4FBJB

Structure of the cif:nedd8 complex - photorhabdus luminescens cycle inhibiting factor in complex with human nedd8
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular basis of Nedd8 deamidation by the bacterial effector protein Cif
rcsb
source organism Photorhabdus luminescens subsp. laumondii
molecule tags Cell cycle/protein binding
molecule keywords Hypothetical protein
total genus 20
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4fbjB00
2K25A 4M8NA 3VTVA 5AEKB 3PPAA 5G2NA 2ZNVC 3TJPA 4IM0A 4CYEA 3DPDA 2N1VA 4K7UA 1WZ3A 1WJ6A 1G6JA 1WXSA 3ECIA 3UQAA 1WFYA 4ZDVA 2JRHA 2K8HA 3VUWA 3ZDMC 5C1ZA 3PLUA 3K9OB 3W1SA 1HE8A 3PV1A 5J18A 4XZ4A 3ML8A 4URKA 2KLGA 4ANXA 5L95C 1TBEA 1J19A 1P98A 3V61A 3CF6E 2KWUB 3KVFB 2MQJA 4TV3A 5BO4B 5JHAA 1WXAA 2M8SA 2N9EB 5JH5C 4HWIB 2I1JA 4FULA 1E8YA 3LDZE 4M8MA 1X1MA 4MJSB 1E8WA 1ZKHA 4ANUA 2CHZA 1H8CA 3UF8A 3M3JA 1MG8A 3SDLC 4XC2A 4B9KA 3GOEA 4ZYNA 1V86A 2JUOA 1EO6A 4GDKA 2XBBC 1EF1A 2NPTA 2NBWB 3A9JA 2KDIA 1WJNA 3TL5A 2D2QA 2DHZA 1AARA 4I6NB 3KW5B 4G50A 3VH3B 1IPGA 2LGDA 3CMMB 4PYUA 4W9HA 4K1RB 5CHWA 2G4DB 2MBBB 4BKGA 3BY4B 4E74A 2G4SA 4NQKE 3TCAA 2BYVE 2K1FA 5D2MB 2C7HA 1WY8A 3ZUNA 4EFOA 2KANA 3ZNZB 4LDTD 2I1KA 2JZ3B 3H7SA 4GMVA 2PPHA 2IO0B 3DOWA 3EHVA 2DX5B 1KLVA 4II3B 2ZCBA 5FR6A 2HE7A 3DQVA 4GDLB 4EOYA 4AWJA 4ZRKA 3R3MA 2KVRA 4HK2A 3MJWA 1CMXB 3QJZA 2M1MA 2EKEC 2YVCA 4F8CB 1KOTA 2JRIB 3NS8A 3R66C 1WM3A 3H6NA 5DPWA 3L13A 3WAOA 2UWQA 2AYOB 4GXBA 2K8CA 1WH3A 2PE9A 1Z2MA 1LFDA 2MA9B 4WWPA 3V6EB 2AWTA 1EF5A 4WJOA 1NI2A 2A5UA 1C1YB 3A4SC 3M95A 5J2RA 1D3ZA 4YL8A 4JQWC 4W9CA 4DDGD 1WR6E 2D10A 1GG3A 2LRWA 3DBHI 4X57B 3TBLD 2AL3A 3WANA 2G3QB 3VHTC 4BKTA 2MWSB 3PTFC 5E6NA 3IG3A 1SIFA 2FCQA 1S3SG 1QZEA 3K9PB 1VCBA 4G0NB 1J8CA 4W9DA 3OLMD 4CO7A 4GB9A 2DZKA 2N4FA 4AJWA 3B1LX 2KD0A 1BT0A 2KMAA 2Y5BB 2MSED 3M62B 2PE6B 4MGZE 4K81A 3RYTA 5KHOA 2LGXA 4FHKA 2GBKA 2BWES 3ZW3A 4DDID 1RRBA 2DZMA 2O2VA 1E7VA 2L8JA 2MBHA 2PEAA 3O65B 2MCNB 2PJHA 3X23A 2GBJA 4GDKB 2O6VB 2RSUA 1WJUA 2JF5A 3ZNHB 2IY1B 2WYQA 4DXAB 4EUTA 3QWZB 4WJNA 3N32A 5HKHA 2LVPA 4NJ6A 3ZVVA 1E7UA 2ZJDA 4MEMA 4DHJD 3N30A 3DBRI 1F9JA 2KFJA 3H9DA 4E71A 2YLMA 2WX0A 1YX6B 1UD7A 2JVCA 3A1QA 4BBNC 4BKSA 5GMVA 5LXHA 1WGRA 4WWNA 1L7YA 1I35A 4NQLB 3ZTCA 4W9GA 1V5TA 3PSEB 2DAJA 4FJVB 5DPSA 3N3KB 3A9JB 1WZ0A 4M0WB 3BINA 3VTWA 1Q1OA 2BYEA 3ONSA 4EKUA 5E6OA 2L76A 4HDOA 2W9NA 4AJYB 1GC7A 1P0RA 2KX3A 2LUEA 2DYOA 4KZCA 2FIDA 1XD3B 2Z0DB 3APDA 3JYUA 4NAWB 3UIOB 1ISNA 3B08A 3OJ3A 3PRZA 3L54A 2EMSA 1E8ZA 4GSWA 4GDLA 1WXMA 4IG7B 3B0AA 3UINB 