4FAPA

Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-BINDING PROTEIN
molecule tags Cell cycle
source organism Homo sapiens
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4fapA00
1KT0A 1FKBA 2F21A 3O5EA 1FAPA 4DRPA 2MPHA 3O5MA 5BXJA 2DG3A 1Q1CA 5DITA 4DRQA 1F8AB 1FKFA 3UI4A 1D7JA 2ZQUA 2F4EA 2ZR5A 1FKTA 4TW6A 4MSPA 4N19A 4ITZA 3TCZA 5HWBA 5HWCA 3O5QA 3UQBA 1U79A 1JNSA 2MLYA 4W9OA 3O5DA 4DRMA 2Q5AA 2KO7A 2OFNA 4ODNA 3JXVA 4BF8A 2XP8A 3IKDA 3KAHA 4G50A 4LAWA 2XPAA 1A7XA 4ODLA 5HT1A 4JFKA 3O5PA 3KCEA 3TDBA 3NTPA 1EQ3A 2ZQSA 3PA7A 1YATA 2XP5A 2XP7A 3NI6A 4GIVA 1N1AA 4TYOA 2PBCA 4DRNA 3UF8A 4IQCA 1FKKA 4J4NA 1FKIA 2Y78A 4R0XA 2MLZA 3KZ7A 3O5OA 2UZ5A 1ZK6A 2IF4A 3GPKA 3I6CA 4JFLA 4ODKA 5DIUA 3B7XA 2RSEA 2RUQA 4LAYA 3WH0A 1FKGA 3O5KA 3O5JA 4JFJA 3VAWA 5GPGA 1J6YA 2DG9A 4LAVA 1C9HA 4DRJA 4W9PA 4DRKA 5HW8A 2D9FA 4DROA 1FKRA 2AWGA 1ZCNA 2XPBA 2LKNA 1FKLA 4U84A 2VN1A 4ODOA 1Y0OA 2PPOA 4DH0A 1EYMA 1QPLA 3KAFA 4W9QA 5HW6A 1PINA 1PBKA 2PV1A 3O5GA 3O5IA 4C02B 2PV3A 4QIBA 2PPNA 4DZ2A 1FKDA 2JZVA 2VCDA 5D75A 1NMVA 1D6OA 3JYMA 5DIVA 3UI6A 2FKEA 3H9RB 2LGOA 3IK8A 1FD9A 2RURA 3FAPA 5HUAA 1JVWA 2PV2A 3OOBA 1M5YA 4JFMA 3RFWA 2KI3A 3KAGA 3KADA 1Q6IA 2XP4A 1JNTA 5HTGA 4QT2A 2XP6A 1J4IA 3UQIA 3TC5A 2RQSA 5I98A 1P5QA 2M08A 3IKGA 3MDYB 4MGVA 1FKJA 2K8IA 4DZ3A 2KGJA 5J6EA 3O5RA 1FJDA 2RUDA 3JYJA 1Q6HA 3KACA 3NRKA 4FN2A 1J4HA 4TX0A 4U86A 3UI5A 1HXVA 2KR7A 4JYSA 2KFWA 3O5LA 4TW8A 1NSGA 3KABA 4ODQA 2M1IA 3EY6A 4DRHA 3CGNA 1J4RA 1TCOC 1QPFA 2ZR4A 2ZR6A 5HKGA 2M2AA 1YW5A 1QZ2A 2L2SA 2MNTA 5B8IC 1R9HA 2XP3A 1FKSA 3ODKA 4LAXA 4QT3A 1NMWA 4G2PA 5HW7A 4TNSA 4J4OA 3UQAA 3LUOA 4GGQA 1D7HA 1D7IA 2LPVA 2N87A 1F40A 4FAPA 2MF9A 3CGMA 3PRBA 2ZQVA 4O2TA 1B6CA 2RUCA 1BKFA 1KT1A 4IQ2A 4ODPA 4ODRA 2XP9A 4TW7A 4ODMA 3RGCA 4DRIA 3O5FA 2LJ4A 3KAIA 2PPPA 1L1PA 1T11A 2F2DA 3IHZA 3PRDA 2KE0A 4DT4A 1W26A 4DIPA 4IPXA 1BL4A 1FKHA 2FAPA 1Q6UA 2MLXA 4JFIA 4NNRA 2ZQTA 2DG4A 1ROTA 4U85A 1ROUA 2ITKA
chains in the Genus database with same CATH superfamily
3O5EA 3WD0A 1D7JA 4MNMA 1FKTA 4ITZA 5HWBA 5HWCA 3O5QA 2Q5AA 4LAWA 3IKDA 1XHGA 1A7XA 4MAVA 5HBFA 4WKAA 1UR8A 1YATA 2XP5A 2XP7A 4KQZA 4MNJA 3AQUA 4DRNA 4J4NA 1LG2A 2Y78A 2WLZA 3AS1A 5DO2A 3O5OA 1SR0A 1EDQA 1LL4A 3WD3A 4JFJA 5GQBA 3VAWA 2D9FA 2XPBA 2LKNA 2VN1A 1LG1A 3CHFA 2PV1A 4C02B 4P8UA 3CH9A 4Q22A 3UI6A 1UR9A 5HUAA 2RURA 3FAPA 4WKHA 1M5YA 1Q6IA 3GU0A 4QT2A 5DF0A 3WIJA 2WLYA 2RQSA 5I98A 1P5QA 2DT2A 2M08A 3WD1A 4MPKA 2RUDA 3FXYA 1RD6A 2DSZA 4TW8A 1OWQA 1NSGA 1E6ZA 3KABA 1SYTA 4DRHA 4LGXA 3ARVA 1W1TA 2O92A 2B31A 1QPFA 2M2AA 2L2SA 1ZBCA 1HKKA 4QT3A 3LUOA 1E15A 2MF9A 