4FAPA

Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
107
structure length
107
Chain Sequence
b'GVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 26
structure length 107
sequence length 107
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 1999-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 4fapA00
2LPVA 4FAPA 2MNTA 2XP9A 3UQIA 4JFLA 4O2TA 2IF4A 4G50A 1D6OA 4ODLA 1NMVA 1JNSA 2D9FA 4FN2A 3O5LA 5J6EA 1QPFA 4DRJA 3O5PA 2LGOA 4ODMA 1Q6UA 3O5JA 1FKBA 2FKEA 1FAPA 3JXVA 2F4EA 3O5RA 2XP7A 1D7IA 3CGNA 4DRKA 2ZR6A 1D7JA 1P5QA 4LAWA 2PPOA 2MLYA 4ODRA 4TX0A 4TYOA 1Q6IA 3NRKA 1C9HA 4GGQA 5HUAA 1FJDA 3UQAA 5HWBA 2F21A 2KO7A 2LKNA 4J4NA 4MSPA 1J6YA 2XP6A 3O5KA 1NMWA 4TNSA 3B7XA 1A7XA 1KT1A 4TW6A 3LUOA 4TW7A 2MPHA 2XP4A 4W9PA 1B6CA 2VCDA 3KAHA 3ODKA 1W26A 4LAVA 2PV2A 3O5EA 3KAIA 2KFWA 4DRPA 4TW8A 2PPNA 3O5MA 1F8AB 3O5DA 3PA7A 3UI5A 2UZ5A 2KI3A 2Y78A 4DT4A 4IQCA 2ZR4A 1FKFA 1QZ2A 3IKDA 5HT1A 3KCEA 3JYMA 2ZQTA 4JYSA 2MLXA 3MDYB 2M2AA 3TCZA 3TDBA 5HW6A 3UF8A 2ITKA 2RSEA 3KZ7A 1FKTA 1Q6HA 3EY6A 3KADA 1JVWA 4W9QA 3UQBA 3CGMA 5HTGA 2FAPA 1FKIA 5DITA 2N87A 1EYMA 4G2PA 5DIVA 3KACA 1F40A 1FKKA 4JFKA 4R0XA 2PV1A 1T11A 3H9RB 4DRQA 3I6CA 1NSGA 2RQSA 3KAFA 3OOBA 3VAWA 1FKRA 4DRIA 3O5GA 4ODPA 4DZ3A 3PRDA 5DIUA 3IHZA 2PPPA 4ODOA 2DG3A 2RUCA 2JZVA 3FAPA 1FKSA 5HWCA 1JNTA 4BF8A 2LJ4A 3O5IA 1KT0A 2RURA 4LAYA 4N19A 1BKFA 1Y0OA 4ODNA 4DH0A 2DG4A 3IK8A 3IKGA 5HW7A 1J4RA 4C02B 1PBKA 4GIVA 1R9HA 1J4IA 1M5YA 2XP3A 4DRMA 3O5QA 1EQ3A 1YATA 4U86A 2ZQVA 2RUDA 4ODQA 4JFIA 1D7HA 1FKDA 2AWGA 2M08A 4QT2A 4U85A 2XPBA 4W9OA 1BL4A 4LAXA 5B8IC 4NNRA 2PV3A 2VN1A 1U79A 4DZ2A 2F2DA 1ROTA 2OFNA 2XP8A 2ZQUA 3NI6A 2XP5A 2KE0A 3PRBA 1FD9A 4QIBA 3RGCA 2ZR5A 3TC5A 2KGJA 4DROA 2MLZA 3UI4A 2L2SA 1N1AA 4ODKA 5HKGA 4DIPA 5HW8A 1HXVA 1Q1CA 5BXJA 2K8IA 3O5FA 2M1IA 1FKHA 3GPKA 4MGVA 4QT3A 1TCOC 4J4OA 3KABA 2MF9A 4JFJA 5GPGA 1FKGA 1FKLA 1QPLA 4IPXA 3UI6A 3RFWA 2XPAA 1PINA 1ZCNA 2RUQA 5I98A 4JFMA 2Q5AA 2KR7A 4IQ2A 4ITZA 4DRHA 1J4HA 1YW5A 1ZK6A 1ROUA 4U84A 4DRNA 3NTPA 1L1PA 3KAGA 5D75A 3O5OA 3JYJA 2DG9A 3WH0A 2PBCA 2ZQSA 1FKJA
chains in the Genus database with same CATH superfamily
1HJVA 2LPVA 4FAPA 2XP9A 4WJXA 1D6OA 1NMVA 1WAWA 4ZPVR 2LGOA 1Q6UA 1W1YA 3O5RA 2WLZA 3CGNA 4Z2KA 2ZR6A 1D7JA 2O92A 3PR9A 3AS0A 1Q6IA 5DF0A 3AS3A 5HWBA 4J4NA 1J6YA 1ZBVA 3ALGA 3G6MA 2WK2A 4Z2GA 2MPHA 1LG2A 2VCDA 3KAHA 2B31A 4LAVA 3O5EA 4URIA 4Z2IA 2O9OA 4TW8A 1F8AB 4NZCA 2DSZA 2M2AA 1ITXA 4KQZA 3TDBA 3UF8A 3FY1A 1JVWA 2PN0A 3UQBA 2FAPA 3CHCA 2DSUA 4G2PA 1NWTA 1F40A 1TFVA 1OGGA 2PV1A 1T11A 4DRQA 2RQSA 3VAWA 4DRIA 4HARA 4ODPA 3PRDA 1JCHB 1BKFA 4DH0A 2DG4A 