4FAVC

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 50 days
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
125
structure length
124
Chain Sequence
TDPRAKWVPQDNDIQACDYWRHCSIDGNICDCSGGSLTNCPPGTKLATASVASCYNPTDGQSYLIAYRDCCGYNVSGRCPCLNTEGELPVYRPEFANDIIWCFGAEDDAMTYHCTISPIVGKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 31
structure length 124
sequence length 125
chains with identical sequence E
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 2012-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02975 Me-amine-dh_L Methylamine dehydrogenase, L chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.30.10 Mainly Beta Sandwich Electron Transport Ethylamine Dehydrogenase Methylamine/Aralkylamine dehydrogenase light chain 4favC00
2GC7B 3SVWC 2H3XB 2BBKL 2HJ4D 2J57K 4K3IC 1MG2B 2IUVD 2GC4B 3SLEC 2AH0D 3RN0C 4FA5C 2MTAL 4FB1C 3PXSC 2AGYD 1MAFL 2I0TD 2AH1D 2HKMD 2HKRD 2OJYD 4L3HC 4FANC 2I0SD 2AGZD 4FA4C 4FA9C 3PXWC 4L3GC 2I0RD 2OIZD 3C75L 3SWSC 4Y5RC 2Q7QD 2OK4D 4FA1C 2IUPD 2H47B 3RN1C 4O1QC 2IAAB 2AGLD 2J55L 3PXTC 4L1QC 1MG3B 2IUQD 2MADL 2OK6D 3RMZC 3RLMC 3SXTC 2J56L 2IURD 4FAVC 3L4MC 2AGXD 2HXCD 3ORVC 1MDAL 3SJLC 3L4OC 2AGWD 1MAEL 2HJBD
chains in the Genus database with same CATH superfamily
2GC7B 3SVWC 2H3XB 2BBKL 2HJ4D 2J57K 4K3IC 1MG2B 2IUVD 2GC4B 3SLEC 2AH0D 3RN0C 4FA5C 2MTAL 4FB1C 3PXSC 2AGYD 1MAFL 2I0TD 2AH1D 2HKMD 2HKRD 2OJYD 4L3HC 4FANC 2I0SD 2AGZD 4FA4C 4FA9C 3PXWC 4L3GC 2I0RD 2OIZD 3C75L 3SWSC 4Y5RC 2Q7QD 2OK4D 4FA1C 2IUPD 2H47B 3RN1C 4O1QC 2IAAB 2AGLD 2J55L 3PXTC 4L1QC 1MG3B 2IUQD 2MADL 2OK6D 3RMZC 3RLMC 3SXTC 2J56L 2IURD 4FAVC 3L4MC 2AGXD 2HXCD 3ORVC 1MDAL 3SJLC 3L4OC 2AGWD 1MAEL 2HJBD
chains in the Genus database with same CATH topology
2GC7B 3SVWC 2H3XB 2BBKL 2HJ4D 2J57K 4K3IC 1MG2B 2IUVD 2GC4B 3SLEC 2AH0D 3RN0C 4FA5C 2MTAL 4FB1C 3PXSC 2AGYD 1MAFL 2I0TD 2AH1D 2HKMD 2HKRD 2OJYD 4L3HC 4FANC 2I0SD 2AGZD 4FA4C 4FA9C 3PXWC 4L3GC 2I0RD 2OIZD 3C75L 3SWSC 4Y5RC 2Q7QD 2OK4D 4FA1C 2IUPD 2H47B 3RN1C 4O1QC 2IAAB 2AGLD 2J55L 3PXTC 4L1QC 1MG3B 2IUQD 2MADL 2OK6D 3RMZC 3RLMC 3SXTC 2J56L 2IURD 4FAVC 3L4MC 2AGXD 2HXCD 3ORVC 1MDAL 3SJLC 3L4OC 