3WQWA 4IQ2A 2DPEA 4ODPA 1HKJA 3QOKA 3RGCA 2G8ZA 3O5FA 2LJ4A 3ARPA 1L1PA 1T11A 1XRVA 3IHZA 2A3CA 4ML4A 4JFIA 1LJYA 4DRPA 1FAPA 4Z2HA 4HBOA 1H0GA 2DT1A 1Q1CA 2A3BA 1NWUA 1F8AB 3WD2A 1CTNA 4XAKA 3RM8A 2ZQUA 3UI4A 2ZR5A 2G41A 2MLYA 4W9OA 4DRMA 4BF8A 4G50A 3O5PA 4Z2KA 4DWSD 3ARRA 3NTPA 1ZBKA 3ARSA 1N1AA 3CHCA 5JH8A 2PBCA 3AS2A 3UF8A 1FKIA 4URIA 2EULA 2IF4A 4MTVA 1W9UA 4JFLA 1FFQA 3B7XA 2RUQA 4LAYA 4W5UA 1ZL1A 1HKMA 4L3NA 4LAVA 4DRKA 1ITXA 1E6RA 2AWGA 1FKLA 1NWRA 1ZB5A 1W9VA 2DT3A 3ARWA 4QIBA 4ZPVR 3CHDA 1D6OA 3JYMA 3WQVA 2LGOA 3IK8A 1FD9A 3OOBA 3RFWA 3KADA 3B9AA 3ARXA 5HTGA 1NWTA 3UQIA 1W9PA 1FKJA 2K8IA 4DZ3A 3KACA 1E44A 4JYSA 3O5LA 2M1IA 4ZPWR 3CGNA 2ZR6A 3GTYX 1YW5A 1QZ2A 4WIWA 1IX5A 5HW7A 1R9HA 4LAXA 1FKSA 1NMWA 2DT0A 3B8SA 3BXWA 3UQAA 4GGQA 1F40A 1D7HA 1D7IA 4DWSB 3BMBA 1LL7A 3PRBA 2DSWA 4O2TA 1FFRA 4ODMA 4P8XA 1OGBA 3KAIA 3OA5A 2F2DA 2KE0A 3AS0A 1W26A 4DIPA 4IPXA 1FKHA 2QF8A 1Q6UA 4Q7NA 2F21A 1FKBA 3CHEA 3O5MA 4P8VA 2DSVA 2YBTA 1FKFA 2F4EA 1GPFA 1JNDA 2O9OA 4MSPA 4TW6A 2P4VA 4MNLA 2OLHA 1JNSA 2OFNA 1GOIA 1GUVA 4L72B 2XP8A 4HBEA 4ZS6A 2AOSA 3TDBA 1EQ3A 3PA7A 3NI6A 4IQCA 1EHNA 2MLZA 2PN0A 1W1YA 3GPKA 2DSUA 3I6CA 4WK9A 2RSEA 1W1PA 3WH0A 1FKGA 3O5KA 3O5JA 1E6NA 2YBUA 4Z2LA 2B5UB 4NZCA 1J6YA 4S3KA 1EIBA 1C9HA 4WKFA 3CZ8A 1FKRA 1HKIA 4DH0A 4DWSC 1Y0OA 5HW6A 1W1VA 3PR9A 3O5GA 1WNOA 2PV3A 3PRAA 2PPNA 4DZ2A 1NWSA 1FKDA 2VCDA 2WK2A 4DWSA 2FKEA 4NSBA 2PV2A 2KI3A 1X6LA 4WJXA 3WL1A 2XP6A 4ZPTR 1JCHB 1E6PA 3IKGA 4MGVA 2ETNA 1X6NA 1ZBVA 4P8WA 3O5RA 1FJDA 3B9EA 4FN2A 3UI5A 2KR7A 1HJVA 3ALFA 3RM4A 2ZR4A 3ARUA 3AS3A 2MNTA 1H0IA 5DEZA 4TNSA 3RMEA 2LPVA 4FAPA 2RUCA 1BKFA 4TW7A 3WD4A 4DRIA 2F23A 3G6LA 3EIPA 3AROA 1E9LA 1WAWA 4MNKA 4DT4A 1BL4A 4U85A 4Z2IA 5BXJA 5B8IC 2DG4A 1VF8A 4U84A 3KAGA 2ITKA 1KT0A 3G6MA 2MPHA 2DG3A 1JNEA 5DITA 4DRQA 1TFVA 4N19A 2A3EA 1ZU8A 3TCZA 3UQBA 1U79A 2ESCA 3O5DA 2KO7A 2WM0A 4ODNA 3JXVA 3KAHA 1D2KA 2XPAA 4ODLA 5HT1A 4JFKA 1WB0A 4R5EA 3KCEA 2ZQSA 4TYOA 4GIVA 3W4RA 4HARA 1FKKA 4Z2JA 3KZ7A 1LQ0A 2UZ5A 1ZK6A 5DIUA 2IUZA 4ODKA 4UDMA 4Z2GA 1OGGA 5GPGA 2DG9A 4DRJA 5HW8A 4W9PA 1KFWA 4DROA 1ZCNA 3FY1A 4ODOA 2PPOA 4S3JA 3ARYA 1EYMA 1QPLA 3WL0A 3KAFA 4IT4A 4W9QA 1PINA 1PBKA 1ZBWA 3O5IA 1GRJA 1K9TA 2JZVA 5D75A 1NMVA 5DIVA 1HXVA 3H9RB 1JVWA 4JFMA 3WKZA 2XP4A 1JNTA 1J4IA 4AY1A 3TC5A 3MDYB 3ALGA 4PTMA 4QZVB 2KGJA 5J6EA 4IT6A 4U86A 3JYJA 1Q6HA 3NRKA 4TX0A 1J4HA 3B9DA 1NH6A 2FDMA 3RM9A 2KFWA 2A3AA 4ODQA 3EY6A 3ARZA 1J4RA 5GPRA 1TCOC 5HKGA 2XP3A 3ODKA 4G2PA 1HJXA 4J4OA 2N87A 3ARTA 3CGMA 2ZQVA 1B6CA 1KT1A 1O6IA 1LL6A 2XP9A 4KR0B 2PI6A 2PPPA 1HJWA 3PRDA 3ARQA 4ODRA 2FAPA 2MLXA 4NNRA 4R0XA 2ZQTA 1ROTA 1ROUA