1E44A 3IKGA 1PBKA 1E6ZA 4DWSD 1YATA 1VF8A 1HKJA 1W9VA 2AWGA 4W9OA 4NNRA 2VN1A 4W5UA 3PRBA 3TC5A 2XP5A 1ZU8A 3WKZA 3UI4A 2P4VA 4HBEA 1NWUA 5HW8A 3ARSA 1UR9A 1E9LA 4QT3A 3O5FA 2M1IA 1FKHA 4J4OA 2MF9A 1ZL1A 1FKLA 2XPAA 1ZCNA 2DT0A 2Q5AA 4ITZA 1J4HA 1ZK6A 5D75A 3G6LA 3JYJA 4DWSC 3UQIA 1LJYA 2DPEA 4P8XA 5J6EA 4DRJA 3O5PA 3O5JA 5HBFA 3ALFA 1EDQA 2B5UB 2F4EA 4PTMA 4MNMA 4LAWA 1P5QA 1XRVA 1W9UA 4ODRA 4TX0A 4TYOA 3NRKA 4S3KA 2OLHA 4GGQA 1FJDA 3ARPA 4DWSA 1GOIA 2F23A 1XHGA 2KO7A 4MSPA 4TW6A 4W9PA 1B6CA 1W26A 4Q22A 3KAIA 1SR0A 5GPRA 3PA7A 3UI5A 2UZ5A 2Y78A 5DO2A 1QZ2A 3IKDA 3UI6A 3KCEA 3JYMA 4JYSA 4WKAA 1RD6A 3WD4A 4MPKA 1E6PA 3WD0A 5DITA 1UR8A 4Z2LA 1EYMA 2IUZA 5DIVA 2DT1A 1FKKA 1H0GA 1EIBA 4HBOA 2PI6A 2JZVA 3WQWA 3AS2A 1LL4A 4MNLA 1HJWA 1GRJA 3CHDA 1J4RA 4C02B 4GIVA 1R9HA 3CZ8A 1M5YA 2AOSA 3O5QA 4U86A 2ZQVA 4JFIA 2M08A 3CH9A 3FXYA 2XPBA 3AROA 4U85A 3RM4A 1ZB5A 2PV3A 2F2DA 1NH6A 3NI6A 4QIBA 3RGCA 3ARWA 1O6IA 2MLZA 2L2SA 4WIWA 5HKGA 4WKFA 2YBUA 3RMEA 4L72B 1FFRA 5BXJA 2QF8A 1JNEA 4JFJA 2DT2A 1GUVA 4KR0B 1HKKA 4IQ2A 4DRHA 1NWSA 1ROUA 3BMBA 4DRNA 1L1PA 2PBCA 3H9RB 1FKJA 3WL0A 1FFQA 2MNTA 4JFLA 4O2TA 2IF4A 4G50A 1W9PA 1JNSA 2ESCA 4FN2A 1QPFA 4ODMA 4WKHA 3WD2A 3EIPA 2FKEA 3ARTA 3ARUA 3GTYX 2XP7A 1D7IA 3WD3A 2G41A 2MLYA 3B9DA 1H0IA 4S3JA 1OWQA 3WD1A 2WM0A 1C9HA 1KFWA 5HUAA 1SYTA 2LKNA 2XP6A 3O5KA 4TNSA 1ZBKA 3LUOA 4TW7A 4R5EA 3ODKA 2KFWA 4DRPA 2PPNA 3O5MA 2KI3A 2ZR4A 4ZPTR 5HT1A 3AS1A 2ZQTA 3TCZA 2G8ZA 3KZ7A 1FKTA 2DT3A 4MNJA 1W1PA 3ARZA 4ML4A 4R0XA 4JFKA 2EULA 3I6CA 1NSGA 3OOBA 1FKRA 3CHEA 3O5GA 1D2KA 4DZ3A 5DIUA 4ODOA 2PPPA 1FKSA 5HWCA 3OA5A 4BF8A 3O5IA 4ZPWR 1KT0A 4Q7NA 3GU0A 2A3AA 5HW7A 3ARRA 1EQ3A 1OGBA 1K9TA 1D7HA 4QT2A 1BL4A 4LAXA 4DZ2A 4WK9A 2OFNA 2ZQUA 4P8UA 1FD9A 1WNOA 2ZR5A 4L3NA 1N1AA 4IT6A 4ODKA 4QZVB 1Q1CA 1JNDA 3CHFA 2K8IA 3GPKA 4MGVA 3KABA 4IPXA 3RFWA 1PINA 2RUQA 5I98A 2KR7A 4AY1A 1YW5A 3KAGA 3O5OA 2A3EA 4NSBA 1LQ0A 4MAVA 1ZBCA 1E6RA 4ODLA 3ARQA 2D9FA 3O5LA 4DWSB 5JH8A 1FKBA 3ARVA 1FAPA 3JXVA 4ZS6A 4P8VA 4DRKA 2PPOA 3WIJA 3ARYA 3RM8A 2WLYA 3AQUA 4XAKA 3WQVA 3UQAA 2F21A 1EHNA 1W1VA 1NMWA 3B7XA 1CTNA 1A7XA 1KT1A 3ARXA 2XP4A 2PV2A 3B9AA 1WB0A 2DSVA 3O5DA 3PRAA 3BXWA 4DT4A 4IQCA 1FKFA 1HXVA 1W1TA 2MLXA 3MDYB 5HW6A 2ITKA 4UDMA 2RSEA 1LG1A 1Q6HA 3EY6A 3KADA 1LL6A 4W9QA 3CGMA 5HTGA 1FKIA 1IX5A 3QOKA 2N87A 3KACA 5GQBA 2ETNA 1GPFA 5DEZA 3KAFA 4LGXA 3B9EA 3IHZA 3RM9A 2DG3A 2RUCA 3FAPA 3WL1A 1JNTA 1HJXA 1E6NA 2LJ4A 2RURA 1X6NA 4LAYA 4MTVA 4N19A 1Y0OA 1E15A 4ODNA 2YBTA 1HKMA 3IK8A 1ZBWA 4Z2JA 1J4IA 2XP3A 4DRMA 4ODQA 2RUDA 1FKDA 4MNKA 5B8IC 1U79A 1ROTA 2FDMA 2XP8A 2KE0A 4Z2HA 4DROA 2DSWA 2KGJA 1X6LA 1NWRA 4DIPA 4P8WA 2A3BA 2A3CA 1TCOC 3W4RA 5GPGA 1FKGA 1LL7A 1QPLA 4JFMA 1HKIA 3B8SA 4U84A 3NTPA 3WH0A 2DG9A 4IT4A 2ZQSA