3H1UA 1TTNA 4NJ7A 3ZRFA 2MLBA 1WE6A 2V4LA 3I3TB 3T8MA 2M17A 5D7GA 4DHJB 4OVUA 3A9KA 3ENEA 2MBQA 3NHEB 2M0XA 1V9JA 4XX5A 4BOZB 4TQ1A 3KH0A 2N1WA 4KDLB 3ZIMA 4BOSC 2KZRA 2KQSA 3MTNB 4B95A 2OOBB 1Y8RC 4EZLA 2CU1A 4FJZA 1WGDA 3GZNI 4LJOB 2IO1B 2KJHB 4KIKA 1WGGA 2FNJB 1OTRB 2IYDB 4K7SA 5L83A 4ZRIA 3ZRCA 1KJTA 2O6VA 2LZ6A 5AZHA 1R4MI 4JLCA 3W1YA 4LJPB 3HK0A 2ZCCA 2MBOA 1V81A 1YIWA 2K6DB 1WX9A 3RD2A 3U7DA 3A1QB 2J0KA 1C3TA 4TUUA 2ASQA 2GOWA 1SE9A 1PQSA 5LXIB 1FXTB 5DPRA 2KN5A 4PS8A 3ZO5B 2GBNA 2IY0B 1GUAB 1YJ1A 1JRUA 2A4ZA 3ZNGC 2BF8B 1T0YA 2C7NB 3QARA 2GBMA 3ZKJC 2LWPA 2KFKA 4GN1A 4K7WA 2C9WB 2WDTB 4MSMB 1V49A 3RZWC 4W9JA 3JVZX 2J0MA 3LJ3A 2BYFA 4RM8A 4DWFA 4FA6A 3AXCA 3PVLA 2FIFA 3KYDD 2QHOA 4JGHB 2KK8A 1UBQA 4IM2A 4NAWA 3AI5A 2KX0A 2MP2A 4FHJA 2KJ6A 2HD5B 1OEYJ 3SU8X 1WXVA 2C5LC 2RGFA 1OQYA 1V80A 4KSKC 4LDTB 4A3PA 2LVQA 4W9FA 1NDDA 2EMTA 3DBLI 1TZ1A 3KUDB 2JWZA 3PRMB 4MELA 2FCNA 1WX8A 2KFKB 4RMAA 5CX3A 2JY6A 3VXWA 2J0JA 2KWCA 1E5WA 4IC7B 4W9LA 5J17A 2LXAA 1YX5B 2N7DA 3EFUA 3NZSA 4KDIC 2BKFA 4FLHA 4KIKB 3HM3A 4MGKE 2KMCA 4MH0E 4BFRA 1WGHA 2UYZB 1WRDB 1RLFA 5AZGA 1ZW7A 3DVNV 3VH4B 1RAXA 2L0FA 5IA7A 1P9DU 1V5OA 1GJZA 4W9KA 5C23A 1Q0WB 3S2AA 2MP2B 2JXXA 1RFAA 4A20A 2NBUA 3AU5A 2CHXA 3KUCB 2L05A 1Z5SB 4MJSA 4BBNF 5G55A 3QHTA 3AULA 3PHXB 4W9EA 4II2B 4DHZE 3V6CB 3WIMA 4WQOB 2KDFB 4BVUC 4EEWA 3RUIB 3RULA 2R2QA 2RR9A 2DAFA 3DVNU 2G45B 3HHMA 1WI0A 2JPHA 2LXCA 1YQBA 4LCDE 3P2BA 3TMPB 4IW0A 2O2VB 5AZFA 4DK5A 2IO2B 4F7ZA 1WR1A 2KQ7A 3A4RA 3JSVA 5D94A 1LM8B 2FCMA 4I6PA 3IBEA 3QK0A 5CHVC 3OJ4B 4KVGB 4HCPB 3VVWB 3UIPB 2JT4B 3T9LA 3C0RB 4MGYE 1U4AA 2C7MB 2K39A 1LXDA 2IZVB 4NNJB 1GNUA 4FN2A 3QCAA 2DYMA 4HCNB 3QQ8B 3WAPA 2D07B 1A5RA 1UELA 4IUMB 4ZRJA 3NOBA 4ASWC 2B3AA 2ZZPB 3PLVA 2L0TA 1V2YA 3QAQA 1WGYA 2L00B 3ZDTA 3IHPC 4HXDA 2NR2A 3A33B 3PT2B 3VQIA 1NBFC 3D32A 2IBIB 1V6EA 2GBRA 2C60A 3H7PA 3DCGA 3HM6X 4JL9A 3V62A 3QC8B 2XEWA 3ZTDA 3NZUA 2N7EA 2REXA 2LGYA 3ML9A 4HPLB 2JZZA 4TQ0A 1WMHA 2LJ5A 2CR5A 2L3ZA 4G3XB 4PS3A 1YD8U 2LASA 3KUZA 2DYBA 1UH6A 3KYCD 4IWQA 4KZ0A 4WWOA 2FUHB 2LI5A 3IVFA 4MGIE 2AL6A 2FAZA 3SHQA 4PYZA 2MBEA 3L08A 2ZNVB 4BKSD 3U8ZA 3V60A 4G11A 1LQBA 4I6LB 3Q3JA 3EECA 2KHWB 2XK5A 2KWVB 4TKNA 1E8XA 2WWZA 4ICVA 4MSQB 2AEHA 4A3OA 2KKCA 1L2NA 4E3CA 2D3GA 4OVVA 4WJPA 1J0GA 2BWFA 3H7PB 2LRUA 1H4RA 2CKHB 1IP9A 3M63B 3VFKA 2KLCA 2CHWA 2N9PC 4GU2A 4MDKE 1WMHB 1WF9A 2NPTB 2IO3B 2N9XA 4AOFA 3U30A 4GGQA 3PRPB 3Q3FA 1Q5WB 5CHFA 3RZFA 1WM2A 4HPMB 2ZPYA 5KHQA 2KNBA 5CTRC 2LD9A 4PS7A 5EDSA 3WAMA 1OGWA 4ICUA 5TR5A 2DZJA 1KM7A 4IWOA 1UZXB 5DPTA 