chains in the Genus database with same CATH topology
3O5EA 3WD0A 1D7JA 4MNMA 1FKTA 4ITZA 5HWBA 5HWCA 3O5QA 2Q5AA 4LAWA 3IKDA 1XHGA 1A7XA 4MAVA 5HBFA 4WKAA 1UR8A 1YATA 2XP5A 2XP7A 4KQZA 4MNJA 3AQUA 4DRNA 4J4NA 1LG2A 2Y78A 2WLZA 3AS1A 5DO2A 3O5OA 1SR0A 1EDQA 1LL4A 3WD3A 4JFJA 5GQBA 3VAWA 2D9FA 2XPBA 2LKNA 2VN1A 1LG1A 3CHFA 2PV1A 4C02B 4P8UA 3CH9A 4Q22A 3UI6A 1UR9A 5HUAA 2RURA 3FAPA 4WKHA 1M5YA 1Q6IA 4QT2A 5DF0A 3WIJA 2WLYA 2RQSA 5I98A 1P5QA 2DT2A 2M08A 3WD1A 4MPKA 2RUDA 3FXYA 1RD6A 2DSZA 4TW8A 1OWQA 1NSGA 1E6ZA 3KABA 1SYTA 4DRHA 4LGXA 3ARVA 1W1TA 2O92A 2B31A 1QPFA 2M2AA 2L2SA 1ZBCA 1HKKA 4QT3A 3LUOA 1E15A 2MF9A 3WQWA 4IQ2A 2DPEA 4ODPA 1HKJA 3QOKA 3RGCA 2G8ZA 3O5FA 2LJ4A 3ARPA 1L1PA 1T11A 1XRVA 3IHZA 2A3CA 4ML4A 4JFIA 1LJYA 4DRPA 1FAPA 4Z2HA 4HBOA 1H0GA 2DT1A 1Q1CA 2A3BA 1NWUA 1F8AB 3WD2A 1CTNA 4XAKA 3RM8A 2ZQUA 3UI4A 2ZR5A 2G41A 2MLYA 4W9OA 4DRMA 4BF8A 4G50A 3O5PA 4Z2KA 4DWSD 3ARRA 3NTPA 1ZBKA 3ARSA 1N1AA 3CHCA 5JH8A 2PBCA 3AS2A 3UF8A 1FKIA 4URIA 2IF4A 4MTVA 1W9UA 4JFLA 1FFQA 3B7XA 2RUQA 4LAYA 4W5UA 1ZL1A 1HKMA 4L3NA 4LAVA 4DRKA 1ITXA 1E6RA 2AWGA 1FKLA 1NWRA 1ZB5A 1W9VA 2DT3A 3ARWA 4QIBA 4ZPVR 3CHDA 1D6OA 3JYMA 3WQVA 2LGOA 3IK8A 1FD9A 3OOBA 3RFWA 3KADA 3B9AA 3ARXA 5HTGA 1NWTA 3UQIA 1W9PA 1FKJA 2K8IA 4DZ3A 3KACA 4JYSA 3O5LA 2M1IA 4ZPWR 3CGNA 2ZR6A 1YW5A 1QZ2A 4WIWA 1IX5A 5HW7A 1R9HA 4LAXA 1FKSA 1NMWA 2DT0A 3B8SA 3BXWA 3UQAA 4GGQA 1F40A 1D7HA 1D7IA 4DWSB 1LL7A 3PRBA 2DSWA 4O2TA 1FFRA 4ODMA 4P8XA 1OGBA 3KAIA 3OA5A 2F2DA 2KE0A 3AS0A 1W26A 4DIPA 4IPXA 1FKHA 2QF8A 1Q6UA 4Q7NA 2F21A 1FKBA 3CHEA 3O5MA 4P8VA 2DSVA 2YBTA 1FKFA 2F4EA 1GPFA 1JNDA 2O9OA 4MSPA 4TW6A 4MNLA 2OLHA 1JNSA 2OFNA 1GOIA 1GUVA 4L72B 2XP8A 4HBEA 4ZS6A 2AOSA 3TDBA 1EQ3A 3PA7A 3NI6A 4IQCA 1EHNA 2MLZA 1W1YA 3GPKA 2DSUA 3I6CA 4WK9A 2RSEA 1W1PA 3WH0A 1FKGA 3O5KA 3O5JA 1E6NA 2YBUA 4Z2LA 4NZCA 1J6YA 4S3KA 1EIBA 1C9HA 4WKFA 3CZ8A 1FKRA 1HKIA 4DH0A 4DWSC 1Y0OA 5HW6A 1W1VA 3PR9A 3O5GA 1WNOA 2PV3A 3PRAA 2PPNA 4DZ2A 1NWSA 1FKDA 2VCDA 2WK2A 4DWSA 2FKEA 4NSBA 2PV2A 2KI3A 1X6LA 4WJXA 3WL1A 2XP6A 4ZPTR 1E6PA 3IKGA 4MGVA 1X6NA 1ZBVA 4P8WA 3O5RA 1FJDA 3B9EA 4FN2A 3UI5A 2KR7A 1HJVA 3ALFA 3RM4A 2ZR4A 3ARUA 3AS3A 2MNTA 1H0IA 5DEZA 4TNSA 3RMEA 2LPVA 4FAPA 2RUCA 1BKFA 4TW7A 3WD4A 4DRIA 3G6LA 3AROA 1E9LA 1WAWA 4MNKA 4DT4A 1BL4A 4U85A 4Z2IA 5BXJA 5B8IC 2DG4A 1VF8A 4U84A 3KAGA 2ITKA 1KT0A 3G6MA 2MPHA 2DG3A 1JNEA 5DITA 4DRQA 1TFVA 4N19A 2A3EA 1ZU8A 3TCZA 3UQBA 1U79A 2ESCA 3O5DA 2KO7A 2WM0A 4ODNA 3JXVA 3KAHA 1D2KA 2XPAA 4ODLA 5HT1A 4JFKA 1WB0A 4R5EA 3KCEA 2ZQSA 4TYOA 4GIVA 3W4RA 4HARA 1FKKA 4Z2JA 3KZ7A 