chains in the Genus database with same CATH topology
1HJVA 2LPVA 4FAPA 2XP9A 4WJXA 1D6OA 1NMVA 1WAWA 4ZPVR 2LGOA 1Q6UA 1W1YA 3O5RA 2WLZA 3CGNA 4Z2KA 2ZR6A 1D7JA 2O92A 3PR9A 3AS0A 1Q6IA 5DF0A 3AS3A 5HWBA 4J4NA 1J6YA 1ZBVA 3ALGA 3G6MA 2WK2A 4Z2GA 2MPHA 1LG2A 2VCDA 3KAHA 2B31A 4LAVA 3O5EA 4URIA 4Z2IA 2O9OA 4TW8A 1F8AB 4NZCA 2DSZA 2M2AA 1ITXA 4KQZA 3TDBA 3UF8A 3FY1A 1JVWA 3UQBA 2FAPA 3CHCA 2DSUA 4G2PA 1NWTA 1F40A 1TFVA 1OGGA 2PV1A 1T11A 4DRQA 2RQSA 3VAWA 4DRIA 4HARA 4ODPA 3PRDA 1BKFA 4DH0A 2DG4A 3IKGA 1PBKA 1E6ZA 4DWSD 1YATA 1VF8A 1HKJA 1W9VA 2AWGA 4W9OA 4NNRA 2VN1A 4W5UA 3PRBA 3TC5A 2XP5A 1ZU8A 3WKZA 3UI4A 4HBEA 1NWUA 5HW8A 3ARSA 1UR9A 1E9LA 4QT3A 3O5FA 2M1IA 1FKHA 4J4OA 2MF9A 1ZL1A 1FKLA 2XPAA 1ZCNA 2DT0A 2Q5AA 4ITZA 1J4HA 1ZK6A 5D75A 3G6LA 3JYJA 4DWSC 3UQIA 1LJYA 2DPEA 4P8XA 5J6EA 4DRJA 3O5PA 3O5JA 5HBFA 3ALFA 1EDQA 2F4EA 4PTMA 4MNMA 4LAWA 1P5QA 1XRVA 1W9UA 4ODRA 4TX0A 4TYOA 3NRKA 4S3KA 2OLHA 4GGQA 1FJDA 3ARPA 4DWSA 1GOIA 2KO7A 1XHGA 4MSPA 4TW6A 4W9PA 1B6CA 1W26A 4Q22A 3KAIA 1SR0A 5GPRA 3PA7A 3UI5A 2UZ5A 2Y78A 5DO2A 1QZ2A 3IKDA 3UI6A 3KCEA 3JYMA 4JYSA 4WKAA 1RD6A 3WD4A 4MPKA 1E6PA 3WD0A 5DITA 1UR8A 4Z2LA 1EYMA 2IUZA 5DIVA 2DT1A 1FKKA 1H0GA 1EIBA 4HBOA 2PI6A 2JZVA 3WQWA 3AS2A 1LL4A 4MNLA 1HJWA 3CHDA 1J4RA 4C02B 4GIVA 1R9HA 3CZ8A 1M5YA 2AOSA 3O5QA 4U86A 2ZQVA 4JFIA 2M08A 3CH9A 3FXYA 2XPBA 3AROA 4U85A 3RM4A 1ZB5A 2PV3A 2F2DA 1NH6A 3NI6A 4QIBA 3RGCA 3ARWA 1O6IA 2MLZA 2L2SA 4WIWA 5HKGA 4WKFA 2YBUA 3RMEA 4L72B 1FFRA 5BXJA 2QF8A 1JNEA 4JFJA 2DT2A 1GUVA 4KR0B 1HKKA 4IQ2A 4DRHA 1NWSA 1ROUA 4DRNA 1L1PA 2PBCA 3H9RB 1FKJA 3WL0A 1FFQA 2MNTA 4JFLA 4O2TA 2IF4A 4G50A 1W9PA 1JNSA 2ESCA 4FN2A 1QPFA 4ODMA 4WKHA 3WD2A 2FKEA 3ARTA 3ARUA 2XP7A 1D7IA 3WD3A 2G41A 2MLYA 3B9DA 1H0IA 4S3JA 1OWQA 3WD1A 2WM0A 1C9HA 1KFWA 5HUAA 1SYTA 2LKNA 2XP6A 3O5KA 4TNSA 1ZBKA 3LUOA 4TW7A 4R5EA 3ODKA 2KFWA 4DRPA 2PPNA 3O5MA 2KI3A 2ZR4A 4ZPTR 5HT1A 3AS1A 2ZQTA 3TCZA 2G8ZA 3KZ7A 1FKTA 2DT3A 4MNJA 1W1PA 3ARZA 4ML4A 4R0XA 4JFKA 3I6CA 1NSGA 3OOBA 1FKRA 3CHEA 3O5GA 1D2KA 4DZ3A 5DIUA 4ODOA 2PPPA 1FKSA 5HWCA 3OA5A 4BF8A 3O5IA 4ZPWR 1KT0A 4Q7NA 2A3AA 5HW7A 3ARRA 1EQ3A 1OGBA 1K9TA 1D7HA 4QT2A 1BL4A 4LAXA 4DZ2A 4WK9A 2OFNA 2ZQUA 4P8UA 1FD9A 1WNOA 2ZR5A 4L3NA 1N1AA 4IT6A 4ODKA 4QZVB 1Q1CA 1JNDA 3CHFA 2K8IA 3GPKA 4MGVA 3KABA 4IPXA 3RFWA 1PINA 2RUQA 5I98A 2KR7A 4AY1A 1YW5A 3KAGA 3O5OA 2A3EA 4NSBA 1LQ0A 4MAVA 1ZBCA 1E6RA 4ODLA 3ARQA 2D9FA 3O5LA 4DWSB 5JH8A 1FKBA 3ARVA 1FAPA 3JXVA 4ZS6A 4P8VA 4DRKA 2PPOA 3WIJA 3ARYA 