL A;  1OWQ A;  4LAX A;  1D6O A;  2B5U B;  4DH0 A;  1HKI A;  2YBT A;  3AQU A;  1QPL A;  3CZ8 A;  3AS3 A;  1FKB A;  1ZL1 A;  3CHC A;  1FKL A;  4U86 A;  3IKG A;  4ZPW R;  1EQ3 A;  3GPK A;  4TW7 A;  4JFI A;  3OA5 A;  3WD2 A;  1X6L A;  1NWR A;  1W1V A;  2RUC A;  1ZU8 A;  2PN0 A;  3B7X A;  2FDM A;  4PTM A;  3O5K A;  1FFR A;  1FKT A;  4S3K A;  4JFK A;  1R9H A;  3W4R A;  3I6C A;  4LGX A;  2KI3 A;  4MNJ A;  4XAK A;  5D75 A;  4MAV A;  5HBF A;  3NI6 A;  2YBU A;  3WQW A;  4S3J A;  2ZQU A;  1GOI A;  1FKK A;  4MGV A;  4ZPT R;  4Z2H A;  3KZ7 A;  4R0X A;  4P8V A;  4QIB A;  3RM4 A;  4HBE A;  3CGM A;  2XPA A;  4MNK A;  5DO2 A;  4KQZ A;  5I98 A;  2PV2 A;  2PI6 A;  3ARU A;  3ALF A;  3OOB A;  1U79 A;  3G6M A;  1IX5 A;  2IUZ A;  2MF9 A;  2PPP A;  4ZS6 A;  5HT1 A;  4L72 B;  4WIW A;  1FKG A;  2XP9 A;  4TNS A;  1FKR A;  1NSG A;  5DEZ A;  2DG9 A;  4DZ2 A;  3JYJ A;  5HTG A;  4MPK A;  1FKH A;  3UI6 A;  5GPR A;  5HW7 A;  1NMW A;  3WH0 A;  1EHN A;  1W1Y A;  3B8S A;  4JFJ A;  2PBC A;  2XP3 A;  2DPE A;  2WK2 A;  5HUA A;  2M08 A;  3KAI A;  1JCH B;  3UQA A;  2O9O A;  3CHE A;  1J6Y A;  4P8U A;  1HKJ A;  1Q6U A;  4ITZ A;  1HXV A;  2MLX A;  2PPO A;  4ODM A;  1ITX A;  3RM9 A;  1E6P A;  1HKM A;  4HAR A;  3FXY A;  4FN2 A;  5DIT A;  3ALG A;  1FFQ A;  1TCO C;  2ZQV A;  2KFW A;  4WKH A;  3UQI A;  3O5E A;  1H0G A;  1Y0O A;  2KR7 A;  2DT2 A;  3GU0 A;  1HJW A;  1WAW A;  3AS2 A;  2O92 A;  4ODO A;  3KAG A;  1D2K A;  2PPN A;  1FKJ A;  1ROT A;  1WB0 A;  1J4H A;  3CHD A;  3WD3 A;  3O5L A;  2FAP A;  2EUL A;  4MNM A;  4WJX A;  1NWU A;  1CTN A;  2L2S A;  1UR9 A;  3FY1 A;  3O5F A;  3WD0 A;  4DRP A;  1QZ2 A;  3O5M A;  1E44 A;  2ZQS A;  4GIV A;  1E6Z A;  1ZBV A;  3IHZ A;  3NRK A;  4FAP A;  3B9D A;  4ODK A;  2XP4 A;  2RUD A;  2RUQ A;  3GTY X;  3ARX A;  3IKD A;  2PV3 A;  1KT0 A;  1W1T A;  2N87 A;  2A3B A;  4DZ3 A;  2ETN A;  2D9F A;  3NTP A;  3B9E A;  1J4R A;  4ODQ A;  1Q6H A;  2M1I A; 
#chains in the Genus database with same CATH homology