1LQ0A 2UZ5A 1ZK6A 5DIUA 2IUZA 4ODKA 4Z2GA 1OGGA 5GPGA 2DG9A 4DRJA 5HW8A 4W9PA 1KFWA 4DROA 1ZCNA 3FY1A 4ODOA 2PPOA 4S3JA 3ARYA 1EYMA 1QPLA 3WL0A 3KAFA 4IT4A 4W9QA 1PINA 1PBKA 1ZBWA 3O5IA 1K9TA 2JZVA 5D75A 1NMVA 5DIVA 1HXVA 3H9RB 1JVWA 4JFMA 3WKZA 2XP4A 1JNTA 1J4IA 4AY1A 3TC5A 3MDYB 3ALGA 4PTMA 4QZVB 2KGJA 5J6EA 4IT6A 4U86A 3JYJA 1Q6HA 3NRKA 4TX0A 1J4HA 3B9DA 1NH6A 2FDMA 3RM9A 2KFWA 2A3AA 4ODQA 3EY6A 3ARZA 1J4RA 5GPRA 1TCOC 5HKGA 2XP3A 3ODKA 4G2PA 1HJXA 4J4OA 2N87A 3ARTA 3CGMA 2ZQVA 1B6CA 1KT1A 1O6IA 1LL6A 2XP9A 4KR0B 2PI6A 2PPPA 1HJWA 3PRDA 3ARQA 4ODRA 2FAPA 2MLXA 4NNRA 4R0XA 2ZQTA 1ROTA 1ROUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT0 A;  1FKB A;  2F21 A;  3O5E A;  1FAP A;  4DRP A;  2MPH A;  3O5M A;  5BXJ A;  2DG3 A;  1Q1C A;  5DIT A;  4DRQ A;  1F8A B;  1FKF A;  3UI4 A;  1D7J A;  2ZQU A;  2F4E A;  2ZR5 A;  1FKT A;  4TW6 A;  4MSP A;  4N19 A;  4ITZ A;  3TCZ A;  5HWB A;  5HWC A;  3O5Q A;  3UQB A;  1U79 A;  1JNS A;  2MLY A;  4W9O A;  3O5D A;  4DRM A;  2Q5A A;  2KO7 A;  2OFN A;  4ODN A;  3JXV A;  4BF8 A;  2XP8 A;  3IKD A;  3KAH A;  4G50 A;  4LAW A;  2XPA A;  1A7X A;  4ODL A;  5HT1 A;  4JFK A;  3O5P A;  3KCE A;  3TDB A;  3NTP A;  1EQ3 A;  2ZQS A;  3PA7 A;  1YAT A;  2XP5 A;  2XP7 A;  3NI6 A;  4GIV A;  1N1A A;  4TYO A;  2PBC A;  4DRN A;  3UF8 A;  4IQC A;  1FKK A;  4J4N A;  1FKI A;  2Y78 A;  4R0X A;  2MLZ A;  3KZ7 A;  3O5O A;  2UZ5 A;  1ZK6 A;  2IF4 A;  3GPK A;  3I6C A;  4JFL A;  4ODK A;  5DIU A;  3B7X A;  2RSE A;  2RUQ A;  4LAY A;  3WH0 A;  1FKG A;  3O5K A;  3O5J A;  4JFJ A;  3VAW A;  5GPG A;  1J6Y A;  2DG9 A;  4LAV A;  1C9H A;  4DRJ A;  4W9P A;  4DRK A;  5HW8 A;  2D9F A;  4DRO A;  1FKR A;  2AWG A;  1ZCN A;  2XPB A;  2LKN A;  1FKL A;  4U84 A;  2VN1 A;  4ODO A;  1Y0O A;  2PPO A;  4DH0 A;  1EYM A;  1QPL A;  3KAF A;  4W9Q A;  5HW6 A;  1PIN A;  1PBK A;  2PV1 A;  3O5G A;  3O5I A;  4C02 B;  2PV3 A;  4QIB A;  2PPN A;  4DZ2 A;  1FKD A;  2JZV A;  2VCD A;  5D75 A;  1NMV A;  1D6O A;  3JYM A;  5DIV A;  3UI6 A;  2FKE A;  3H9R B;  2LGO A;  3IK8 A;  1FD9 A;  2RUR A;  3FAP A;  5HUA A;  1JVW A;  2PV2 A;  3OOB A;  1M5Y A;  4JFM A;  3RFW A;  2KI3 A;  3KAG A;  3KAD A;  1Q6I A;  2XP4 A;  1JNT A;  5HTG A;  4QT2 A;  2XP6 A;  1J4I A;  3UQI A;  3TC5 A;  2RQS A;  5I98 A;  1P5Q A;  2M08 A;  3IKG A;  3MDY B;  4MGV A;  1FKJ A;  2K8I A;  4DZ3 A;  2KGJ A;  5J6E A;  3O5R A;  1FJD A;  2RUD A;  3JYJ A;  1Q6H A;  3KAC A;  3NRK A;  4FN2 A;  1J4H A;  4TX0 A;  4U86 A;  3UI5 A;  1HXV A;  2KR7 A;  4JYS A;  2KFW A;  3O5L A;  4TW8 A;  1NSG A;  3KAB A;  4ODQ A;  2M1I A;  3EY6 A;  4DRH A;  3CGN A;  1J4R A;  