4FAPB

Atomic structures of the rapamycin analogs in complex with both human fkbp12 and frb domain of frap
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
94
structure length
94
Chain Sequence
VAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFRRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FK506-BINDING PROTEIN
publication title Refined structure of the FKBP12-rapamycin-FRB ternary complex at 2.2 A resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 38
structure length 94
sequence length 94
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 1999-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.150 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) FKBP12-rapamycin binding domain 4fapB00
2FAPB 5GPGB 2RSEB 4DRIB 1AUEA 4FAPB 1FAPB 4DRHB 4DRJB 2NPUA 3FAPB 1NSGB 2GAQA
chains in the Genus database with same CATH superfamily
2NUPB 1L3PA 4PK4A 4AL1A 1YAUO 3C18A 4J7YA 3S90A 2CNWD 3FAJA 1T5OA 1VOMA 2IM8A 2CNWA 2NUPA 4DBQA 3HNLA 3GEEA 1HMDA 1O87A 3EHNA 1MMGA 4M63A 4CDYA 3KKBA 5COGA 4KI2A 3Q6MA 3G50A 4ER9A 4WGZA 1SZIA 5L0FA 1W2WA 1N1CA 2JX0A 4XEFA 2CDQA 2W4MA 4NQFA 3VF0A 4JZAA 2AWCA 2KYHA 2Y3HA 4CDAA 2EIMC 2QNLA 2PX0A 2MYSA 3O39A 5E3AA 2R7RA 4YK5A 2HZ8A 1A7EA 3SEOA 2FFHA 2XLVA 4W8KA 3KL4A 4LDRA 1A7DA 5COMA 1MMAA 1Y4CA 2DI3A 2LP4A 2NSFA 2J9BA 3ASOC 3U8PA 3DZAA 5AC5A 1D1CA 1KNYA 3ZQVA 5K0IA 1LPEA 2JD3A 4JTCB 2XL6A 1FR0A 2EPLX 3ABLC 3U9MA 1OR2A 3NYJA 3ABMC 3NKDA 3LNMB 2M64A 4G0HA 3SNHA 4CBEA 4OIRF 4L6RA 5DS6A 3UGPA 3ZQYA 4YT2A 2XRHA 4MTGA 3RKOF 1OCZC 3WHNA 3LS0A 3IQ6A 3QVYA 4K1OA 2XLHA 3VRCA 3PMRA 2YQYA 256BA 1QKRA 1RKCA 3PCVA 3LJBA 3IQCA 3JCUQ 1OXKA 4U5EE 3BEHA 3SXKA 4DBRA 2HV7A 2P61A 3CAXA 2W9YA 3FHDA 1YJGA 4BJ5A 3FOOA 2NG1A 2KSFA 5DQTA 5DS5A 3EGXB 4MTFA 1FMVA 2CCYA 2EINC 2J9UA 5A6BD 1FFHA 4BJ1A 4U5FE 4AK9A 5HSWA 1C17M 5A6BA 4XEVA 2P1AA 2Q9AA 1DOWA 1V4AA 2V26A 3SYNA 2OJED 3KYIA 3B0VC 2J46A 4G7ZF 3S0XA 1Q0FA 3EGXA 4MW8A 2P0NA 3GANA 4U5DE 3SZRA 2DB4A 3EH2A 2RSEB 3UMKA 1ZYRF 1EA8A 4EIYA 3UGOA 3DAGA 3TD7A 3TQOA 3U2LA 4F4BA 4CIHA 1LE2A 3UMHA 1C02A 1UFBA 1YDIA 2R7TA 3Q7LA 4JJGA 4P9TA 1M57C 3KMIA 5JUAA 4ONSA 3JSEO 4EWCA 4IB4A 1VK5A 1VLTA 5JT4A 3HNIA 4DRIB 3JZ0A 4LLEA 3RH3A 1E84A 1JPNA 2NSGA 3S84A 4K7BA 3F46A 1SF8A 2LD6A 2XSEA 3Q7GA 5E2QA 5F5HA 5BQHA 1D1AA 2ETSA 2EPKX 2HMQA 2VCAA 1IW7F 3NMKA 3LAYA 3IEEA 4HEAJ 4K0DA 4XLNF 3K1IA 4WJ0A 3EQLF 1Z7Qc 2JPUA 3AGUA 1D0ZA 2OG2A 