3RM8A 2WLYA 3AQUA 4XAKA 3WQVA 3UQAA 2F21A 1EHNA 1W1VA 1NMWA 3B7XA 1CTNA 1A7XA 1KT1A 3ARXA 2XP4A 2PV2A 3B9AA 1WB0A 2DSVA 3O5DA 3PRAA 3BXWA 4DT4A 4IQCA 1FKFA 1HXVA 1W1TA 2MLXA 3MDYB 5HW6A 2ITKA 2RSEA 1LG1A 1Q6HA 3EY6A 3KADA 1LL6A 4W9QA 3CGMA 5HTGA 1FKIA 1IX5A 3QOKA 2N87A 3KACA 5GQBA 1GPFA 5DEZA 3KAFA 4LGXA 3B9EA 3IHZA 3RM9A 2DG3A 2RUCA 3FAPA 3WL1A 1JNTA 1HJXA 1E6NA 2LJ4A 2RURA 1X6NA 4LAYA 4MTVA 4N19A 1Y0OA 1E15A 4ODNA 2YBTA 1HKMA 3IK8A 1ZBWA 4Z2JA 1J4IA 2XP3A 4DRMA 4ODQA 2RUDA 1FKDA 4MNKA 5B8IC 1U79A 1ROTA 2FDMA 2XP8A 2KE0A 4Z2HA 4DROA 2DSWA 2KGJA 1X6LA 1NWRA 4DIPA 4P8WA 2A3BA 2A3CA 1TCOC 3W4RA 5GPGA 1FKGA 1LL7A 1QPLA 4JFMA 1HKIA 3B8SA 4U84A 3NTPA 3WH0A 2DG9A 4IT4A 2ZQSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LPV A;  4FAP A;  2MNT A;  2XP9 A;  3UQI A;  4JFL A;  4O2T A;  2IF4 A;  4G50 A;  1D6O A;  4ODL A;  1NMV A;  1JNS A;  2D9F A;  4FN2 A;  3O5L A;  5J6E A;  1QPF A;  4DRJ A;  3O5P A;  2LGO A;  4ODM A;  1Q6U A;  3O5J A;  1FKB A;  2FKE A;  1FAP A;  3JXV A;  2F4E A;  3O5R A;  2XP7 A;  1D7I A;  3CGN A;  4DRK A;  2ZR6 A;  1D7J A;  1P5Q A;  4LAW A;  2PPO A;  2MLY A;  4ODR A;  4TX0 A;  4TYO A;  1Q6I A;  3NRK A;  1C9H A;  4GGQ A;  5HUA A;  1FJD A;  3UQA A;  5HWB A;  2F21 A;  2KO7 A;  2LKN A;  4J4N A;  4MSP A;  1J6Y A;  2XP6 A;  3O5K A;  1NMW A;  4TNS A;  3B7X A;  1A7X A;  1KT1 A;  4TW6 A;  3LUO A;  4TW7 A;  2MPH A;  2XP4 A;  4W9P A;  1B6C A;  2VCD A;  3KAH A;  3ODK A;  1W26 A;  4LAV A;  2PV2 A;  3O5E A;  3KAI A;  2KFW A;  4DRP A;  4TW8 A;  2PPN A;  3O5M A;  1F8A B;  3O5D A;  3PA7 A;  3UI5 A;  2UZ5 A;  2KI3 A;  2Y78 A;  4DT4 A;  4IQC A;  2ZR4 A;  1FKF A;  1QZ2 A;  3IKD A;  5HT1 A;  3KCE A;  3JYM A;  2ZQT A;  4JYS A;  2MLX A;  3MDY B;  2M2A A;  3TCZ A;  3TDB A;  5HW6 A;  3UF8 A;  2ITK A;  2RSE A;  3KZ7 A;  1FKT A;  1Q6H A;  3EY6 A;  3KAD A;  1JVW A;  4W9Q A;  3UQB A;  3CGM A;  5HTG A;  2FAP A;  1FKI A;  5DIT A;  2N87 A;  1EYM A;  4G2P A;  5DIV A;  3KAC A;  1F40 A;  1FKK A;  4JFK A;  4R0X A;  2PV1 A;  1T11 A;  3H9R B;  4DRQ A;  3I6C A;  1NSG A;  2RQS A;  3KAF A;  3OOB A;  3VAW A;  1FKR A;  4DRI A;  3O5G A;  4ODP A;  4DZ3 A;  3PRD A;  5DIU A;  3IHZ A;  2PPP A;  4ODO A;  2DG3 A;  2RUC A;  2JZV A;  3FAP A;  1FKS A;  5HWC A;  1JNT A;  4BF8 A;  2LJ4 A;  3O5I A;  1KT0 A;  2RUR A;  4LAY A;  4N19 A;  1BKF A;  1Y0O A;  4ODN A;  4DH0 A;  2DG4 A;  3IK8 A;  3IKG A;  5HW7 A;  1J4R A;  4C02 B;  1PBK A;  4GIV A;  1R9H A;  1J4I A;  1M5Y A;  2XP3 A;  4DRM A;  3O5Q A;  1EQ3 A;  1YAT A;  4U86 A;  2ZQV A;  2RUD A;  4ODQ A;  4JFI A;  1D7H A;  1FKD A;  2AWG A;  2M08 A;  4QT2 A;  4U85 A;  2XPB A;  4W9O