1TCO C;  1QPF A;  2ZR4 A;  2ZR6 A;  5HKG A;  2M2A A;  1YW5 A;  1QZ2 A;  2L2S A;  2MNT A;  5B8I C;  1R9H A;  2XP3 A;  1FKS A;  3ODK A;  4LAX A;  4QT3 A;  1NMW A;  4G2P A;  5HW7 A;  4TNS A;  4J4O A;  3UQA A;  3LUO A;  4GGQ A;  1D7H A;  1D7I A;  2LPV A;  2N87 A;  1F40 A;  4FAP A;  2MF9 A;  3CGM A;  3PRB A;  2ZQV A;  4O2T A;  1B6C A;  2RUC A;  1BKF A;  1KT1 A;  4IQ2 A;  4ODP A;  4ODR A;  2XP9 A;  4TW7 A;  4ODM A;  3RGC A;  4DRI A;  3O5F A;  2LJ4 A;  3KAI A;  2PPP A;  1L1P A;  1T11 A;  2F2D A;  3IHZ A;  3PRD A;  2KE0 A;  4DT4 A;  1W26 A;  4DIP A;  4IPX A;  1BL4 A;  1FKH A;  2FAP A;  1Q6U A;  2MLX A;  4JFI A;  4NNR A;  2ZQT A;  2DG4 A;  1ROT A;  4U85 A;  1ROU A;  2ITK A; 
#chains in the Genus database with same CATH topology
 3O5E A;  3WD0 A;  1D7J A;  4MNM A;  1FKT A;  4ITZ A;  5HWB A;  5HWC A;  3O5Q A;  2Q5A A;  4LAW A;  3IKD A;  1XHG A;  1A7X A;  4MAV A;  5HBF A;  4WKA A;  1UR8 A;  1YAT A;  2XP5 A;  2XP7 A;  4KQZ A;  4MNJ A;  3AQU A;  4DRN A;  4J4N A;  1LG2 A;  2Y78 A;  2WLZ A;  3AS1 A;  5DO2 A;  3O5O A;  1SR0 A;  1EDQ A;  1LL4 A;  3WD3 A;  4JFJ A;  5GQB A;  3VAW A;  2D9F A;  2XPB A;  2LKN A;  2VN1 A;  1LG1 A;  3CHF A;  2PV1 A;  4C02 B;  4P8U A;  3CH9 A;  4Q22 A;  3UI6 A;  1UR9 A;  5HUA A;  2RUR A;  3FAP A;  4WKH A;  1M5Y A;  1Q6I A;  3GU0 A;  4QT2 A;  5DF0 A;  3WIJ A;  2WLY A;  2RQS A;  5I98 A;  1P5Q A;  2DT2 A;  2M08 A;  3WD1 A;  4MPK A;  2RUD A;  3FXY A;  1RD6 A;  2DSZ A;  4TW8 A;  1OWQ A;  1NSG A;  1E6Z A;  3KAB A;  1SYT A;  4DRH A;  4LGX A;  3ARV A;  1W1T A;  2O92 A;  2B31 A;  1QPF A;  2M2A A;  2L2S A;  1ZBC A;  1HKK A;  4QT3 A;  3LUO A;  1E15 A;  2MF9 A;  3WQW A;  4IQ2 A;  2DPE A;  4ODP A;  1HKJ A;  3QOK A;  3RGC A;  2G8Z A;  3O5F A;  2LJ4 A;  3ARP A;  1L1P A;  1T11 A;  1XRV A;  3IHZ A;  2A3C A;  4ML4 A;  4JFI A;  1LJY A;  4DRP A;  1FAP A;  4Z2H A;  4HBO A;  1H0G A;  2DT1 A;  1Q1C A;  2A3B A;  1NWU A;  1F8A B;  3WD2 A;  1CTN A;  4XAK A;  3RM8 A;  2ZQU A;  3UI4 A;  2ZR5 A;  2G41 A;  2MLY A;  4W9O A;  4DRM A;  4BF8 A;  4G50 A;  3O5P A;  4Z2K A;  4DWS D;  3ARR A;  3NTP A;  1ZBK A;  3ARS A;  1N1A A;  3CHC A;  5JH8 A;  2PBC A;  3AS2 A;  3UF8 A;  1FKI A;  4URI A;  2EUL A;  2IF4 A;  4MTV A;  1W9U A;  4JFL A;  1FFQ A;  3B7X A;  2RUQ A;  4LAY A;  4W5U A;  1ZL1 A;  1HKM A;  4L3N A;  4LAV A;  4DRK A;  1ITX A;  1E6R A;  2AWG A;  1FKL A;  1NWR A;  1ZB5 A;  1W9V A;  2DT3 A;  3ARW A;  4QIB A;  4ZPV R;  3CHD A;  1D6O A;  3JYM A;  3WQV A;  2LGO A;  3IK8 A;  1FD9 A;  3OOB A;  3RFW A;  3KAD A;  3B9A A;  3ARX A;  5HTG A;  1NWT A;  3UQI A;  1W9P A;  1FKJ A;  2K8I A;  4DZ3 A;  3KAC