4LLCA 2D5RB 1YLMA 3MFNA 2F22A 4O7GA 1T9KA 2QUPA 4A4AA 4UDVA 2EPOA 2V3CC 1B68A 1SYQA 1YYXA 3DAFA 1Z5ZA 2CW0F 3EFOA 5A6JA 2A1DD 4FX5A 3DI5A 4MNDA 1YZAA 1BDJB 2UUIA 4OD5A 5IY5C 2VCCA 2XLDA 4MVRA 4YT4A 2HJ3A 3EGDB 5KYWB 4QI2A 2A68F 2P6VA 3NMJA 4JCZA 2OKUA 1XZQA 4R32A 4NCQA 2J7PA 2OOCA 2VB6A 3ECSA 2ZD9A 4JRZA 1ZU4A 3EHMA 1VLSA 2GFHA 1T6IA 3EGDA 4H4KC 2YLGA 5KYWA 3ITFA 1E2XA 2GA0A 2TMVP 1TWAA 3N0TA 4P9FA 2VASA 4NTBA 1LS1A 4BEMJ 4DJ9A 1EQ1A 2WL8A 1FFTC 4OIOF 2A0BA 3T6JA 4Z9JA 1Q0GA 4CS7A 1UG7A 1VB5A 2C04A 2HUJA 3S27A 3O10A 4AX2A 3A11A 3L0IA 3TULA 2KQ9A 1VYKA 3NG1A 3V5XA 3ZVRA 4JEAA 3CZ6A 1AVOB 1LKXA 1TFKB 1WGWA 1V54C 2HSQA 3H2VA 4EHPA 5A6KA 5L0GA 1MQVA 3PHF2 3G4XA 2FAPB 2QE9A 3U5SA 1RJ9B 2XS8A 2EILC 4CS8A 4PJNA 2W45A 2WZGA 2EIJC 3RQFA 1RXQA 2NPUA 1LVKA 2BE5F 2R7UA 4O6MA 3Q6NA 4J30B 4ZLCA 4U5BE 4MVUA 5DLJA 2KJGA 1LE4A 2H7OA 3DM9B 2R05A 4ULVA 1RJ9A 1D0YA 4XPYA 4ANJA 1JR8A 4Z9IA 3M4BA 3QVZA 3ABKC 4JW1A 3LEOA 4QI0A 5B1AC 4CX9A 4WABA 3SP1A 4KBLA 3RVYA 4JTAB 3W2VA 4G7OF 2Y3GA 5CIVA 2HS5A 3LEVA 3POVA 3NRHA 4RDAA 3DJUB 4BJTA 3T9OA 1JRAA 4JJFA 2HSBA 1HE1A 3DD7A 2Q9BA 1M2OA 1KU2A 3C8GD 1LM3B 1XZPA 1ZHWA 5A6AA 2YL7A 3E70C 1QQ3A 1GGQA 1ORYA 4YT5A 2R7OA 3UMIA 1LI7A 1H7IA 1BR1A 1NG1A 4IGGA 3O55A 1KTMA 2LK4A 2YL0A 1OKKD 4PFPA 1QSPA 1TQGA 4FESA 2XLMA 4MS2A 1G4US 2LFFA 5L0IA 2QY9A 2J0XA 2KNHA 1Z6AA 3K1HA 3ZIBA 4DVZA 1H9GA 2PBEA 1TWCA 3GWLA 5L0CA 2R7SA 2A69F 2ZPAA 5B3SC 5JS5A 5B3IA 1CGME 3HNJA 2L6FA 1O5HA 4Q7CA 5AC4A 1TWGA 3DE9A 5GPGB 2AWYA 3F47A 3HNKA 4HFFB 1VMAA 2MHRA 2AU5A 4J32B 4U5GA 3JRMO 1FAPB 1HE9A 4YL0A 4GQHA 4GYTA 3MYFA 1J8YF 3I5PA 3IHUA 3U3FA 4I3MA 5CI8A 5DVWA 5FZTA 1WN0A 3T6BA 1A41A 3EZHA 4CSAA 2GWWA 2W4BA 4JKVA 4EBBA 2KC3A 2KK1A 3C8ZA 4MVSA 4E0IA 5KYUB 3J06A 4MVOA 1CGOA 3GM1A 4FAPB 1ST6A 1NU9C 3IPMO 4RBNA 1WWPA 2UUHA 3VYWA 4N6HA 4IJJA 3WODF 5KYUA 3NYLA 2Q4FA 1D0XA 5JLIA 1FNTc 1YVIA 1Z23A 1T6QA 1QLEC 2R02A 2BC5A 1TKNA 2PFDA 3C62A 3VM6A 3A9CA 1RCPA 2L7AA 4BJ5C 3ZSUA 4E7SA 5DS4A 5L0JA 1I5NA 3HTKC 5A69A 1MNEA 4BG0A 4JC7A 2DYRC 1K04A 1E85A 5L0HA 3QTHA 3M4CA 2EIKC 1G8XA 3B0UX 4JCHA 3NKEA 4O79A 2AP3A 3RVZA 3SXZA 3GEHA 1Z3IX 3MX3A 2XM0A 4FWVA 4CJGA 5L3QA 1U0BB 3L34A 2OCCC 4I1MA 2YVKA 3E9VA 3EH1A 3EFOB 5BQIA 5L0DA 3V5YA 2DYSC 4E18A 3EG9B 3QW0A 4JIOA 2OU6A 4N6CA 3GM3A 3NMIA 2PF4E 3R7CA 3DM5A 2CGEA 1S7ZA 1FTSA 1WASA 4PJLA 2G62A 1U6HA 1BBHA 1U89A 2IBFA 4RD9A 3AOUA 1BR2A 3EG9A 1ZU5A 3MYIA 5COFA 4C3DA 4NC3A 4O6NA 