A;  1BL4 A;  4LAX A;  5B8I C;  4NNR A;  2PV3 A;  2VN1 A;  1U79 A;  4DZ2 A;  2F2D A;  1ROT A;  2OFN A;  2XP8 A;  2ZQU A;  3NI6 A;  2XP5 A;  2KE0 A;  3PRB A;  1FD9 A;  4QIB A;  3RGC A;  2ZR5 A;  3TC5 A;  2KGJ A;  4DRO A;  2MLZ A;  3UI4 A;  2L2S A;  1N1A A;  4ODK A;  5HKG A;  4DIP A;  5HW8 A;  1HXV A;  1Q1C A;  5BXJ A;  2K8I A;  3O5F A;  2M1I A;  1FKH A;  3GPK A;  4MGV A;  4QT3 A;  1TCO C;  4J4O A;  3KAB A;  2MF9 A;  4JFJ A;  5GPG A;  1FKG A;  1FKL A;  1QPL A;  4IPX A;  3UI6 A;  3RFW A;  2XPA A;  1PIN A;  1ZCN A;  2RUQ A;  5I98 A;  4JFM A;  2Q5A A;  2KR7 A;  4IQ2 A;  4ITZ A;  4DRH A;  1J4H A;  1YW5 A;  1ZK6 A;  1ROU A;  4U84 A;  4DRN A;  3NTP A;  1L1P A;  3KAG A;  5D75 A;  3O5O A;  3JYJ A;  2DG9 A;  3WH0 A;  2PBC A;  2ZQS A;  1FKJ A; 
#chains in the Genus database with same CATH topology
 1HJV A;  2LPV A;  4FAP A;  2XP9 A;  4WJX A;  1D6O A;  1NMV A;  1WAW A;  4ZPV R;  2LGO A;  1Q6U A;  1W1Y A;  3O5R A;  2WLZ A;  3CGN A;  4Z2K A;  2ZR6 A;  1D7J A;  2O92 A;  3PR9 A;  3AS0 A;  1Q6I A;  5DF0 A;  3AS3 A;  5HWB A;  4J4N A;  1J6Y A;  1ZBV A;  3ALG A;  3G6M A;  2WK2 A;  4Z2G A;  2MPH A;  1LG2 A;  2VCD A;  3KAH A;  2B31 A;  4LAV A;  3O5E A;  4URI A;  4Z2I A;  2O9O A;  4TW8 A;  1F8A B;  4NZC A;  2DSZ A;  2M2A A;  1ITX A;  4KQZ A;  3TDB A;  3UF8 A;  3FY1 A;  1JVW A;  2PN0 A;  3UQB A;  2FAP A;  3CHC A;  2DSU A;  4G2P A;  1NWT A;  1F40 A;  1TFV A;  1OGG A;  2PV1 A;  1T11 A;  4DRQ A;  2RQS A;  3VAW A;  4DRI A;  4HAR A;  4ODP A;  3PRD A;  1JCH B;  1BKF A;  4DH0 A;  2DG4 A;  1E44 A;  3IKG A;  1PBK A;  1E6Z A;  4DWS D;  1YAT A;  1VF8 A;  1HKJ A;  1W9V A;  2AWG A;  4W9O A;  4NNR A;  2VN1 A;  4W5U A;  3PRB A;  3TC5 A;  2XP5 A;  1ZU8 A;  3WKZ A;  3UI4 A;  2P4V A;  4HBE A;  1NWU A;  5HW8 A;  3ARS A;  1UR9 A;  1E9L A;  4QT3 A;  3O5F A;  2M1I A;  1FKH A;  4J4O A;  2MF9 A;  1ZL1 A;  1FKL A;  2XPA A;  1ZCN A;  2DT0 A;  2Q5A A;  4ITZ A;  1J4H A;  1ZK6 A;  5D75 A;  3G6L A;  3JYJ A;  4DWS C;  3UQI A;  1LJY A;  2DPE A;  4P8X A;  5J6E A;  4DRJ A;  3O5P A;  3O5J A;  5HBF A;  3ALF A;  1EDQ A;  2B5U B;  2F4E A;  4PTM A;  4MNM A;  4LAW A;  1P5Q A;  1XRV A;  1W9U A;  4ODR A;  4TX0 A;  4TYO A;  3NRK A;  4S3K A;  2OLH A;  4GGQ A;  1FJD A;  3ARP A;  4DWS A;  1GOI A;  2F23 A;  1XHG A;  2KO7 A;  4MSP A;  4TW6 A;  4W9P A;  1B6C A;  1W26 A;  4Q22 A;  3KAI A;  1SR0 A;  5GPR A;  3PA7 A;  3UI5 A;  2UZ5 A;  2Y78 A;  5DO2 A;  1QZ2 A;  3IKD A;  3UI6 A;  3KCE A;  3JYM A;  4JYS A;  4WKA A;  1RD6 A;  3WD4 A;  4MPK A;  1E6P A;  3WD0 A;  5DIT A;  1UR8 A;  4Z2L A;  1EYM A;  2IUZ A;  5DIV A;  2DT1 A;  1FKK A;  1H0G A;  1EIB A;  4HBO A;  