A;  1E44 A;  4JYS A;  3O5L A;  2M1I A;  4ZPW R;  3CGN A;  2ZR6 A;  3GTY X;  1YW5 A;  1QZ2 A;  4WIW A;  1IX5 A;  5HW7 A;  1R9H A;  4LAX A;  1FKS A;  1NMW A;  2DT0 A;  3B8S A;  3BXW A;  3UQA A;  4GGQ A;  1F40 A;  1D7H A;  1D7I A;  4DWS B;  3BMB A;  1LL7 A;  3PRB A;  2DSW A;  4O2T A;  1FFR A;  4ODM A;  4P8X A;  1OGB A;  3KAI A;  3OA5 A;  2F2D A;  2KE0 A;  3AS0 A;  1W26 A;  4DIP A;  4IPX A;  1FKH A;  2QF8 A;  1Q6U A;  4Q7N A;  2F21 A;  1FKB A;  3CHE A;  3O5M A;  4P8V A;  2DSV A;  2YBT A;  1FKF A;  2F4E A;  1GPF A;  1JND A;  2O9O A;  4MSP A;  4TW6 A;  2P4V A;  4MNL A;  2OLH A;  1JNS A;  2OFN A;  1GOI A;  1GUV A;  4L72 B;  2XP8 A;  4HBE A;  4ZS6 A;  2AOS A;  3TDB A;  1EQ3 A;  3PA7 A;  3NI6 A;  4IQC A;  1EHN A;  2MLZ A;  2PN0 A;  1W1Y A;  3GPK A;  2DSU A;  3I6C A;  4WK9 A;  2RSE A;  1W1P A;  3WH0 A;  1FKG A;  3O5K A;  3O5J A;  1E6N A;  2YBU A;  4Z2L A;  2B5U B;  4NZC A;  1J6Y A;  4S3K A;  1EIB A;  1C9H A;  4WKF A;  3CZ8 A;  1FKR A;  1HKI A;  4DH0 A;  4DWS C;  1Y0O A;  5HW6 A;  1W1V A;  3PR9 A;  3O5G A;  1WNO A;  2PV3 A;  3PRA A;  2PPN A;  4DZ2 A;  1NWS A;  1FKD A;  2VCD A;  2WK2 A;  4DWS A;  2FKE A;  4NSB A;  2PV2 A;  2KI3 A;  1X6L A;  4WJX A;  3WL1 A;  2XP6 A;  4ZPT R;  1JCH B;  1E6P A;  3IKG A;  4MGV A;  2ETN A;  1X6N A;  1ZBV A;  4P8W A;  3O5R A;  1FJD A;  3B9E A;  4FN2 A;  3UI5 A;  2KR7 A;  1HJV A;  3ALF A;  3RM4 A;  2ZR4 A;  3ARU A;  3AS3 A;  2MNT A;  1H0I A;  5DEZ A;  4TNS A;  3RME A;  2LPV A;  4FAP A;  2RUC A;  1BKF A;  4TW7 A;  3WD4 A;  4DRI A;  2F23 A;  3G6L A;  3EIP A;  3ARO A;  1E9L A;  1WAW A;  4MNK A;  4DT4 A;  1BL4 A;  4U85 A;  4Z2I A;  5BXJ A;  5B8I C;  2DG4 A;  1VF8 A;  4U84 A;  3KAG A;  2ITK A;  1KT0 A;  3G6M A;  2MPH A;  2DG3 A;  1JNE A;  5DIT A;  4DRQ A;  1TFV A;  4N19 A;  2A3E A;  1ZU8 A;  3TCZ A;  3UQB A;  1U79 A;  2ESC A;  3O5D A;  2KO7 A;  2WM0 A;  4ODN A;  3JXV A;  3KAH A;  1D2K A;  2XPA A;  4ODL A;  5HT1 A;  4JFK A;  1WB0 A;  4R5E A;  3KCE A;  2ZQS A;  4TYO A;  4GIV A;  3W4R A;  4HAR A;  1FKK A;  4Z2J A;  3KZ7 A;  1LQ0 A;  2UZ5 A;  1ZK6 A;  5DIU A;  2IUZ A;  4ODK A;  4UDM A;  4Z2G A;  1OGG A;  5GPG A;  2DG9 A;  4DRJ A;  5HW8 A;  4W9P A;  1KFW A;  4DRO A;  1ZCN A;  3FY1 A;  4ODO A;  2PPO A;  4S3J A;  3ARY A;  1EYM A;  1QPL A;  3WL0 A;  3KAF A;  4IT4 A;  4W9Q A;  1PIN A;  1PBK A;  1ZBW A;  3O5I A;  1GRJ A;  1K9T A;  2JZV A;  5D75 A;  1NMV A;  5DIV A;  1HXV A;  3H9R B;  1JVW A;  4JFM A;  3WKZ A;  2XP4 A;  1JNT A;  1J4I A;  4AY1 A;  3TC5 A;  3MDY B;  3ALG A;  4PTM A;  4QZV B;  2KGJ A;  5J6E A;  4IT6 A;  4U86 A;  3JYJ A;  1Q6H A;  3NRK A;  4TX0 A;  1J4H A;  3B9D A;  1NH6 A;  2FDM A;  3RM9 A;  2KFW A;  2A3A A;  4ODQ A;  3EY6 A;  3ARZ A;  1J4R A;  5GPR A;  1TCO C;  5HKG A;  2XP3 A;  3ODK A;  4G2P A;  1HJX A;  4J4O A;  2N87 A;  3ART A;  3CGM A;  2ZQV A;  1B6C A;  1KT1 A;  1O6I A;  1LL6 A;  2XP9 A;  4KR0 B;  2PI6 A;  2PPP A;  1HJW A;  3PRD A;  3ARQ A;  4ODR A;  2FAP A;  2MLX A;  4NNR A;  4R0X A;  2ZQT A;  1ROT A;  1ROU A; 