 5J6E A;  1ZK6 A;  4U84 A;  1LL6 A;  2WM0 A;  2UZ5 A;  1D7J A;  5B8I C;  2G41 A;  2A3A A;  3PRB A;  2XPB A;  4DRI A;  4Z2G A;  2ZR4 A;  1JNE A;  3ARV A;  2OLH A;  5HWC A;  1VF8 A;  4IPX A;  2MNT A;  1KT1 A;  1ZB5 A;  2LKN A;  4W9O A;  1GPF A;  4NNR A;  2AOS A;  3ARO A;  3ARW A;  1T11 A;  1QPF A;  4QT3 A;  1L1P A;  3WQV A;  1A7X A;  1SYT A;  4URI A;  2ZR6 A;  2DT3 A;  3KAF A;  2KO7 A;  3TC5 A;  5DF0 A;  4DIP A;  3KCE A;  2LJ4 A;  1EYM A;  4ZPV R;  3H9R B;  2DSV A;  5HKG A;  1FKI A;  3KAB A;  1W1P A;  1YW5 A;  3O5R A;  4W9Q A;  4Q22 A;  1TFV A;  3ARZ A;  1OGG A;  3BXW A;  1RD6 A;  4W5U A;  1ROU A;  3PR9 A;  2F4E A;  5HW6 A;  1N1A A;  4NSB A;  4DWS A;  2KGJ A;  2MPH A;  3EY6 A;  3O5J A;  4DRQ A;  3TCZ A;  5DIV A;  1HKK A;  4DRK A;  3WKZ A;  3ARR A;  2IF4 A;  1FD9 A;  2VCD A;  3RGC A;  1J4I A;  2F2D A;  3CGN A;  3PA7 A;  3B9A A;  3WL0 A;  1Q1C A;  4U85 A;  1YAT A;  3RM8 A;  3O5P A;  3ARS A;  2M2A A;  4DT4 A;  4G50 A;  4LAV A;  2DT0 A;  1D7I A;  3WD1 A;  5GQB A;  4C02 B;  1SR0 A;  4Q7N A;  1HJV A;  1JND A;  1Q6I A;  3AS0 A;  1NWS A;  4IT4 A;  1E6N A;  1X6N A;  4DRH A;  4DRN A;  1PIN A;  3JXV A;  2K8I A;  3O5G A;  4BF8 A;  4G2P A;  4DWS D;  4TYO A;  3VAW A;  1LL7 A;  4JFM A;  3O5O A;  2XP5 A;  2XP7 A;  1LL4 A;  3JYM A;  3O5Q A;  1ZBW A;  1EDQ A;  2LGO A;  4WKF A;  4P8W A;  4GGQ A;  4DRO A;  2DG4 A;  1C9H A;  5HWB A;  3WD4 A;  1B6C A;  4DWS B;  1H0I A;  1F8A B;  1FAP A;  3UI4 A;  3RFW A;  2DSU A;  4MSP A;  2WLZ A;  1NMV A;  2MLZ A;  1WNO A;  1E6R A;  1K9T A;  1LG1 A;  3RME A;  4TW6 A;  3WIJ A;  5JH8 A;  4J4O A;  4DRM A;  2ZQT A;  3PRD A;  1E15 A;  3MDY B;  1XRV A;  5HW8 A;  1KFW A;  4AY1 A;  4ML4 A;  1NWT A;  3UF8 A;  2ESC A;  2RQS A;  2XP8 A;  4NZC A;  4MTV A;  3LUO A;  3O5I A;  2B31 A;  3KAH A;  4IT6 A;  2Q5A A;  1LG2 A;  1ZBK A;  2ITK A;  1W9P A;  2OFN A;  5DIU A;  1XHG A;  4QT2 A;  4ODN A;  3KAD A;  4R5E A;  1FKD A;  4DWS C;  2WLY A;  1LJY A;  3ARQ A;  1NH6 A;  3ODK A;  4J4N A;  4ODP A;  2FKE A;  3WL1 A;  1OGB A;  3UQB A;  4Z2I A;  1M5Y A;  4LAY A;  4TX0 A;  4HBO A;  1PBK A;  2LPV A;  3FAP A;  1E9L A;  4N19 A;  2JZV A;  4IQC A;  2A3E A;  3KAC A;  5GPG A;  3UI5 A;  1D7H A;  1FKS A;  2MLY A;  3AS1 A;  1O6I A;  1W26 A;  4JYS A;  2G8Z A;  2KE0 A;  4P8X A;  1ZCN A;  2XP6 A;  4IQ2 A;  2F21 A;  2Y78 A;  2ZR5 A;  4W9P A;  2A3C A;  3G6L A;  1BKF A;  2RUR A;  1JVW A;  3IK8 A;  1HJX A;  1FJD A;  4WKA A;  2AWG A;  2DSW A;  3ART A;  3QOK A;  1ZBC A;  2DSZ A;  3TDB A;  3CH9 A;  4WK9 A;  4L3N