2AGWD 1MAEL 2HJBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GC7 B;  3SVW C;  2H3X B;  2BBK L;  2HJ4 D;  2J57 K;  4K3I C;  1MG2 B;  2IUV D;  2GC4 B;  3SLE C;  2AH0 D;  3RN0 C;  4FA5 C;  2MTA L;  4FB1 C;  3PXS C;  2AGY D;  1MAF L;  2I0T D;  2AH1 D;  2HKM D;  2HKR D;  2OJY D;  4L3H C;  4FAN C;  2I0S D;  2AGZ D;  4FA4 C;  4FA9 C;  3PXW C;  4L3G C;  2I0R D;  2OIZ D;  3C75 L;  3SWS C;  4Y5R C;  2Q7Q D;  2OK4 D;  4FA1 C;  2IUP D;  2H47 B;  3RN1 C;  4O1Q C;  2IAA B;  2AGL D;  2J55 L;  3PXT C;  4L1Q C;  1MG3 B;  2IUQ D;  2MAD L;  2OK6 D;  3RMZ C;  3RLM C;  3SXT C;  2J56 L;  2IUR D;  4FAV C;  3L4M C;  2AGX D;  2HXC D;  3ORV C;  1MDA L;  3SJL C;  3L4O C;  2AGW D;  1MAE L;  2HJB D; 
#chains in the Genus database with same CATH topology
 2GC7 B;  3SVW C;  2H3X B;  2BBK L;  2HJ4 D;  2J57 K;  4K3I C;  1MG2 B;  2IUV D;  2GC4 B;  3SLE C;  2AH0 D;  3RN0 C;  4FA5 C;  2MTA L;  4FB1 C;  3PXS C;  2AGY D;  1MAF L;  2I0T D;  2AH1 D;  2HKM D;  2HKR D;  2OJY D;  4L3H C;  4FAN C;  2I0S D;  2AGZ D;  4FA4 C;  4FA9 C;  3PXW C;  4L3G C;  2I0R D;  2OIZ D;  3C75 L;  3SWS C;  4Y5R C;  2Q7Q D;  2OK4 D;  4FA1 C;  2IUP D;  2H47 B;  3RN1 C;  4O1Q C;  2IAA B;  2AGL D;  2J55 L;  3PXT C;  4L1Q C;  1MG3 B;  2IUQ D;  2MAD L;  2OK6 D;  3RMZ C;  3RLM C;  3SXT C;  2J56 L;  2IUR D;  4FAV C;  3L4M C;  2AGX D;  2HXC D;  3ORV C;  1MDA L;  3SJL C;  3L4O C;  2AGW D;  1MAE L;  2HJB D; 
#chains in the Genus database with same CATH homology
 2GC7 B;  3SVW C;  2H3X B;  2BBK L;  2HJ4 D;  2J57 K;  4K3I C;  1MG2 B;  2IUV D;  2GC4 B;  3SLE C;  2AH0 D;  3RN0 C;  4FA5 C;  2MTA L;  4FB1 C;  3PXS C;  2AGY D;  1MAF L;  2I0T D;  2AH1 D;  2HKM D;  2HKR D;  2OJY D;  4L3H C;  4FAN C;  2I0S D;  2AGZ D;  4FA4 C;  4FA9 C;  3PXW C;  4L3G C;  2I0R D;  2OIZ D;  3C75 L;  3SWS C;  4Y5R C;  2Q7Q D;  2OK4 D;  4FA1 C;  2IUP D;  2H47 B;  3RN1 C;  4O1Q C;  2IAA B;  2AGL D;  2J55 L;  3PXT C;  4L1Q C;  1MG3 B;  2IUQ D;  2MAD L;  2OK6 D;  3RMZ C;  3RLM C;  3SXT C;  2J56 L;  2IUR D;  4FAV C;  3L4M C;  2AGX D;  2HXC D;  3ORV C;  1MDA L;  3SJL C;  3L4O C;  2AGW D;  1MAE L;  2HJB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...