4OIPF 1WATA 3K1IC 2WZFA 4U5CE 1TR2A 2LSEA 3ZTZA 2YLIA 2ICWG 3JRTA 4PR9A 3TOLA 3B71A 3ZTMA 2L81A 3DWWA 3G4ZA 4OD4A 1SR2A 2QTVA 5F5FA 3U3BA 4EBKA 3H2UA 3ZG1A 2ZXPA 4J7TA 2LIGA 2ZXOA 4C3EA 4YWQA 1V74B 4G78A 2Q7RA 3ASNC 4AL0A 2XLOA 2KW3C 2RD9A 4YT8A 2A6HF 3LLKA 4E0HA 2G3VA 1NSGB 4JURI 1GS9A 2IXOA 3DMDA 4YJWA 4DVYP 5JVEA 2YKZA 2IXPA 4B6IA 3EPVA 4XPWA 2YL1A 5JRAA 4U5HA 4BPMA 3JYHA 1ZW3A 1R4TA 4NTAA 2R03A 3DJNB 3EZIA 3S9OA 1M6TA 1Y6DA 2R7VA 4I1OB 3U9JA 4DOZA 3AG2C 2IYLD 3K6BA 3K33A 4JTDB 2I8BA 1TFOB 2E87A 2XLWA 1CPQA 4D4NA 2QLAA 1K05A 3T6GB 4NTFA 2Y69C 4YN0B 2YEVA 3S29A 1I4YA 3I5QA 1ZVZA 4QDLA 2YRFA 2ZXRA 4GEHA 4CS8C 3GODA 4MVZA 3EJNA 4LACB 1JMWA 3TJ6A 4E7ZA 2R7WA 2L9JA 2R9RB 3C8GB 1HW2A 3HKKA 1GQAA 4IAQA 3X2QC 2WVOA 3W4YA 1OW7A 1C03A 2GAQA 1MNDA 1OR3A 1QZXA 3JT1A 3KPHA 3C8GA 4OINF 4DRJB 3OEOA 5T3TA 4HFKB 4IARA 5TJ5E 4CIPA 3KYJA 3U0CA 1TWHA 3RF3A 1YYJA 3ZWIA 3N24A 1JPJA 2Y39A 4LERA 4IAOA 3GEIA 5E3CA 3DXJF 3AG3C 1VTMP 1QVXA 1PCXA 4Q5SF 2HFIA 2I15A 3UR3C 2B0HA 1LS4A 3QW1A 1OKKA 4EUKB 5EHHA 3MLGA 3OA1A 1PV3A 2FGYA 3V7OA 3AG1C 3JTLO 3QMKA 3FDQA 3K7DA 2A6EF 3HLZA 1SMYF 2J45A 4CJOA 2XXAB 2GDCA 3LS1A 4MVQA 1H9TA 3RYLA 1Z63A 5T3WA 3I4UA 2WVNA 1HMOA 5D91A 3DE8A 3M79A 2C03A 3WG7C 1O3UA 4ZLDA 4O6YA 3MBGA 2HV6A 1ZHXA 2LCHA 1FMWA 3TK0A 3K66A 2IXNA 2XXAA 4Z9HA 1OXBA 1PD0A 2WVQA 3IQTA 2X51A 1NU7D 4XEKA 1F1MA 3FMSA 5BQGA 4AE4B 2ASRA 3RQEA 4BJ6A 4Q4ZF 3M1CB 4D4XA 2DGJA 1LI5A 4BEJA 4XTKA 3ZC4A 3PDMP 3CSKA 2YLDA 2PNOA 1A0BA 1H6GA 1ZHZA 2VH3A 3V5ZA 1HY5A 4YL1A 1VYIA 2BL2A 2CYDA 2YZSA 1M56C 3RW0A 4AE4A 1RMVA 2M4EA 3QZCA 1NFOA 2VC9A 3C63A 3JSZA 3NYMA 1RKEB 2PX3A 5JP7A 1HW1A 2A0UA 5F28E 4JE9A 3SXYA 4JEBA 1Q0MA 2OJQA 3UNGC 2AVKA 2J9VA 4BJ6C 2J0WA 4CSAC 3FOPA 4N4WA 3RFYA 3VAYA 1RKEA 5EK0A 2H8AA 4N06A 5KYXB 4I44A 5DQZA 2WZLA 3RQGA 1I4ZA 2L6HA 1G5ZA 4XLPF 3RIPA 1NZEA 4A2NB 3NDBB 4CS9A 4KNVA 1YARO 4YL3A 2EPMX 1JOGA 4MW3A 3L1MA 1V55C 4MQ9F 5KYXA 2NUTB 1Q0KA 1PD1A 2J8WA 1DOVA 1CPRA 2KGOA 2XS1A 1MMDA 4G7HF 3SXMA 1YZCA 3C7JA 1OQCA 4WGYA 1M2VB 3AQCA 4U9DA 4IWBA 3IQ5A 3B9QA 4HE8D 2NUTA 2XL4A 1OW6A 4CS9C 3OWTA 4PJMA 2H7VC 5E33A 2X0CA 5T1DB 2MWQA 1AUEA 3AG4C 3ATPA 4C7OB 1L7CA 1M2VA 4OIQF 2J9WA 3FAPB 3X1OA 1A7VA 5D92A 3JYYA 1GM5A 1ZW2A 3HJCA 1AEPA 1OCOC 2ZXWC 3W8IA 2HKVA 3LUTB 4DRHB 2Z15A 3W2WA 3S28A 4C7OA 2HJMA 3B0PA 2YHSA 4E17A 2OEVA 1D1BA 2LFDA 2O9XA 1NBBA 3DKAA 4DXWA 5FCLA 4JVSA 1ZHTA 1J8MF 2OEXA 3W8HA 1LIHA 4KC9A 4H54A 