2PI6 A;  2JZV A;  3WQW A;  3AS2 A;  1LL4 A;  4MNL A;  1HJW A;  1GRJ A;  3CHD A;  1J4R A;  4C02 B;  4GIV A;  1R9H A;  3CZ8 A;  1M5Y A;  2AOS A;  3O5Q A;  4U86 A;  2ZQV A;  4JFI A;  2M08 A;  3CH9 A;  3FXY A;  2XPB A;  3ARO A;  4U85 A;  3RM4 A;  1ZB5 A;  2PV3 A;  2F2D A;  1NH6 A;  3NI6 A;  4QIB A;  3RGC A;  3ARW A;  1O6I A;  2MLZ A;  2L2S A;  4WIW A;  5HKG A;  4WKF A;  2YBU A;  3RME A;  4L72 B;  1FFR A;  5BXJ A;  2QF8 A;  1JNE A;  4JFJ A;  2DT2 A;  1GUV A;  4KR0 B;  1HKK A;  4IQ2 A;  4DRH A;  1NWS A;  1ROU A;  3BMB A;  4DRN A;  1L1P A;  2PBC A;  3H9R B;  1FKJ A;  3WL0 A;  1FFQ A;  2MNT A;  4JFL A;  4O2T A;  2IF4 A;  4G50 A;  1W9P A;  1JNS A;  2ESC A;  4FN2 A;  1QPF A;  4ODM A;  4WKH A;  3WD2 A;  3EIP A;  2FKE A;  3ART A;  3ARU A;  3GTY X;  2XP7 A;  1D7I A;  3WD3 A;  2G41 A;  2MLY A;  3B9D A;  1H0I A;  4S3J A;  1OWQ A;  3WD1 A;  2WM0 A;  1C9H A;  1KFW A;  5HUA A;  1SYT A;  2LKN A;  2XP6 A;  3O5K A;  4TNS A;  1ZBK A;  3LUO A;  4TW7 A;  4R5E A;  3ODK A;  2KFW A;  4DRP A;  2PPN A;  3O5M A;  2KI3 A;  2ZR4 A;  4ZPT R;  5HT1 A;  3AS1 A;  2ZQT A;  3TCZ A;  2G8Z A;  3KZ7 A;  1FKT A;  2DT3 A;  4MNJ A;  1W1P A;  3ARZ A;  4ML4 A;  4R0X A;  4JFK A;  2EUL A;  3I6C A;  1NSG A;  3OOB A;  1FKR A;  3CHE A;  3O5G A;  1D2K A;  4DZ3 A;  5DIU A;  4ODO A;  2PPP A;  1FKS A;  5HWC A;  3OA5 A;  4BF8 A;  3O5I A;  4ZPW R;  1KT0 A;  4Q7N A;  3GU0 A;  2A3A A;  5HW7 A;  3ARR A;  1EQ3 A;  1OGB A;  1K9T A;  1D7H A;  4QT2 A;  1BL4 A;  4LAX A;  4DZ2 A;  4WK9 A;  2OFN A;  2ZQU A;  4P8U A;  1FD9 A;  1WNO A;  2ZR5 A;  4L3N A;  1N1A A;  4IT6 A;  4ODK A;  4QZV B;  1Q1C A;  1JND A;  3CHF A;  2K8I A;  3GPK A;  4MGV A;  3KAB A;  4IPX A;  3RFW A;  1PIN A;  2RUQ A;  5I98 A;  2KR7 A;  4AY1 A;  1YW5 A;  3KAG A;  3O5O A;  2A3E A;  4NSB A;  1LQ0 A;  4MAV A;  1ZBC A;  1E6R A;  4ODL A;  3ARQ A;  2D9F A;  3O5L A;  4DWS B;  5JH8 A;  1FKB A;  3ARV A;  1FAP A;  3JXV A;  4ZS6 A;  4P8V A;  4DRK A;  2PPO A;  3WIJ A;  3ARY A;  3RM8 A;  2WLY A;  3AQU A;  4XAK A;  3WQV A;  3UQA A;  2F21 A;  1EHN A;  1W1V A;  1NMW A;  3B7X A;  1CTN A;  1A7X A;  1KT1 A;  3ARX A;  2XP4 A;  2PV2 A;  3B9A A;  1WB0 A;  2DSV A;  3O5D A;  3PRA A;  3BXW A;  4DT4 A;  4IQC A;  1FKF A;  1HXV A;  1W1T A;  2MLX A;  3MDY B;  5HW6 A;  2ITK A;  4UDM A;  2RSE A;  1LG1 A;  1Q6H A;  3EY6 A;  3KAD A;  1LL6 A;  4W9Q A;  3CGM A;  5HTG A;  1FKI A;  1IX5 A;  3QOK A;  2N87 A;  3KAC A;  5GQB A;  2ETN A;  1GPF A;  5DEZ A;  3KAF A;  4LGX A;  3B9E A;  3IHZ A;  3RM9 A;  2DG3 A;  2RUC A;  3FAP A;  3WL1 A;  1JNT A;  1HJX A;  1E6N A;  2LJ4 A;  2RUR A;  1X6N A;  4LAY A;  4MTV A;  4N19 A;  1Y0O