#chains in the Genus database with same CATH homology
 3O5E A;  3WD0 A;  1D7J A;  4MNM A;  1FKT A;  4ITZ A;  5HWB A;  5HWC A;  3O5Q A;  2Q5A A;  4LAW A;  3IKD A;  1XHG A;  1A7X A;  4MAV A;  5HBF A;  4WKA A;  1UR8 A;  1YAT A;  2XP5 A;  2XP7 A;  4KQZ A;  4MNJ A;  3AQU A;  4DRN A;  4J4N A;  1LG2 A;  2Y78 A;  2WLZ A;  3AS1 A;  5DO2 A;  3O5O A;  1SR0 A;  1EDQ A;  1LL4 A;  3WD3 A;  4JFJ A;  5GQB A;  3VAW A;  2D9F A;  2XPB A;  2LKN A;  2VN1 A;  1LG1 A;  3CHF A;  2PV1 A;  4C02 B;  4P8U A;  3CH9 A;  4Q22 A;  3UI6 A;  1UR9 A;  5HUA A;  2RUR A;  3FAP A;  4WKH A;  1M5Y A;  1Q6I A;  4QT2 A;  5DF0 A;  3WIJ A;  2WLY A;  2RQS A;  5I98 A;  1P5Q A;  2DT2 A;  2M08 A;  3WD1 A;  4MPK A;  2RUD A;  3FXY A;  1RD6 A;  2DSZ A;  4TW8 A;  1OWQ A;  1NSG A;  1E6Z A;  3KAB A;  1SYT A;  4DRH A;  4LGX A;  3ARV A;  1W1T A;  2O92 A;  2B31 A;  1QPF A;  2M2A A;  2L2S A;  1ZBC A;  1HKK A;  4QT3 A;  3LUO A;  1E15 A;  2MF9 A;  3WQW A;  4IQ2 A;  2DPE A;  4ODP A;  1HKJ A;  3QOK A;  3RGC A;  2G8Z A;  3O5F A;  2LJ4 A;  3ARP A;  1L1P A;  1T11 A;  1XRV A;  3IHZ A;  2A3C A;  4ML4 A;  4JFI A;  1LJY A;  4DRP A;  1FAP A;  4Z2H A;  4HBO A;  1H0G A;  2DT1 A;  1Q1C A;  2A3B A;  1NWU A;  1F8A B;  3WD2 A;  1CTN A;  4XAK A;  3RM8 A;  2ZQU A;  3UI4 A;  2ZR5 A;  2G41 A;  2MLY A;  4W9O A;  4DRM A;  4BF8 A;  4G50 A;  3O5P A;  4Z2K A;  4DWS D;  3ARR A;  3NTP A;  1ZBK A;  3ARS A;  1N1A A;  3CHC A;  5JH8 A;  2PBC A;  3AS2 A;  3UF8 A;  1FKI A;  4URI A;  2IF4 A;  4MTV A;  1W9U A;  4JFL A;  1FFQ A;  3B7X A;  2RUQ A;  4LAY A;  4W5U A;  1ZL1 A;  1HKM A;  4L3N A;  4LAV A;  4DRK A;  1ITX A;  1E6R A;  2AWG A;  1FKL A;  1NWR A;  1ZB5 A;  1W9V A;  2DT3 A;  3ARW A;  4QIB A;  4ZPV R;  3CHD A;  1D6O A;  3JYM A;  3WQV A;  2LGO A;  3IK8 A;  1FD9 A;  3OOB A;  3RFW A;  3KAD A;  3B9A A;  3ARX A;  5HTG A;  1NWT A;  3UQI A;  1W9P A;  1FKJ A;  2K8I A;  4DZ3 A;  3KAC A;  4JYS A;  3O5L A;  2M1I A;  4ZPW R;  3CGN A;  2ZR6 A;  1YW5 A;  1QZ2 A;  4WIW A;  1IX5 A;  5HW7 A;  1R9H A;  4LAX A;  1FKS A;  1NMW A;  2DT0 A;  3B8S A;  3BXW A;  3UQA A;  4GGQ A;  1F40 A;  1D7H A;  1D7I A;  4DWS B;  1LL7 A;  3PRB A;  2DSW A;  4O2T A;  1FFR A;  4ODM A;  4P8X A;  1OGB A;  3KAI A;  3OA5 A;  2F2D A;  