1T01A 1JAFA 4LDQA 3FXHA 4X0RA 3WAQA 1YA9A 2H7BA 1Q0DA 1S05A 2WB7A 1BR4A 4PACA 2HMZA 3LLIA 1WOLA 4MVMA 2Q00A 1EKYA 3US6A 2XM4A 3AJMA 1CGNA 1QPUA 2J7PD 2OQMA 4EKWA 1BZ4A 4XWJA 2G3KA 3AQBA 1G4WR 4NY3A 4C3BA 2XL8A 3B29A 1NFNA 2Q3TA 4KNWA 4IRUA 3GM2A 4PFOA 1OCCC 3T4RA 1ORSC 5AGFA 3BRJA 1E83A 4W8PA 1OCRC 3TOMA 2Y3BA 3H65A 1EI7A 5EGYA 2IXMA 2XLEA 2IOQA 2R25A 3ZDLA 4EBJA 3M15A 3N2ZB 1R5ID 4PJJA 3CQZA 3R2PA 3CEXA 3L8JA 1MMNA 2D4UA 1E86A 3GWNA 5KYYB 1APCA 4CDVA 2B0JA 2L6GA 3L8IA 1XWJA 1T6UA 1IZMA 4MTOA 4XQ1A 4ULWA 1ZHYA 2PP4A 1K40A 2P7VA 3KH2A 5KYYA 2LQGA 2EPNA 3U8VA 2Q9CA 2VCBA 5KYNA 3O6XA 1YA7O 2YWAA 5B1BC 5BUOA 5JSLA 3LESA 1ZZPA 5CI9A 3U2MA 5L3VA 4LDKA 3AGTA 5HV9A 2R7QA 3LNRA 1WTYA 3TJ5A 4P6IC 4XPXA 1NLXA 3FVYA 3GORA 2Y3DA 4U9EA 2R7XA 1ORJA 1OW8A 2YL3A
chains in the Genus database with same CATH topology
2FAPB 5GPGB 2RSEB 4DRIB 1AUEA 4FAPB 1FAPB 4DRHB 4DRJB 2NPUA 3FAPB 1NSGB 2GAQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FAP B;  5GPG B;  2RSE B;  4DRI B;  1AUE A;  4FAP B;  1FAP B;  4DRH B;  4DRJ B;  2NPU A;  3FAP B;  1NSG B;  2GAQ A; 
#chains in the Genus database with same CATH topology
 2NUP B;  1L3P A;  4PK4 A;  4AL1 A;  1YAU O;  3C18 A;  4J7Y A;  3S90 A;  2CNW D;  3FAJ A;  1T5O A;  1VOM A;  2IM8 A;  2CNW A;  2NUP A;  4DBQ A;  3HNL A;  3GEE A;  1HMD A;  1O87 A;  3EHN A;  1MMG A;  4M63 A;  4CDY A;  3KKB A;  5COG A;  4KI2 A;  3Q6M A;  3G50 A;  4ER9 A;  4WGZ A;  1SZI A;  5L0F A;  1W2W A;  1N1C A;  2JX0 A;  4XEF A;  2CDQ A;  2W4M A;  4NQF A;  3VF0 A;  4JZA A;  2AWC A;  2KYH A;  2Y3H A;  4CDA A;  2EIM C;  2QNL A;  2PX0 A;  2MYS A;  3O39 A;  5E3A A;  2R7R A;  4YK5 A;  2HZ8 A;  1A7E A;  3SEO A;  2FFH A;  2XLV A;  4W8K A;  3KL4 A;  4LDR A;  1A7D A;  5COM A;  1MMA A;  1Y4C A;  2DI3 A;  2LP4 A;  2NSF A;  2J9B A;  3ASO C;  3U8P A;  3DZA A;  5AC5 A;  1D1C A;  1KNY A;  3ZQV A;  5K0I A;  1LPE A;  2JD3 A;  4JTC B;  2XL6 A;  1FR0 A;  2EPL X;  3ABL C;  3U9M A;  1OR2 A;  3NYJ A;  3ABM C;  3NKD A;  3LNM B;  2M64 A;  4G0H A;  3SNH A;  4CBE A;  4OIR F;  4L6R A;  5DS6 A;  3UGP A;  3ZQY A;  4YT2 A;  2XRH A;  4MTG A;  3RKO F;  1OCZ C;  3WHN A;  3LS0 A;  3IQ6 A;  3QVY A;  4K1O A;  2XLH A;  3VRC A;  3PMR A;  2YQY A;  256B A;  1QKR A;  1RKC A;  3PCV A;  3LJB A;  3IQC A;  3JCU Q;  1OXK A;  4U5E E;  3BEH A;  3SXK A;  4DBR A;  2HV7 A;  2P61 A;  3CAX A;  2W9Y A;  3FHD A;  1YJG A;  4BJ5 A;  3FOO A;  2NG1 A;  2KSF