A;  1E15 A;  4ODN A;  2YBT A;  1HKM A;  3IK8 A;  1ZBW A;  4Z2J A;  1J4I A;  2XP3 A;  4DRM A;  4ODQ A;  2RUD A;  1FKD A;  4MNK A;  5B8I C;  1U79 A;  1ROT A;  2FDM A;  2XP8 A;  2KE0 A;  4Z2H A;  4DRO A;  2DSW A;  2KGJ A;  1X6L A;  1NWR A;  4DIP A;  4P8W A;  2A3B A;  2A3C A;  1TCO C;  3W4R A;  5GPG A;  1FKG A;  1LL7 A;  1QPL A;  4JFM A;  1HKI A;  3B8S A;  4U84 A;  3NTP A;  3WH0 A;  2DG9 A;  4IT4 A;  2ZQS A; 
#chains in the Genus database with same CATH homology
 1HJV A;  2LPV A;  4FAP A;  2XP9 A;  4WJX A;  1D6O A;  1NMV A;  1WAW A;  4ZPV R;  2LGO A;  1Q6U A;  1W1Y A;  3O5R A;  2WLZ A;  3CGN A;  4Z2K A;  2ZR6 A;  1D7J A;  2O92 A;  3PR9 A;  3AS0 A;  1Q6I A;  5DF0 A;  3AS3 A;  5HWB A;  4J4N A;  1J6Y A;  1ZBV A;  3ALG A;  3G6M A;  2WK2 A;  4Z2G A;  2MPH A;  1LG2 A;  2VCD A;  3KAH A;  2B31 A;  4LAV A;  3O5E A;  4URI A;  4Z2I A;  2O9O A;  4TW8 A;  1F8A B;  4NZC A;  2DSZ A;  2M2A A;  1ITX A;  4KQZ A;  3TDB A;  3UF8 A;  3FY1 A;  1JVW A;  3UQB A;  2FAP A;  3CHC A;  2DSU A;  4G2P A;  1NWT A;  1F40 A;  1TFV A;  1OGG A;  2PV1 A;  1T11 A;  4DRQ A;  2RQS A;  3VAW A;  4DRI A;  4HAR A;  4ODP A;  3PRD A;  1BKF A;  4DH0 A;  2DG4 A;  3IKG A;  1PBK A;  1E6Z A;  4DWS D;  1YAT A;  1VF8 A;  1HKJ A;  1W9V A;  2AWG A;  4W9O A;  4NNR A;  2VN1 A;  4W5U A;  3PRB A;  3TC5 A;  2XP5 A;  1ZU8 A;  3WKZ A;  3UI4 A;  4HBE A;  1NWU A;  5HW8 A;  3ARS A;  1UR9 A;  1E9L A;  4QT3 A;  3O5F A;  2M1I A;  1FKH A;  4J4O A;  2MF9 A;  1ZL1 A;  1FKL A;  2XPA A;  1ZCN A;  2DT0 A;  2Q5A A;  4ITZ A;  1J4H A;  1ZK6 A;  5D75 A;  3G6L A;  3JYJ A;  4DWS C;  3UQI A;  1LJY A;  2DPE A;  4P8X A;  5J6E A;  4DRJ A;  3O5P A;  3O5J A;  5HBF A;  3ALF A;  1EDQ A;  2F4E A;  4PTM A;  4MNM A;  4LAW A;  1P5Q A;  1XRV A;  1W9U A;  4ODR A;  4TX0 A;  4TYO A;  3NRK A;  4S3K A;  2OLH A;  4GGQ A;  1FJD A;  3ARP A;  4DWS A;  1GOI A;  2KO7 A;  1XHG A;  4MSP A;  4TW6 A;  4W9P A;  1B6C A;  1W26 A;  4Q22 A;  3KAI A;  1SR0 A;  5GPR A;  3PA7 A;  3UI5 A;  2UZ5 A;  2Y78 A;  5DO2 A;  1QZ2 A;  3IKD A;  3UI6 A;  3KCE A;  3JYM A;  4JYS A;  4WKA A;  1RD6 A;  3WD4 A;  4MPK A;  1E6P A;  3WD0 A;  5DIT A;  1UR8 A;  4Z2L A;  1EYM A;  2IUZ A;  5DIV A;  2DT1 A;  1FKK A;  1H0G A;  1EIB A;  4HBO A;  2PI6 A;  2JZV A;  3WQW A;  3AS2 A;  1LL4 A;  4MNL A;  1HJW A;  3CHD A;  1J4R A;  4C02 B;  4GIV A;  1R9H A;  3CZ8 A;  1M5Y A;  2AOS A;  3O5Q A;  4U86 A;  2ZQV A;  4JFI A;  2M08 A;  3CH9 A;  3FXY A;  2XPB A;  3ARO A;  4U85 A;  3RM4 A;  1ZB5 A;  2PV3 A;  2F2D A;  1NH6 A;  3NI6 A;  4QIB A;  3RGC A;  3ARW A;  1O6I A;  2MLZ A;  2L2S A;  4WIW A;  5HKG A;  4WKF A;  2YBU A;  3RME A;  4L72 B;  