4AP4C 4EZJA 3QA8A 4GIVA 2NVUI 3L10B 2KTRB 1K8RB 1XQQA 4KSLC 2ZVNA 3DBSA 3DVGX 1GC6A 3TIXA 3PZDA 3L0WB 2K6QA 4FBJB 3WA0A 3ZNID 3CSTA 2V3SA 4P7IA 2MRPA 4FJYA 4RM9A 2GMIC 4MM3A 1IYFA 3DVGY 3WALA 2VRRB 3APFA 3APCA 5JHBA 2BPSA 1UBIA 1R4NI 2Z0EB 2ZVOA 1I42A 2KTFA 5E6PA 2ZEQA 4AUQC 4W9IA 2KXJA 1EUVB 1E90A 3IFWB 3VTUA 3X0WA 3ZLZA 3SD5A 3MHSD 2NCNA 1XT9B 2K8BA 1UGMA 4IWPA 4IM3A 4NPNA 2NBVB 3JW0X 4B6WA 4DBGA 2V1YA 2RPQA 4NY0A 3PGEA 2DZIA 2J7QB 3DDCB 1S1QB 1OEYA 3VUYA 2O6VD 4JIOU 3NY5A 3PREA 2HJ8A 4EZKA 2FCSA 1M94A 2HTHA 1WX7A 2DENB 2BGFA 3L16A 5DCNA 5LLIA 3UQBA 2D11A 1ZGUB 4WJQA 4ANWA 2MW5A 5JZEB 2KO3A 2KDBA 3AU4A 2KDEB 4DHZB 4J6IA 3EC8A 1SGHA 3QIJA 2L7RA 2KC1A 2R2OA 2MX2A 4CHKA 3VUXA 3JSVB 4ANVA 4HLEA 2WX1A 1P3QU 4N9F4 4HDQA 3VDZA 2M4NA 3W1SC 1WYWB 4WAAA 2KJRA 1P1AA 2NS5A 3PS6A 3QX1A 3RCZA 2XK5B 3R7RA 2RD0A 3OAWA 4F1SA 3UGBB 4HVBA 3HIZA 2LVOA 1WE7A 4GOCA 2KTRA 2CS4A 4FADA 4HJKA 1WJ4A 1TGZB 2KOXA 3CSFA 4KV2A 3RT3B 3A9KB 1WIAA 3R7QA 2BKRB 2ZPNA 2KC2A 5D6JB 3VAWA 3ALBA 1VD2A 2OJRA 5IAAC 3PHWB 2Z59B 3L17A
chains in the Genus database with same CATH superfamily
2K25A 3ZJUA 1JWBD 1HA5A 2N1VA 3Q3OC 1WZ3A 1WJ6A 4K7UA 5GXGB 1WXSA 1UUPA 4ZDVA 2N9KA 3VUWA 1YMHE 2J4XA 3L4PA 3PLUA 1HE8A 3ML8A 1XLNA 4URKA 2KLGA 3MC0B 4ANXA 1J19A 2R61A 4A6QA 3CF6E 1KF6B 4TV3A 1WXAA 2M8SA 2I1JA 1X1MA 2CHZA 1GOZA 1XCTL 3DBRB 2CU3A 4LNFA 1V86A 2XBBC 1EF1A 1WJNA 2J53A 3Q8CA 2K1FA 3MC9A 2C7HA 4RGOS 4L23A 2JZ3B 2PPHA 1ZXHA 2IO0B 2DX5B 1V97A 1K53A 4II3B 2ZCBA 1N60A 5FR6A 2HE7A 3DQVA 4GDLB 2W3SA 2KVRA 1ZDVA 3MJWA 1KOTA 2JRIB 3H6NA 1FMAD 1QT9A 2AYOB 2FBWB 4GXBA 3V6EB 5EE9A 3VRBB 4JWSC 3A4SC 3GE3C 1JWAD 3TBLD 2G3QB 4HKQA 3UI3A 4ITKA 2MWSB 2XN9C 4ZYSA 3KQ4A 1QZEA 1VCBA 3ZJVA 4GB9A 2N4FA 3B1LX 4LNIA 2BS3B 2GBKA 3ZW3A 4DDID 2DZMA 2MCNB 2WLBA 2EKIA 2PJHA 4GDKB 1HXYD 2WYQA 4WJNA 3N32A 3AM9A 3ZVVA 3P4SB 2WXPA 4C80A 2JVCA 4BKSA 5LXHA 4WWNA 1I35A 4NQLB 3PSEB 3AE5B 4FJVB 3N3KB 4AQ7A 1WZ0A 2N9LA 2JWUA 3DBLB 3VTWA 3BYTB 4TSSA 4C7ZA 4EKUA 2L76A 4R3DA 4HRSA 2GI9A 3UIOB 4NAWB 4OZCA 4TMAB 4C56C 2LEKA 3L54A 1SB3C 1E8ZA 1L0XB 4GDLA 1WXMA 2KT7A 1N6ZA 2KMMA 3H1UA 1TTNA 4GLSC 3I3TB 4OVUA 4RGTA 3ENEA 4XX5A 2UU7A 3KH0A 1F52A 2N1WA 3MTNB 2KQSA 2PMVA 2OOBB 4UDUC 2CU1A 4LJOB 2IO1B 1OTRB 2IYDB 1I4HA 1XXGA 1B1ZA 2LZ6A 1LO5D 4FXCA 3AE9B 1YIWA 2K6DB 3RD2A 1WX9A 3U7DA 1C3TA 2ASQA 1SE9A 1E6EB 2KN5A 1PYWD 1I4RA 2IY0B 1YJ1A 1STEA 2PLPA 2C7NB 2GBMA 3ZKJC 2G1EA 5G5GA 1FFVA 1FO4A 1GB4A 2BYFA 4XGAB 3AXCA 3KYDD 2WU2B 2KK8A 3T3OA 1UBQA 4IM2A 3MFGA 1OEYJ 5BMGA 1QLBB 2LVQA 3U52E 1TS2A 1NDDA 3X23A 1L2NA 