A;  5DQT A;  5DS5 A;  3EGX B;  4MTF A;  1FMV A;  2CCY A;  2EIN C;  2J9U A;  5A6B D;  1FFH A;  4BJ1 A;  4U5F E;  4AK9 A;  5HSW A;  1C17 M;  5A6B A;  4XEV A;  2P1A A;  2Q9A A;  1DOW A;  1V4A A;  2V26 A;  3SYN A;  2OJE D;  3KYI A;  3B0V C;  2J46 A;  4G7Z F;  3S0X A;  1Q0F A;  3EGX A;  4MW8 A;  2P0N A;  3GAN A;  4U5D E;  3SZR A;  2DB4 A;  3EH2 A;  2RSE B;  3UMK A;  1ZYR F;  1EA8 A;  4EIY A;  3UGO A;  3DAG A;  3TD7 A;  3TQO A;  3U2L A;  4F4B A;  4CIH A;  1LE2 A;  3UMH A;  1C02 A;  1UFB A;  1YDI A;  2R7T A;  3Q7L A;  4JJG A;  4P9T A;  1M57 C;  3KMI A;  5JUA A;  4ONS A;  3JSE O;  4EWC A;  4IB4 A;  1VK5 A;  1VLT A;  5JT4 A;  3HNI A;  4DRI B;  3JZ0 A;  4LLE A;  3RH3 A;  1E84 A;  1JPN A;  2NSG A;  3S84 A;  4K7B A;  3F46 A;  1SF8 A;  2LD6 A;  2XSE A;  3Q7G A;  5E2Q A;  5F5H A;  5BQH A;  1D1A A;  2ETS A;  2EPK X;  2HMQ A;  2VCA A;  1IW7 F;  3NMK A;  3LAY A;  3IEE A;  4HEA J;  4K0D A;  4XLN F;  3K1I A;  4WJ0 A;  3EQL F;  1Z7Q c;  2JPU A;  3AGU A;  1D0Z A;  2OG2 A;  4LLC A;  2D5R B;  1YLM A;  3MFN A;  2F22 A;  4O7G A;  1T9K A;  2QUP A;  4A4A A;  4UDV A;  2EPO A;  2V3C C;  1B68 A;  1SYQ A;  1YYX A;  3DAF A;  1Z5Z A;  2CW0 F;  3EFO A;  5A6J A;  2A1D D;  4FX5 A;  3DI5 A;  4MND A;  1YZA A;  1BDJ B;  2UUI A;  4OD5 A;  5IY5 C;  2VCC A;  2XLD A;  4MVR A;  4YT4 A;  2HJ3 A;  3EGD B;  5KYW B;  4QI2 A;  2A68 F;  2P6V A;  3NMJ A;  4JCZ A;  2OKU A;  1XZQ A;  4R32 A;  4NCQ A;  2J7P A;  2OOC A;  2VB6 A;  3ECS A;  2ZD9 A;  4JRZ A;  1ZU4 A;  3EHM A;  1VLS A;  2GFH A;  1T6I A;  3EGD A;  4H4K C;  2YLG A;  5KYW A;  3ITF A;  1E2X A;  2GA0 A;  2TMV P;  1TWA A;  3N0T A;  4P9F A;  2VAS A;  4NTB A;  1LS1 A;  4BEM J;  4DJ9 A;  1EQ1 A;  2WL8 A;  1FFT C;  4OIO F;  2A0B A;  3T6J A;  4Z9J A;  1Q0G A;  4CS7 A;  1UG7 A;  1VB5 A;  2C04 A;  2HUJ A;  3S27 A;  3O10 A;  4AX2 A;  3A11 A;  3L0I A;  3TUL A;  2KQ9 A;  1VYK A;  3NG1 A;  3V5X A;  3ZVR A;  4JEA A;  3CZ6 A;  1AVO B;  1LKX A;  1TFK B;  1WGW A;  1V54 C;  2HSQ A;  3H2V A;  4EHP A;  5A6K A;  5L0G A;  1MQV A;  3PHF 2;  3G4X A;  2FAP B;  2QE9 A;  3U5S A;  1RJ9 B;  2XS8 A;  2EIL C;  4CS8 A;  4PJN A;  2W45 A;  2WZG A;  2EIJ C;  3RQF A;  1RXQ A;  2NPU A;  1LVK A;  2BE5 F;  2R7U A;  4O6M A;  3Q6N A;  4J30 B;  4ZLC A;  4U5B E;  4MVU A;  5DLJ A;  2KJG A;  1LE4 A;  2H7O A;  3DM9 B;  2R05 A;  4ULV A;  1RJ9 A;  1D0Y A;  4XPY A;  4ANJ A;  1JR8 A;  4Z9I A;  3M4B A;  3QVZ A;  3ABK C;  4JW1 