1FFR A;  5BXJ A;  2QF8 A;  1JNE A;  4JFJ A;  2DT2 A;  1GUV A;  4KR0 B;  1HKK A;  4IQ2 A;  4DRH A;  1NWS A;  1ROU A;  4DRN A;  1L1P A;  2PBC A;  3H9R B;  1FKJ A;  3WL0 A;  1FFQ A;  2MNT A;  4JFL A;  4O2T A;  2IF4 A;  4G50 A;  1W9P A;  1JNS A;  2ESC A;  4FN2 A;  1QPF A;  4ODM A;  4WKH A;  3WD2 A;  2FKE A;  3ART A;  3ARU A;  2XP7 A;  1D7I A;  3WD3 A;  2G41 A;  2MLY A;  3B9D A;  1H0I A;  4S3J A;  1OWQ A;  3WD1 A;  2WM0 A;  1C9H A;  1KFW A;  5HUA A;  1SYT A;  2LKN A;  2XP6 A;  3O5K A;  4TNS A;  1ZBK A;  3LUO A;  4TW7 A;  4R5E A;  3ODK A;  2KFW A;  4DRP A;  2PPN A;  3O5M A;  2KI3 A;  2ZR4 A;  4ZPT R;  5HT1 A;  3AS1 A;  2ZQT A;  3TCZ A;  2G8Z A;  3KZ7 A;  1FKT A;  2DT3 A;  4MNJ A;  1W1P A;  3ARZ A;  4ML4 A;  4R0X A;  4JFK A;  3I6C A;  1NSG A;  3OOB A;  1FKR A;  3CHE A;  3O5G A;  1D2K A;  4DZ3 A;  5DIU A;  4ODO A;  2PPP A;  1FKS A;  5HWC A;  3OA5 A;  4BF8 A;  3O5I A;  4ZPW R;  1KT0 A;  4Q7N A;  2A3A A;  5HW7 A;  3ARR A;  1EQ3 A;  1OGB A;  1K9T A;  1D7H A;  4QT2 A;  1BL4 A;  4LAX A;  4DZ2 A;  4WK9 A;  2OFN A;  2ZQU A;  4P8U A;  1FD9 A;  1WNO A;  2ZR5 A;  4L3N A;  1N1A A;  4IT6 A;  4ODK A;  4QZV B;  1Q1C A;  1JND A;  3CHF A;  2K8I A;  3GPK A;  4MGV A;  3KAB A;  4IPX A;  3RFW A;  1PIN A;  2RUQ A;  5I98 A;  2KR7 A;  4AY1 A;  1YW5 A;  3KAG A;  3O5O A;  2A3E A;  4NSB A;  1LQ0 A;  4MAV A;  1ZBC A;  1E6R A;  4ODL A;  3ARQ A;  2D9F A;  3O5L A;  4DWS B;  5JH8 A;  1FKB A;  3ARV A;  1FAP A;  3JXV A;  4ZS6 A;  4P8V A;  4DRK A;  2PPO A;  3WIJ A;  3ARY A;  3RM8 A;  2WLY A;  3AQU A;  4XAK A;  3WQV A;  3UQA A;  2F21 A;  1EHN A;  1W1V A;  1NMW A;  3B7X A;  1CTN A;  1A7X A;  1KT1 A;  3ARX A;  2XP4 A;  2PV2 A;  3B9A A;  1WB0 A;  2DSV A;  3O5D A;  3PRA A;  3BXW A;  4DT4 A;  4IQC A;  1FKF A;  1HXV A;  1W1T A;  2MLX A;  3MDY B;  5HW6 A;  2ITK A;  2RSE A;  1LG1 A;  1Q6H A;  3EY6 A;  3KAD A;  1LL6 A;  4W9Q A;  3CGM A;  5HTG A;  1FKI A;  1IX5 A;  3QOK A;  2N87 A;  3KAC A;  5GQB A;  1GPF A;  5DEZ A;  3KAF A;  4LGX A;  3B9E A;  3IHZ A;  3RM9 A;  2DG3 A;  2RUC A;  3FAP A;  3WL1 A;  1JNT A;  1HJX A;  1E6N A;  2LJ4 A;  2RUR A;  1X6N A;  4LAY A;  4MTV A;  4N19 A;  1Y0O A;  1E15 A;  4ODN A;  2YBT A;  1HKM A;  3IK8 A;  1ZBW A;  4Z2J A;  1J4I A;  2XP3 A;  4DRM A;  4ODQ A;  2RUD A;  1FKD A;  4MNK A;  5B8I C;  1U79 A;  1ROT A;  2FDM A;  2XP8 A;  2KE0 A;  4Z2H A;  4DRO A;  2DSW A;  2KGJ A;  1X6L A;  1NWR A;  4DIP A;  4P8W A;  2A3B A;  2A3C A;  1TCO C;  3W4R A;  5GPG A;  1FKG A;  1LL7 A;  1QPL A;  4JFM A;  1HKI A;  3B8S A;  4U84 A;  3NTP A;  3WH0 A;  2DG9 A;  4IT4 A;  2ZQS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...