4FAVC

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 50 days
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4favC00
2J55L 2HJBD 2Q7QD 2OK4D 1MG2B 2AGXD 2AGLD 4L3GC 3SLEC 3RMZC 4FAVC 2MADL 2AGYD 2HKRD 4K3IC 2OJYD 2OIZD 3PXWC 2IUPD 3SJLC 3SVWC 2IUVD 2OK6D 3C75L 3SWSC 2H3XB 2H47B 2I0RD 2MTAL 4L1QC 2AGWD 4FANC 4FA4C 4L3HC 4FA9C 2IURD 4Y5RC 3RN1C 2GC7B 1MAFL 2HKMD 2BBKL 1MAEL 3RLMC 4FA5C 2GC4B 4O1QC 4FB1C 2IAAB 3ORVC 3PXTC 2J57K 3L4OC 2IUQD 2I0SD 2AH0D 2AH1D 2J56L 3PXSC 2HJ4D 4FA1C 1MG3B 1MDAL 2HXCD 3RN0C 2AGZD 2I0TD 3L4MC 3SXTC
chains in the Genus database with same CATH superfamily
2J55L 2HJBD 2Q7QD 2OK4D 1MG2B 2AGXD 2AGLD 4L3GC 3SLEC 3RMZC 4FAVC 2MADL 2AGYD 2HKRD 4K3IC 2OJYD 2OIZD 3PXWC 2IUPD 3SJLC 3SVWC 2IUVD 2OK6D 3C75L 3SWSC 2H3XB 2H47B 2I0RD 2MTAL 4L1QC 2AGWD 4FANC 4FA4C 4L3HC 4FA9C 2IURD 4Y5RC 3RN1C 2GC7B 1MAFL 2HKMD 2BBKL 1MAEL 3RLMC 4FA5C 2GC4B 4O1QC 4FB1C 2IAAB 3ORVC 3PXTC 2J57K 3L4OC 2IUQD 2I0SD 2AH0D 2AH1D 2J56L 3PXSC 2HJ4D 4FA1C 1MG3B 1MDAL 2HXCD 3RN0C 2AGZD 2I0TD 3L4MC 3SXTC
chains in the Genus database with same CATH topology
2J55L 2HJBD 2Q7QD 2OK4D 1MG2B 2AGXD 2AGLD 4L3GC 3SLEC 3RMZC 4FAVC 2MADL 2AGYD 2HKRD 4K3IC 2OJYD 2OIZD 3PXWC 2IUPD 3SJLC 3SVWC 2IUVD 2OK6D 3C75L 3SWSC 2H3XB 2H47B 2I0RD 2MTAL 4L1QC 2AGWD 4FANC 4FA4C 4L3HC 4FA9C 2IURD 4Y5RC 3RN1C 2GC7B 1MAFL 2HKMD 2BBKL 1MAEL 3RLMC 4FA5C 2GC4B 4O1QC 4FB1C 2IAAB 3ORVC 3PXTC 2J57K 3L4OC 2IUQD 2I0SD 2AH0D 2AH1D 2J56L 3PXSC 2HJ4D 4FA1C 1MG3B 1MDAL 2HXCD 3RN0C 2AGZD 2I0TD 3L4MC 3SXTC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J55 L;  2HJB D;  2Q7Q D;  2OK4 D;  1MG2 B;  2AGX D;  2AGL D;  4L3G C;  3SLE C;  3RMZ C;  4FAV C;  2MAD L;  2AGY D;  2HKR D;  4K3I C;  2OJY D;  2OIZ D;  3PXW C;  2IUP D;  3SJL C;  3SVW C;  2IUV D;  2OK6 D;  3C75 L;  3SWS C;  2H3X B;  2H47 B;  2I0R D;  2MTA L;  4L1Q C;  2AGW D;  4FAN C;  4FA4 C;  4L3H C;  4FA9 C;  2IUR D;  4Y5R C;  3RN1 C;  2GC7 B;  1MAF L;  2HKM D;  2BBK L;  1MAE L;  3RLM C;  4FA5 C;  2GC4 B;  4O1Q C;  4FB1 C;  2IAA B;  3ORV C;  3PXT C;  2J57 K;  3L4O C;  2IUQ D;  2I0S D;  2AH0 D;  2AH1 D;  2J56 L;  3PXS C;  2HJ4 D;  4FA1 C;  1MG3 B;  1MDA L;  2HXC D;  3RN0 C;  2AGZ D;  2I0T D;  3L4M C;  3SXT C; 
#chains in the Genus database with same CATH topology
 2J55 L;  2HJB D;  2Q7Q D;  2OK4 D;  1MG2 B;  2AGX D;  2AGL D;  4L3G C;  3SLE C;  3RMZ C;  4FAV C;  2MAD L;  2AGY D;  2HKR D;  4K3I C;  2OJY D;  2OIZ D;  3PXW C;  2IUP D;  3SJL C;  3SVW C;  2IUV D;  2OK6 D;  3C75 L;  3SWS C;  2H3X B;  2H47 B;  2I0R D;  2MTA L;  4L1Q C;  2AGW D;  4FAN C;  4FA4 C;  4L3H C;  4FA9 C;  2IUR D;  4Y5R C;  3RN1 C;  2GC7 B;  1MAF L;  2HKM D;  2BBK L;  1MAE L;  3RLM C;  4FA5 C;  2GC4 B;  4O1Q C;  4FB1 C;  2IAA B;  3ORV C;  3PXT C;  2J57 K;  3L4O C;  2IUQ D;  2I0S D;  2AH0 D;  2AH1 D;  2J56 L;  3PXS C;  2HJ4 D;  4FA1 C;  1MG3 B;  1MDA L;  2HXC D;  3RN0 C;  2AGZ D;  2I0T D;  3L4M C;  3SXT C; 
#chains in the Genus database with same CATH homology
 2J55 L;  2HJB D;  2Q7Q D;  2OK4 D;  1MG2 B;  2AGX D;  2AGL D;  4L3G C;  3SLE C;  3RMZ C;  4FAV C;  2MAD L;  2AGY D;  2HKR D;  4K3I C;  2OJY D;  2OIZ D;  3PXW C;  2IUP D;  3SJL C;  3SVW C;  2IUV D;  2OK6 D;  3C75 L;  3SWS C;  2H3X B;  2H47 B;  2I0R D;  2MTA L;  4L1Q C;  2AGW D;  4FAN C;  4FA4 C;  4L3H C;  4FA9 C;  2IUR D;  4Y5R C;  3RN1 C;  2GC7 B;  1MAF L;  2HKM D;  2BBK L;  1MAE L;  3RLM C;  4FA5 C;  2GC4 B;  4O1Q C;  4FB1 C;  2IAA B;  3ORV C;  3PXT C;  2J57 K;  3L4O C;  2IUQ D;  2I0S D;  2AH0 D;  2AH1 D;  2J56 L;  3PXS C;  2HJ4 D;  4FA1 C;  1MG3 B;  1MDA L;  2HXC D;  3RN0 C;  2AGZ D;  2I0T D;  3L4M C;  3SXT C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...