A;  3LEO A;  4QI0 A;  5B1A C;  4CX9 A;  4WAB A;  3SP1 A;  4KBL A;  3RVY A;  4JTA B;  3W2V A;  4G7O F;  2Y3G A;  5CIV A;  2HS5 A;  3LEV A;  3POV A;  3NRH A;  4RDA A;  3DJU B;  4BJT A;  3T9O A;  1JRA A;  4JJF A;  2HSB A;  1HE1 A;  3DD7 A;  2Q9B A;  1M2O A;  1KU2 A;  3C8G D;  1LM3 B;  1XZP A;  1ZHW A;  5A6A A;  2YL7 A;  3E70 C;  1QQ3 A;  1GGQ A;  1ORY A;  4YT5 A;  2R7O A;  3UMI A;  1LI7 A;  1H7I A;  1BR1 A;  1NG1 A;  4IGG A;  3O55 A;  1KTM A;  2LK4 A;  2YL0 A;  1OKK D;  4PFP A;  1QSP A;  1TQG A;  4FES A;  2XLM A;  4MS2 A;  1G4U S;  2LFF A;  5L0I A;  2QY9 A;  2J0X A;  2KNH A;  1Z6A A;  3K1H A;  3ZIB A;  4DVZ A;  1H9G A;  2PBE A;  1TWC A;  3GWL A;  5L0C A;  2R7S A;  2A69 F;  2ZPA A;  5B3S C;  5JS5 A;  5B3I A;  1CGM E;  3HNJ A;  2L6F A;  1O5H A;  4Q7C A;  5AC4 A;  1TWG A;  3DE9 A;  5GPG B;  2AWY A;  3F47 A;  3HNK A;  4HFF B;  1VMA A;  2MHR A;  2AU5 A;  4J32 B;  4U5G A;  3JRM O;  1FAP B;  1HE9 A;  4YL0 A;  4GQH A;  4GYT A;  3MYF A;  1J8Y F;  3I5P A;  3IHU A;  3U3F A;  4I3M A;  5CI8 A;  5DVW A;  5FZT A;  1WN0 A;  3T6B A;  1A41 A;  3EZH A;  4CSA A;  2GWW A;  2W4B A;  4JKV A;  4EBB A;  2KC3 A;  2KK1 A;  3C8Z A;  4MVS A;  4E0I A;  5KYU B;  3J06 A;  4MVO A;  1CGO A;  3GM1 A;  4FAP B;  1ST6 A;  1NU9 C;  3IPM O;  4RBN A;  1WWP A;  2UUH A;  3VYW A;  4N6H A;  4IJJ A;  3WOD F;  5KYU A;  3NYL A;  2Q4F A;  1D0X A;  5JLI A;  1FNT c;  1YVI A;  1Z23 A;  1T6Q A;  1QLE C;  2R02 A;  2BC5 A;  1TKN A;  2PFD A;  3C62 A;  3VM6 A;  3A9C A;  1RCP A;  2L7A A;  4BJ5 C;  3ZSU A;  4E7S A;  5DS4 A;  5L0J A;  1I5N A;  3HTK C;  5A69 A;  1MNE A;  4BG0 A;  4JC7 A;  2DYR C;  1K04 A;  1E85 A;  5L0H A;  3QTH A;  3M4C A;  2EIK C;  1G8X A;  3B0U X;  4JCH A;  3NKE A;  4O79 A;  2AP3 A;  3RVZ A;  3SXZ A;  3GEH A;  1Z3I X;  3MX3 A;  2XM0 A;  4FWV A;  4CJG A;  5L3Q A;  1U0B B;  3L34 A;  2OCC C;  4I1M A;  2YVK A;  3E9V A;  3EH1 A;  3EFO B;  5BQI A;  5L0D A;  3V5Y A;  2DYS C;  4E18 A;  3EG9 B;  3QW0 A;  4JIO A;  2OU6 A;  4N6C A;  3GM3 A;  3NMI A;  2PF4 E;  3R7C A;  3DM5 A;  2CGE A;  1S7Z A;  1FTS A;  1WAS A;  4PJL A;  2G62 A;  1U6H A;  1BBH A;  1U89 A;  2IBF A;  4RD9 A;  3AOU A;  1BR2 A;  3EG9 A;  1ZU5 A;  3MYI A;  5COF A;  4C3D A;  4NC3 A;  4O6N A;  4OIP F;  1WAT A;  3K1I C;  2WZF A;  4U5C E;  1TR2 A;  2LSE A;  3ZTZ A;  2YLI A;  2ICW G;  3JRT A;  4PR9 A;  3TOL A;  3B71 A;  3ZTM A;  2L81 A;  3DWW A;  3G4Z A;  4OD4 A;  1SR2 A;  2QTV A;  