2FCNA 3VXWA 4LK0M 4W9LA 5J17A 3W5VB 4K3CA 3W9CB 1FEHA 3HM3A 3J9CA 1RLFA 5AZGA 1ZW7A 2WXKA 5FKAC 1ZXIA 1GJZA 4W9KA 3S2AA 5EE0A 4WAFA 3NS1A 3Q8FA 1Q10A 3H8HA 4BBNF 1Z5SB 4MJSA 5G55A 4JE3B 2WS3B 3QHTA 5JXVA 1MHHE 4C4VB 4II2B 3V6CB 2DWQA 3NRZA 4WQOB 2H88B 3WCQA 4EEWA 3P4PB 3RUIB 3RULA 2BVCA 1WI0A 1VZ8A 2D3BA 5BMIA 3JSVA 5D94A 1LM8B 2FCMA 2INPE 1ENFA 2SAKA 4HCPB 2D5GA 3VVWB 3UIPB 3NVZA 1U4AA 1TS5A 1SE4A 1A5RA 3HVZA 4ZRJA 3NOBA 4ASWC 4KKIA 3MC8A 2B76B 3AE4B 2IBIB 2C60A 1N62A 3QC8B 2JYTA 2XEWA 2REXA 1IBXA 3ML9A 2CR5A 2L3ZA 3KUZA 1JWMD 2WXNA 4IWQA 4KZ0A 4WWOA 2FUHB 2CJOA 2LI5A 1AYFA 3IVFA 1HTQA 3SHQA 1HTOA 1D5XC 4BKSD 3Q3JA 1SSNA 1V1PA 3EECA 2KHWB 2WWZA 4ICVA 4MSQB 2AEHA 4A3OA 2WDRB 4WJPA 3H7PB 5T8IA 3Q8EA 3M63B 2WXHA 2KLCA 4GU2A 2Y3AA 2K9XA 2LMCA 3U30A 2Y5CA 1JQ4A 3PRPB 5CHFA 2DLBA 4PS7A 3NVWA 5EDSA 1MVKA 3R8BA 2HTME 5DPTA 3RNEC 4AP4C 2L52A 1C78A 2RDHA 1XQQA 1LGRA 1GC6A 2K6QA 3PZ7A 2BS2B 1DYQA 2LGSA 1TKGA 2V3NA 2QCZA 1FM0D 2V9HA 2MH7A 1ZDXA 1MFWA 2K3UA 1R4NI 2Z0EB 1GPXA 4XWTA 4MACA 2NTTA 3N20C 4W9IA 4XYCA 1V8CA 3TSSA 1EUVB 3Q69A 1YN5A 2W3RA 1XT9B 2K8BA 4J3OD 5D3IB 3JW0X 2RPQA 2HJ1A 4NY0A 2DZIA 3DDCB 2O6VD 1FNVA 2HJ8A 2FCSA 4LNKA 1JALA 2DENB 3DHGC 5E6JA 3RNCC 1ZGUB 5JZEB 2KDEB 1WYGA 3EC8A 4ZHPA 2IPKD 3VUXA 1P3QU 4HDQA 4WAAA 2KJRA 1P1AA 3PS6A 1L6VA 1TT5B 3IT4B 3UGBB 4GOCA 3RNGC 2CS4A 4FADA 1EWYC 1MI0A 3AE1B 4KV2A 1ZPSA 3A9KB 2ZPNA 2KC2A 3VAWA 3RPFC 2OJRA 1NYQA 2IGGA 2Z59B 4M8NA 3VTVA 2AQ3B 1L5PA 5G2NA 3TJPA 2MJ3A 3CWIA 1G6JA 2WXJA 3ECIA 1WFYA 3AE6B 2JRHA 3NVVA 5C1ZA 2AQ2B 3P4QB 5BYQA 5L95C 1FNWA 3FILB 1UGJA 3Q2AC 4YSYB 1QQRA 2KYWA 3PO0A 4ZRQA 1L0YB 4XC2A 3GOEA 4ZYNA 2JUOA 1KLGD 4MM3B 4GDKA 2NBWB 3A9JA 4P6VF 2KDIA 1AARA 1TY0A 3KW5B 3VH3B 4BZAA 2LGDA 3CMMB 4HEA1 4W9HA 4BKGA 1BXTA 3BY4B 3Q6BA 1XO3A 4NQKE 2BYVE 5D2MB 2I1KA 4GMVA 4C00A 3EHVA 4JX1C 3N1ZC 4EOYA 4AWJA 2FE8A 4HK2A 1CMXB 2BQQA 2YVCA 4ARCA 1JW9D 5C2TB 5DPWA 3L13A 1NVID 4DQOC 1GB1A 4WWPA 2AWTA 1TJEA 2A5UA 2MJDA 1C1YB 3M95A 1D3ZA 2L1AA 4JQWC 2NMQA 5MPOA 1ET6A 1WR6E 2LRWA 3RI7C 2AL3A 2SEBD 3PTFC 5E6NA 3FC4A 3IG3A 2DZKA 2KMAA 2MSED 2VH2A 4K81A 2BWES 1CJEA 2O2VA 1E7VA 2L8JA 2PEAA 2O6VB 4US9A 3ZNHB 4DXAB 4EUTA 2V0GA 3QWZB 2LVPA 3BVZA 2ZJDA 4MEMA 1AN8A 2WX0A 1UD7A 3A1QA 4BBNC 3NJTA 1L7YA 2QMTA 2LFIA 3ZTCA 4W9GA 3AEAB 1TIFA 2VZKB 3SR6A 3BVMA 2DYOA 4KZCA 3JYUA 3ZJTA 3PRZA 3OJ3A 2EMSA 4GSWA 3I9V1 4OZBA 4NJ7A 3ZRFA 2WDVB 2MLBA 2V4LA 2D3CA 3B2FA 3T8MA 2M17A 4A9AA 2I38A 3A9KA 2MBQA 2M0XA 4TQ1A 4KDLB 1ACCA 3ZIMA 2KZRA 4B95A 1Y8RC 2OJWA 1SBBB 4NJCA 4L1BA 2KJHB 2J52A 4ZRIA 1KJTA 