A;  2QF8 A;  1FKF A;  1LQ0 A;  2VN1 A;  1F40 A;  4Z2L A;  4QZV B;  2DG3 A;  2RSE A;  4Z2J A;  4KR0 B;  1JNS A;  1W9V A;  1P5Q A;  1EIB A;  4DRJ A;  3O5D A;  4ODL A;  4ODR A;  1W9U A;  1UR8 A;  5BXJ A;  2PV1 A;  4LAW A;  3ARP A;  1BL4 A;  4TW8 A;  2DT1 A;  3CHF A;  3ARY A;  4O2T A;  3PRA A;  1GUV A;  4JFL A;  1JNT A;  4Z2K A;  4MNL A;  1OWQ A;  4LAX A;  1D6O A;  4DH0 A;  1HKI A;  2YBT A;  3AQU A;  1QPL A;  3CZ8 A;  3AS3 A;  1FKB A;  1ZL1 A;  3CHC A;  1FKL A;  4U86 A;  3IKG A;  4ZPW R;  1EQ3 A;  3GPK A;  4TW7 A;  4JFI A;  3OA5 A;  3WD2 A;  1X6L A;  1NWR A;  1W1V A;  2RUC A;  1ZU8 A;  3B7X A;  2FDM A;  4PTM A;  3O5K A;  1FFR A;  1FKT A;  4S3K A;  4JFK A;  1R9H A;  3W4R A;  3I6C A;  4LGX A;  2KI3 A;  4MNJ A;  4XAK A;  5D75 A;  4MAV A;  5HBF A;  3NI6 A;  2YBU A;  3WQW A;  4S3J A;  2ZQU A;  1GOI A;  1FKK A;  4MGV A;  4ZPT R;  4Z2H A;  3KZ7 A;  4R0X A;  4P8V A;  4QIB A;  3RM4 A;  4HBE A;  3CGM A;  2XPA A;  4MNK A;  5DO2 A;  4KQZ A;  5I98 A;  2PV2 A;  2PI6 A;  3ARU A;  3ALF A;  3OOB A;  1U79 A;  3G6M A;  1IX5 A;  2IUZ A;  2MF9 A;  2PPP A;  4ZS6 A;  5HT1 A;  4L72 B;  4WIW A;  1FKG A;  2XP9 A;  4TNS A;  1FKR A;  1NSG A;  5DEZ A;  2DG9 A;  4DZ2 A;  3JYJ A;  5HTG A;  4MPK A;  1FKH A;  3UI6 A;  5GPR A;  5HW7 A;  1NMW A;  3WH0 A;  1EHN A;  1W1Y A;  3B8S A;  4JFJ A;  2PBC A;  2XP3 A;  2DPE A;  2WK2 A;  5HUA A;  2M08 A;  3KAI A;  3UQA A;  2O9O A;  3CHE A;  1J6Y A;  4P8U A;  1HKJ A;  1Q6U A;  4ITZ A;  1HXV A;  2MLX A;  2PPO A;  4ODM A;  1ITX A;  3RM9 A;  1E6P A;  1HKM A;  4HAR A;  3FXY A;  4FN2 A;  5DIT A;  3ALG A;  1FFQ A;  1TCO C;  2ZQV A;  2KFW A;  4WKH A;  3UQI A;  3O5E A;  1H0G A;  1Y0O A;  2KR7 A;  2DT2 A;  1HJW A;  1WAW A;  3AS2 A;  2O92 A;  4ODO A;  3KAG A;  1D2K A;  2PPN A;  1FKJ A;  1ROT A;  1WB0 A;  1J4H A;  3CHD A;  3WD3 A;  3O5L A;  2FAP A;  4MNM A;  4WJX A;  1NWU A;  1CTN A;  2L2S A;  1UR9 A;  3FY1 A;  3O5F A;  3WD0 A;  4DRP A;  1QZ2 A;  3O5M A;  2ZQS A;  4GIV A;  1E6Z A;  1ZBV A;  3IHZ A;  3NRK A;  4FAP A;  3B9D A;  4ODK A;  2XP4 A;  2RUD A;  2RUQ A;  3ARX A;  3IKD A;  2PV3 A;  1KT0 A;  1W1T A;  2N87 A;  2A3B A;  4DZ3 A;  2D9F A;  3NTP A;  3B9E A;  1J4R A;  4ODQ A;  1Q6H A;  2M1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...