5F5F A;  3U3B A;  4EBK A;  3H2U A;  3ZG1 A;  2ZXP A;  4J7T A;  2LIG A;  2ZXO A;  4C3E A;  4YWQ A;  1V74 B;  4G78 A;  2Q7R A;  3ASN C;  4AL0 A;  2XLO A;  2KW3 C;  2RD9 A;  4YT8 A;  2A6H F;  3LLK A;  4E0H A;  2G3V A;  1NSG B;  4JUR I;  1GS9 A;  2IXO A;  3DMD A;  4YJW A;  4DVY P;  5JVE A;  2YKZ A;  2IXP A;  4B6I A;  3EPV A;  4XPW A;  2YL1 A;  5JRA A;  4U5H A;  4BPM A;  3JYH A;  1ZW3 A;  1R4T A;  4NTA A;  2R03 A;  3DJN B;  3EZI A;  3S9O A;  1M6T A;  1Y6D A;  2R7V A;  4I1O B;  3U9J A;  4DOZ A;  3AG2 C;  2IYL D;  3K6B A;  3K33 A;  4JTD B;  2I8B A;  1TFO B;  2E87 A;  2XLW A;  1CPQ A;  4D4N A;  2QLA A;  1K05 A;  3T6G B;  4NTF A;  2Y69 C;  4YN0 B;  2YEV A;  3S29 A;  1I4Y A;  3I5Q A;  1ZVZ A;  4QDL A;  2YRF A;  2ZXR A;  4GEH A;  4CS8 C;  3GOD A;  4MVZ A;  3EJN A;  4LAC B;  1JMW A;  3TJ6 A;  4E7Z A;  2R7W A;  2L9J A;  2R9R B;  3C8G B;  1HW2 A;  3HKK A;  1GQA A;  4IAQ A;  3X2Q C;  2WVO A;  3W4Y A;  1OW7 A;  1C03 A;  2GAQ A;  1MND A;  1OR3 A;  1QZX A;  3JT1 A;  3KPH A;  3C8G A;  4OIN F;  4DRJ B;  3OEO A;  5T3T A;  4HFK B;  4IAR A;  5TJ5 E;  4CIP A;  3KYJ A;  3U0C A;  1TWH A;  3RF3 A;  1YYJ A;  3ZWI A;  3N24 A;  1JPJ A;  2Y39 A;  4LER A;  4IAO A;  3GEI A;  5E3C A;  3DXJ F;  3AG3 C;  1VTM P;  1QVX A;  1PCX A;  4Q5S F;  2HFI A;  2I15 A;  3UR3 C;  2B0H A;  1LS4 A;  3QW1 A;  1OKK A;  4EUK B;  5EHH A;  3MLG A;  3OA1 A;  1PV3 A;  2FGY A;  3V7O A;  3AG1 C;  3JTL O;  3QMK A;  3FDQ A;  3K7D A;  2A6E F;  3HLZ A;  1SMY F;  2J45 A;  4CJO A;  2XXA B;  2GDC A;  3LS1 A;  4MVQ A;  1H9T A;  3RYL A;  1Z63 A;  5T3W A;  3I4U A;  2WVN A;  1HMO A;  5D91 A;  3DE8 A;  3M79 A;  2C03 A;  3WG7 C;  1O3U A;  4ZLD A;  4O6Y A;  3MBG A;  2HV6 A;  1ZHX A;  2LCH A;  1FMW A;  3TK0 A;  3K66 A;  2IXN A;  2XXA A;  4Z9H A;  1OXB A;  1PD0 A;  2WVQ A;  3IQT A;  2X51 A;  1NU7 D;  4XEK A;  1F1M A;  3FMS A;  5BQG A;  4AE4 B;  2ASR A;  3RQE A;  4BJ6 A;  4Q4Z F;  3M1C B;  4D4X A;  2DGJ A;  1LI5 A;  4BEJ A;  4XTK A;  3ZC4 A;  3PDM P;  3CSK A;  2YLD A;  2PNO A;  1A0B A;  1H6G A;  1ZHZ A;  2VH3 A;  3V5Z A;  1HY5 A;  4YL1 A;  1VYI A;  2BL2 A;  2CYD A;  2YZS A;  1M56 C;  3RW0 A;  4AE4 A;  1RMV A;  2M4E A;  3QZC A;  1NFO A;  2VC9 A;  3C63 A;  3JSZ A;  3NYM A;  1RKE B;  2PX3 A;  5JP7 A;  1HW1 A;  2A0U A;  5F28 E;  4JE9 A;  3SXY A;  4JEB A;  1Q0M A;  2OJQ A;  3UNG C;  2AVK A;  2J9V A;  4BJ6 C;  2J0W A;  4CSA C;  3FOP A;  4N4W A;  3RFY A;  3VAY A;  1RKE