4JLCA 3W1YA 2ZCCA 3C8YA 2J0KA 2GOWA 3W5UB 5LXIB 1VRAB 4PS8A 1C4PA 2GBNA 3RNAC 3AN1A 2A4ZA 1T0SC 4PK1A 1AWDA 4AS1A 2KFKA 4GN1A 4K7WA 2J42A 5H8YE 1RM6C 3RZWC 2WQYB 1SE2A 4RM8A 2INDC 4KKJA 4MH8A 3AI5A 1WXVA 2C5LC 1OQYA 4ZHOA 1FFUA 3PRMB 3DBLI 5CX3A 2KFKB 3AECB 2WGSA 3GS2A 2JY6A 3P1MA 5BMHA 4PT5A 4IKGA 1UWMA 3Q8BA 1YX5B 3EFUA 1WRIA 2PVGC 4ARIA 1WRDB 3DVNV 3VH4B 5IA7A 5C23A 1RFAA 3AE7B 2NBUA 3AU5A 1P7FA 2KWDA 3GE8C 4ZRPA 1R4NB 3WIMA 2M56B 1I4PA 2KDFB 3HVDA 3ZXRA 2R2QA 2RR9A 4MT5A 1UF0A 1YQ4B 1YQBA 3P42A 3TMPB 4IW0A 3DHHC 3A4RA 2KQ7A 3IBEA 4KVGB 1F77A 3C0RB 4YTMB 1NEKB 1KLUD 2C7MB 4NNJB 4FN2A 1GNUA 2ZW1A 4WURA 2CJNA 4HCNB 3QQ8B 2L83A 4RNAA 3TEXA 1L4DB 2V3PA 1YOVB 3I57A 2L0TA 2LJIA 2L00B 3VQIA 3A33B 1EWCA 1NBFC 2BB6A 3AEDB 3DCGA 3GP7A 3Q3MC 4YTNB 3ZTDA 3C19A 4HPLB 4DXFA 2LJ5A 2DYBA 1UH6A 3KYCD 5IP4D 5AUKA 1QOAA 4YXDB 3SEBA 3U8ZA 3TEZA 4I6LB 1VJKA 4N6EB 1E8XA 4E3CA 4YSXB 1H4RA 4JPSA 1TS4A 3VFKA 1WMHB 1PUTA 2NPTB 2WHIA 4AOFA 1Q5WB 4P1BC 2OEDA 2KNBA 5TR5A 4C7YA 2DZJA 1KM7A 4IWOA 4USAA 4EZJA 3QA8A 4GIVA 2KTRB 2ZVNA 3TIXA 3L0WB 4FBJB 3WA0A 3ZNID 2V3SA 2MRPA 2Q5WD 3WALA 3O13A 5JHBA 3B9JA 2K0PA 2BPSA 1UBIA 3EA6A 1I42A 3ZGZA 2ON8A 2W54A 3LB8C 4JWUC 4AUQC 3AV8A 4XE0A 3DHIC 1E90A 2AQ1B 2GLSA 3VR8B 3X0WA 3SD5A 1I4XA 3MHSD 2NTSA 2K5PA 4IM3A 4NPNA 2NBVB 2PW9A 5I4DA 3EUB2 1OQRA 3AEBB 3R2TA 1OEYA 1V1PB 1F1HA 3AMZA 1JMLA 2BS4B 5IKCM 1SE3A 5DCNA 5LLIA 2LHDA 4WJQA 2KDBA 4J6IA 4A8XC 3AE8B 2KC1A 4ANVA 4HLEA 4N9F4 2M4NA 2INNE 3EFCA 3CIRB 3B2GA 3EGRA 3BK2A 5C3JB 4N59A 2KACA 1XF5L 3R7QA 2KVZA 3N1XC 1VD2A 2G9HD 2KAJA 3L17A 1OFFA 5AEKB 3PPAA 3E56A 4CYEA 2BTEA 3TEYA 1MHXA 3N1YC 2JSVX 3ZDMC 3R2IA 3W1SA 5J18A 3PV1A 4IDIA 1TBEA 2EELA 1P98A 3V61A 3KVFB 5BO4B 2N0SB 4MJSB 1E8WA 4ANUA 3RFZB 1YN4A 2RPVA 1A70A 1VZ6A 3KWVA 3SDLC 3IXSA 1SJHD 2JQRB 2V4IB 2VH1A 2NPTA 3I5JC 1IPGA 5CHWA 1KRHA 1FIQA 4E74A 2G4SA 3TCAA 1KFYB 2E6XA 1WY8A 3ZUNA 3KWLA 4LDTD 2GB1A 2QSDA 4OZAA 3R3MA 3AE3B 1WM3A 5BYRA 1TKEA 2L32A 3WAOA 2UWQA 1EU4A 2K8CA 2DNFA 2PE9A 1Z2MA 1T0RC 1C77A 5J2RA 1NI2A 4ACFA 4W9CA 2D10A 1GG3A 3DBHI 4X57B 3AB5A 5TSSA 1PFDA 2WXQA 1SIFA 1S3SG 2E3TA 1J8CA 4W9DA 3OLMD 4AJWA 2KD0A 2Y5BB 3M62B 4MGZE 4RFBA 2LGXA 4FHKA 1RRBA 4A55A 2GBJA 2RSUA 1WJUA 2IY1B 4DHJD 3DBRI 1F9JA 1E0ZA 2KFJA 1RYJA 3RNFC 1VLBA 4S17A 3U4EG 2BT6A 2DAJA 5DPSA 2PTLA 3NZ3A 1Y56A 3A9JB 1Q1OA 2WXFA 3ZYYX 4S0RA 4O1NA 3ONSA 5IO9A 5E6OA 3OWEB 2W9NA 4HDOA 1ZE3D 1GC7A 1P0RA 2KX3A 2LUEA 2FIDA 1XD3B 2Z0DB 1ISNA 3B08A 2OHFA 1J7AA 3B0AA 3PZ8A 1T5XD 1N63A 1FXAA 1KTKA 4DHJB 3NHEB 1ZUD2 4BOSC 1QF6A 4EZLA 2WXIA 3ZXVA 