2KE0 A;  3AS0 A;  1W26 A;  4DIP A;  4IPX A;  1FKH A;  2QF8 A;  1Q6U A;  4Q7N A;  2F21 A;  1FKB A;  3CHE A;  3O5M A;  4P8V A;  2DSV A;  2YBT A;  1FKF A;  2F4E A;  1GPF A;  1JND A;  2O9O A;  4MSP A;  4TW6 A;  4MNL A;  2OLH A;  1JNS A;  2OFN A;  1GOI A;  1GUV A;  4L72 B;  2XP8 A;  4HBE A;  4ZS6 A;  2AOS A;  3TDB A;  1EQ3 A;  3PA7 A;  3NI6 A;  4IQC A;  1EHN A;  2MLZ A;  1W1Y A;  3GPK A;  2DSU A;  3I6C A;  4WK9 A;  2RSE A;  1W1P A;  3WH0 A;  1FKG A;  3O5K A;  3O5J A;  1E6N A;  2YBU A;  4Z2L A;  4NZC A;  1J6Y A;  4S3K A;  1EIB A;  1C9H A;  4WKF A;  3CZ8 A;  1FKR A;  1HKI A;  4DH0 A;  4DWS C;  1Y0O A;  5HW6 A;  1W1V A;  3PR9 A;  3O5G A;  1WNO A;  2PV3 A;  3PRA A;  2PPN A;  4DZ2 A;  1NWS A;  1FKD A;  2VCD A;  2WK2 A;  4DWS A;  2FKE A;  4NSB A;  2PV2 A;  2KI3 A;  1X6L A;  4WJX A;  3WL1 A;  2XP6 A;  4ZPT R;  1E6P A;  3IKG A;  4MGV A;  1X6N A;  1ZBV A;  4P8W A;  3O5R A;  1FJD A;  3B9E A;  4FN2 A;  3UI5 A;  2KR7 A;  1HJV A;  3ALF A;  3RM4 A;  2ZR4 A;  3ARU A;  3AS3 A;  2MNT A;  1H0I A;  5DEZ A;  4TNS A;  3RME A;  2LPV A;  4FAP A;  2RUC A;  1BKF A;  4TW7 A;  3WD4 A;  4DRI A;  3G6L A;  3ARO A;  1E9L A;  1WAW A;  4MNK A;  4DT4 A;  1BL4 A;  4U85 A;  4Z2I A;  5BXJ A;  5B8I C;  2DG4 A;  1VF8 A;  4U84 A;  3KAG A;  2ITK A;  1KT0 A;  3G6M A;  2MPH A;  2DG3 A;  1JNE A;  5DIT A;  4DRQ A;  1TFV A;  4N19 A;  2A3E A;  1ZU8 A;  3TCZ A;  3UQB A;  1U79 A;  2ESC A;  3O5D A;  2KO7 A;  2WM0 A;  4ODN A;  3JXV A;  3KAH A;  1D2K A;  2XPA A;  4ODL A;  5HT1 A;  4JFK A;  1WB0 A;  4R5E A;  3KCE A;  2ZQS A;  4TYO A;  4GIV A;  3W4R A;  4HAR A;  1FKK A;  4Z2J A;  3KZ7 A;  1LQ0 A;  2UZ5 A;  1ZK6 A;  5DIU A;  2IUZ A;  4ODK A;  4Z2G A;  1OGG A;  5GPG A;  2DG9 A;  4DRJ A;  5HW8 A;  4W9P A;  1KFW A;  4DRO A;  1ZCN A;  3FY1 A;  4ODO A;  2PPO A;  4S3J A;  3ARY A;  1EYM A;  1QPL A;  3WL0 A;  3KAF A;  4IT4 A;  4W9Q A;  1PIN A;  1PBK A;  1ZBW A;  3O5I A;  1K9T A;  2JZV A;  5D75 A;  1NMV A;  5DIV A;  1HXV A;  3H9R B;  1JVW A;  4JFM A;  3WKZ A;  2XP4 A;  1JNT A;  1J4I A;  4AY1 A;  3TC5 A;  3MDY B;  3ALG A;  4PTM A;  4QZV B;  2KGJ A;  5J6E A;  4IT6 A;  4U86 A;  3JYJ A;  1Q6H A;  3NRK A;  4TX0 A;  1J4H A;  3B9D A;  1NH6 A;  2FDM A;  3RM9 A;  2KFW A;  2A3A A;  4ODQ A;  3EY6 A;  3ARZ A;  1J4R A;  5GPR A;  1TCO C;  5HKG A;  2XP3 A;  3ODK A;  4G2P A;  1HJX A;  4J4O A;  2N87 A;  3ART A;  3CGM A;  2ZQV A;  1B6C A;  1KT1 A;  1O6I A;  1LL6 A;  2XP9 A;  4KR0 B;  2PI6 A;  2PPP A;  1HJW A;  3PRD A;  3ARQ A;  4ODR A;  2FAP A;  2MLX A;  4NNR A;  4R0X A;  2ZQT A;  1ROT A;  1ROU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...