A;  5EK0 A;  2H8A A;  4N06 A;  5KYX B;  4I44 A;  5DQZ A;  2WZL A;  3RQG A;  1I4Z A;  2L6H A;  1G5Z A;  4XLP F;  3RIP A;  1NZE A;  4A2N B;  3NDB B;  4CS9 A;  4KNV A;  1YAR O;  4YL3 A;  2EPM X;  1JOG A;  4MW3 A;  3L1M A;  1V55 C;  4MQ9 F;  5KYX A;  2NUT B;  1Q0K A;  1PD1 A;  2J8W A;  1DOV A;  1CPR A;  2KGO A;  2XS1 A;  1MMD A;  4G7H F;  3SXM A;  1YZC A;  3C7J A;  1OQC A;  4WGY A;  1M2V B;  3AQC A;  4U9D A;  4IWB A;  3IQ5 A;  3B9Q A;  4HE8 D;  2NUT A;  2XL4 A;  1OW6 A;  4CS9 C;  3OWT A;  4PJM A;  2H7V C;  5E33 A;  2X0C A;  5T1D B;  2MWQ A;  1AUE A;  3AG4 C;  3ATP A;  4C7O B;  1L7C A;  1M2V A;  4OIQ F;  2J9W A;  3FAP B;  3X1O A;  1A7V A;  5D92 A;  3JYY A;  1GM5 A;  1ZW2 A;  3HJC A;  1AEP A;  1OCO C;  2ZXW C;  3W8I A;  2HKV A;  3LUT B;  4DRH B;  2Z15 A;  3W2W A;  3S28 A;  4C7O A;  2HJM A;  3B0P A;  2YHS A;  4E17 A;  2OEV A;  1D1B A;  2LFD A;  2O9X A;  1NBB A;  3DKA A;  4DXW A;  5FCL A;  4JVS A;  1ZHT A;  1J8M F;  2OEX A;  3W8H A;  1LIH A;  4KC9 A;  4H54 A;  1T01 A;  1JAF A;  4LDQ A;  3FXH A;  4X0R A;  3WAQ A;  1YA9 A;  2H7B A;  1Q0D A;  1S05 A;  2WB7 A;  1BR4 A;  4PAC A;  2HMZ A;  3LLI A;  1WOL A;  4MVM A;  2Q00 A;  1EKY A;  3US6 A;  2XM4 A;  3AJM A;  1CGN A;  1QPU A;  2J7P D;  2OQM A;  4EKW A;  1BZ4 A;  4XWJ A;  2G3K A;  3AQB A;  1G4W R;  4NY3 A;  4C3B A;  2XL8 A;  3B29 A;  1NFN A;  2Q3T A;  4KNW A;  4IRU A;  3GM2 A;  4PFO A;  1OCC C;  3T4R A;  1ORS C;  5AGF A;  3BRJ A;  1E83 A;  4W8P A;  1OCR C;  3TOM A;  2Y3B A;  3H65 A;  1EI7 A;  5EGY A;  2IXM A;  2XLE A;  2IOQ A;  2R25 A;  3ZDL A;  4EBJ A;  3M15 A;  3N2Z B;  1R5I D;  4PJJ A;  3CQZ A;  3R2P A;  3CEX A;  3L8J A;  1MMN A;  2D4U A;  1E86 A;  3GWN A;  5KYY B;  1APC A;  4CDV A;  2B0J A;  2L6G A;  3L8I A;  1XWJ A;  1T6U A;  1IZM A;  4MTO A;  4XQ1 A;  4ULW A;  1ZHY A;  2PP4 A;  1K40 A;  2P7V A;  3KH2 A;  5KYY A;  2LQG A;  2EPN A;  3U8V A;  2Q9C A;  2VCB A;  5KYN A;  3O6X A;  1YA7 O;  2YWA A;  5B1B C;  5BUO A;  5JSL A;  3LES A;  1ZZP A;  5CI9 A;  3U2M A;  5L3V A;  4LDK A;  3AGT A;  5HV9 A;  2R7Q A;  3LNR A;  1WTY A;  3TJ5 A;  4P6I C;  4XPX A;  1NLX A;  3FVY A;  3GOR A;  2Y3D A;  4U9E A;  2R7X A;  1ORJ A;  1OW8 A;  2YL3 A; 
#chains in the Genus database with same CATH homology
 2FAP B;  5GPG B;  2RSE B;  4DRI B;  1AUE A;  4FAP B;  1FAP B;  4DRH B;  4DRJ B;  2NPU A;  3FAP B;  1NSG B;  2GAQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...