1SJED 4KIKA 1WGGA 2PKOA 3ZRCA 2O6VA 4OHJA 4LJPB 3NVYA 4LLGM 1V81A 2RMMA 4RF0A 3A1QB 4TUUA 2MJEA 1PQSA 1ROEA 2BBCA 3ZO5B 1XLQA 1GUAB 1JRUA 2KN4A 3ZNGC 2BF8B 1T0YA 3VRAB 4M0WA 1QKZA 3Q8AA 2C9WB 2WDTB 2W55A 3VR9B 2WU5B 3JVZX 1WWTA 2J0MA 4H2AA 1C4CA 1T3QA 4FA6A 1E9MA 2QHOA 2K22A 2VZKD 4NAWA 2MP2A 4FHJA 2RGFA 1E10A 3KUDB 2QILA 2JWZA 4RMAA 4MELA 2J0JA 2KWCA 3KLSX 4IC7B 1DOYA 3RN9C 2LXAA 1ESFA 2N7DA 4P16A 2JXTA 2WXRA 1QILA 3BVGA 3NZSA 2BKFA 1HEZE 4MGKE 4MH0E 4BFRA 1HZ5A 1P9DU 1C9FA 3GZNB 2MP2B 3BWUD 2JXXA 3MJ5A 1YNTE 2QIEB 3MP9A 3KUCB 3PHXB 1NENB 2MEKA 4BVUC 5HHDG 3ETRA 2DAFA 2G45B 3HHMA 3FAHA 1MPEA 2JPHA 2O2VB 4DK5A 1FRRA 4B0MA 3QK0A 5CHVC 4RF1A 1RWSA 2QC8A 1ZP0B 2JT4B 3T9LA 3RNBC 2JX5A 2K39A 1FRDA 2KDMA 3QCAA 1VZ7A 1JWUD 3WAPA 4IUMB 3FKYA 2B3AA 2ZZPB 3PLVA 1V2YA 5HFYA 1WGYA 1B9RA 4HXDA 3PT2B 1RFKA 3D32A 2GBRA 3URYA 3H7PA 3HM6X 4JL9A 3NZUA 2N7EA 2LGYA 2RDGA 1XEEA 1WMHA 4WIPA 4G3XB 2LASA 2WXMA 4WWMA 4PYZA 2MBEA 2ZNVB 3V60A 1LQBA 4D2KA 2KKCA 2M0AA 4XDDA 4OVVA 1J0GA 2CKHB 4P1CC 4KX6B 5AUIA 4MDKE 1WF9A 2IO3B 4RGNA 4GGQA 4YTPB 1OQQA 1TY2A 3RZFA 2ZPYA 3HUIA 5KHQA 1SXTA 4NZLB 5CTRC 2LD9A 3P63A 3WAMA 4ICUA 1UZXB 2NVUI 1R7SA 1K8RB 3DBSA 3T3NA 1CQVA 3DVGX 1HZ6A 4ZOHC 4A90A 3IT6B 1UNSA 1JCKB 3V05A 3TUOA 3DVGY 1V1OA 3APCA 2ZVOA 1MG4A 2KTFA 5E6PA 3IFWB 3VTUA 2LGIA 1C79A 4LNOA 2V1YA 2J7QB 3VUYA 4JIOU 2HTHA 1VDVA 3TEWA 3L16A 1FCCC 2D11A 4HPPA 1UWXA 1SEBD 3QIJA 2L7RA 2R2OA 2MX2A 4CHKA 3JSVB 2WX1A 3VDZA 3ABVB 1WYWB 2NS5A 3QX1A 2X38A 3RCZA 2XK5B 1XLPA 1QOGA 3AEFB 4F1SA 2WXGA 4K3BA 4HVBA 2LVOA 1WE7A 3NG0A 2KTRA 1D5ZC 2JU6X 2N7JA 3CSFA 2KOXA 4WH4A 1WIAA 2BKRB 5D3DA 3GB1A 3ALBA 3AEGB 4P7IA 2Z8LA 1I7HA 2ZNVC 1IGCA 4IM0A 1J7CA 3DPDA 3SFDB 2WXLA 3UQAA 2K8HA 3K9OB 1JWSD 4XZ4A 3OG5A 2BB5A 2KWUB 2MQJA 5JHAA 2N9EB 5JH5C 4HWIB 4FULA 1E8YA 3LDZE 4M8MA 1ZKHA 1ET9A 2D3AA 4C4VA 2BYTA 1H8CA 3UF8A 3M3JA 1MG8A 4B9KA 1EO6A 1N5XA 2ACZB 1KH0A 3TL5A 2D2QA 2DHZA 4I6NB 4G50A 4PYUA 4K1RB 2G4DB 2MBBB 3BZDB 1M4VA 1F2RC 4OVZA 4EFOA 2KANA 3ZNZB 4L2YA 3H7SA 3DOWA 1KLVA 5HG2A 4HJGE 4ZRKA 3DBHB 3QJZA 2M1MA 2EKEC 4F8CB 2ICIA 3NS8A 3R66C 1NYRA 1WH3A 1LFDA 2MA9B 1DOIA 1EF5A 4WJOA 5EE1A 1BUIC 3HRDD 4YL8A 2I2YA 2H89B 4DDGD 1N61A 3WANA 3VHTC 4BKTA 5EE3A 2FCQA 3K9PB 4G0NB 4QAYA 1PGXA 4CO7A 1BT0A 2PE6B 3RYTA 5KHOA 1D6EC 1MJDA 2WDQB 2AX5A 2MBHA 3O65B 4CQNA 2FUG1 2JF5A 5HKHA 4NJ6A 1F0ZA 5FR3A 1E7UA 1WXQA 3N30A 3P4RB 2JYEA 3H9DA 4E71A 2YLMA 1TZOA 1YX6B 2QJLA 5GMVA 1WGRA 5BYSA 1V5TA 1E7PB 2QEJC 1N5WA 4EE2A 3LYYA 4M0WB 3BINA 1BMLC 3BYYB 2BYEA 4IOIE 4M02A 4AJYB 2INCC 2KQ4X 4KGSA 1FXIA 1HQRD 1FPYA 3APDA 2M19A 4YWGG 5HI1A 4IG7B 3UINB 4YSZB 5LNK1 1WE6A 4LNNA 3V3XA 5D7GA 4YT0B 1V9JA 4BOZB 3BIID 4HROA 1JROA 2IGDA 4FJZA 2LHEA 1IGDA 1WGDA 3GZNI 2JZPA 2FNJB 2HDEA 4K7SA 5L83A 5AZHA 1R4MI 2WP9B 1FCLA 3HK0A 2MBOA 2DBYA 1D4BA 4XWWA 2PIAA 4RGMA 2RDBC 4NAMA 4BAXA 1FXTB 1FNUA 5DPRA 1TS3A 3E9SA 3QARA 1SF0A 2LWPA 3IAM1 4B0EA 2IDYA 2ONQA 1DOXA 4MSMB 1V49A 4M01A 5IN7A 1R4MB 4W9JA 3LJ3A 1GAQB 4DWFA 3PVLA 4DXGA 2FIFA 4JGHB 1QOBA 1K52A 1C76A 2YEPB 2KX0A 4HKZE 2KJ6A 2HD5B 1QOFA 1SIJA 2WXOA 4RCOA 3SU8X 4KSKC 1V80A 4LDTB 4A3PA 1WGKA 4W9FA 1IUEA 1YN3A 3SFEB 2EMTA 1TZ1A 3N9YC 2TSSA 1WX8A 2IGHA 1E5WA 4Q2JA 2WNMA 4KDIC 4FLHA 4KIKB 2KMCA 1L0VB 1WGHA 2UYZB 3NUHB 1RAXA 2L0FA 1P7EA 1V5OA 3Q3NC 1Q0WB 3AEEB 1NI3A 1TKYA 4A20A 1K51A 3IAS1 2W82A 2CHXA 2L05A 1L4ZB 3AULA 4W9EA 2XNAC 4DHZE 4REZA 1YJIA 5G5HA 3I63C 3DVNU 2LXCA 4LCDE 3P2BA 3DWGC 5FK9C 5AZFA 2IO2B 5IOIA 4F7ZA 1WR1A 4I6PA 5H92C 3OJ4B 1T0QC 4MGYE 1LXDA 4KGTA 2IZVB 3AE2B 1AW7A 4KGRA 2DYMA 2D07B 1UELA 1EM7A 1CZPA 1YQ3B 3BK1A 3QAQA 3ZDTA 1XCQL 3IHPC 3MHZA 2NR2A 2QDFA 1V6EA 1DGJA 3RMKC 1L6UA 3V62A 3ZQ4A 1TYGB 2JZZA 4TQ0A 4PS3A 1YD8U 3LXFA 3DWMA 1CK1A 1PGAA 4MGIE 2AL6A 2FAZA 3L08A 1JRPA 4G11A 2XK5A 4TKNA 2KWVB 1PGBA 2BW2A 1PDXA 1I4QA 2D3GA 4LTUA 2BWFA 1T6BX 2LRUA 1IP9A 4OW0A 2CHWA 2N9PC 1EU3A 1F2RI 1J7BA 2N9XA 3U2SC 2IJ0A 3Q3FA 1WM2A 4HPMB 1I4GA 2X8XX 4WQMA 1OGWA 3FILA 3L10B 4KSLC 4M00A 1FD6A 1VR9A 3PZDA 3CSTA 4FJYA 4RM9A 2GMIC 4MM3A 1IYFA 3U7ZA 2YEPF 2VRRB 3APFA 2MHJA 2ZEQA 2KXJA 4US8A 1C4AA 3ZLZA 1ZOYB 2NCNA 1UGMA 4IWPA 2GRIA 3Q14C 4B6WA 4DBGA 1K50A 3PGEA 1S1QB 1YJJA 3NY5A 3PREA 4EZKA 4RH6A 1M94A 2LUMA 1WX7A 1WSPA 2BGFA 3UQBA 1IBXB 4ANWA 2MW5A 2KO3A 2Y5PA 4XDCA 3AU4A 4DHZB 1SGHA 2ZW0A 3W1SC 1XLOA 3R7RA 3W2DA 2RD0A 3AH7A 3OAWA 1D5MC 3HIZA 4HJKA 1WJ4A 1TGZB 3RT3B 5D6JB 2PVOD 4N58A 5IAAC 3PHWB
chains in the Genus database with same CATH topology
2K25A 4M8NA 3VTVA 5AEKB 3PPAA 5G2NA 2ZNVC 3TJPA 4IM0A 4CYEA 3DPDA 2N1VA 4K7UA 1WZ3A 1WJ6A 1G6JA 1WXSA 3ECIA 3UQAA 1WFYA 4ZDVA 2JRHA 2K8HA 3VUWA 3ZDMC 5C1ZA 3PLUA 3K9OB 3W1SA 1HE8A 3PV1A 5J18A 4XZ4A 3ML8A 4URKA 2KLGA 4ANXA 5L95C 1TBEA 1J19A 1P98A 3V61A 3CF6E 2KWUB 3KVFB 2MQJA 4TV3A 5BO4B 5JHAA 1WXAA 2M8SA 2N9EB 5JH5C 4HWIB 2I1JA 4FULA 1E8YA 3LDZE 4M8MA 1X1MA 4MJSB 1E8WA 1ZKHA 4ANUA 2CHZA 1H8CA 3UF8A 3M3JA 1MG8A 3SDLC 4XC2A 4B9KA 3GOEA 4ZYNA 1V86A 2JUOA 1EO6A 4GDKA 2XBBC 1EF1A 2NPTA 2NBWB 3A9JA 2KDIA 1WJNA 3TL5A 2D2QA 2DHZA 1AARA 4I6NB 3KW5B 4G50A 3VH3B 1IPGA 2LGDA 3CMMB 4PYUA 4W9HA 4K1RB 5CHWA 2G4DB 2MBBB 4BKGA 3BY4B 4E74A 2G4SA 4NQKE 3TCAA 2BYVE 2K1FA 5D2MB 2C7HA 1WY8A 3ZUNA 4EFOA 2KANA 3ZNZB 4LDTD 2I1KA 2JZ3B 3H7SA 4GMVA 2PPHA 2IO0B 3DOWA 3EHVA 2DX5B 1KLVA 4II3B 2ZCBA 5FR6A 2HE7A 3DQVA 4GDLB 4EOYA 4AWJA 4ZRKA 3R3MA 2KVRA 4HK2A 3MJWA 1CMXB 3QJZA 2M1MA 2EKEC 2YVCA 4F8CB 1KOTA 2JRIB 3NS8A 3R66C 1WM3A 3H6NA 5DPWA 3L13A 3WAOA 2UWQA 2AYOB 4GXBA 2K8CA 1WH3A 2PE9A 1Z2MA 1LFDA 2MA9B 4WWPA 3V6EB 2AWTA 1EF5A 4WJOA 1NI2A 2A5UA 1C1YB 3A4SC 3M95A 5J2RA 1D3ZA 4YL8A 4JQWC 4W9CA 4DDGD 1WR6E 2D10A 1GG3A 2LRWA 3DBHI 4X57B 3TBLD 2AL3A 3WANA 2G3QB 3VHTC 4BKTA 2MWSB 3PTFC 5E6NA 3IG3A 1SIFA 2FCQA 1S3SG 1QZEA 3K9PB 1VCBA 4G0NB 1J8CA 4W9DA 3OLMD 4CO7A 4GB9A 2DZKA 2N4FA 4AJWA 3B1LX 2KD0A 1BT0A 2KMAA 2Y5BB 2MSED 3M62B 2PE6B 4MGZE 4K81A 3RYTA 5KHOA 2LGXA 4FHKA 2GBKA 2BWES 3ZW3A 4DDID 1RRBA 2DZMA 2O2VA 1E7VA 2L8JA 2MBHA 2PEAA 3O65B 2MCNB 2PJHA 3X23A 2GBJA 4GDKB 2O6VB 2RSUA 1WJUA 2JF5A 3ZNHB 2IY1B 2WYQA 4DXAB 4EUTA 3QWZB 4WJNA 3N32A 5HKHA 2LVPA 4NJ6A 3ZVVA 1E7UA 2ZJDA 4MEMA 4DHJD 3N30A 3DBRI 1F9JA 2KFJA 3H9DA 4E71A 2YLMA 2WX0A 1YX6B 1UD7A 2JVCA 3A1QA 4BBNC 4BKSA 5GMVA 5LXHA 1WGRA 4WWNA 1L7YA 1I35A 4NQLB 3ZTCA 4W9GA 1V5TA 3PSEB 2DAJA 4FJVB 5DPSA 3N3KB 3A9JB 1WZ0A 4M0WB 3BINA 3VTWA 1Q1OA 2BYEA 3ONSA 4EKUA 5E6OA 2L76A 4HDOA 2W9NA 4AJYB 1GC7A 1P0RA 2KX3A 2LUEA 2DYOA 4KZCA 2FIDA 1XD3B 2Z0DB 3APDA 3JYUA 4NAWB 3UIOB 1ISNA 3B08A 3OJ3A 3PRZA 3L54A 2EMSA 1E8ZA 4GSWA 4GDLA 1WXMA 4IG7B 3B0AA 3UINB 3H1UA 1TTNA 4NJ7A 3ZRFA 2MLBA 1WE6A 2V4LA 3I3TB 3T8MA 2M17A 5D7GA 4DHJB 4OVUA 3A9KA 3ENEA 2MBQA 3NHEB 2M0XA 1V9JA 4XX5A 4BOZB 4TQ1A 3KH0A 2N1WA 4KDLB 3ZIMA 4BOSC 2KZRA 2KQSA 3MTNB 4B95A 2OOBB 1Y8RC 4EZLA 2CU1A 4FJZA 1WGDA 3GZNI 4LJOB 2IO1B 2KJHB 4KIKA 1WGGA 2FNJB 1OTRB 2IYDB 4K7SA 5L83A 4ZRIA 3ZRCA 1KJTA 2O6VA 2LZ6A 5AZHA 1R4MI 4JLCA 3W1YA 4LJPB 3HK0A 2ZCCA 2MBOA 1V81A 1YIWA 2K6DB 1WX9A 3RD2A 3U7DA 3A1QB 2J0KA 1C3TA 4TUUA 2ASQA 2GOWA 1SE9A 1PQSA 5LXIB 1FXTB 5DPRA 2KN5A 4PS8A 3ZO5B 2GBNA 2IY0B 1GUAB 1YJ1A 1JRUA 2A4ZA 3ZNGC 2BF8B 1T0YA 2C7NB 3QARA 2GBMA 3ZKJC 2LWPA 2KFKA 4GN1A 4K7WA 2C9WB 2WDTB 4MSMB 1V49A 3RZWC 4W9JA 3JVZX 2J0MA 3LJ3A 2BYFA 4RM8A 4DWFA 4FA6A 3AXCA 3PVLA 2FIFA 3KYDD 2QHOA 4JGHB 2KK8A 1UBQA 4IM2A 4NAWA 3AI5A 2KX0A 2MP2A 4FHJA 2KJ6A 2HD5B 1OEYJ 3SU8X 1WXVA 2C5LC 2RGFA 1OQYA 1V80A 4KSKC 4LDTB 4A3PA 2LVQA 4W9FA 1NDDA 2EMTA 3DBLI 1TZ1A 3KUDB 2JWZA 3PRMB 4MELA 2FCNA 1WX8A 2KFKB 4RMAA 5CX3A 2JY6A 3VXWA 2J0JA 2KWCA 1E5WA 4IC7B 4W9LA 5J17A 2LXAA 1YX5B 2N7DA 3EFUA 3NZSA 4KDIC 2BKFA 4FLHA 4KIKB 3HM3A 4MGKE 2KMCA 4MH0E 4BFRA 1WGHA 2UYZB 1WRDB 1RLFA 5AZGA 1ZW7A 3DVNV 3VH4B 1RAXA 2L0FA 5IA7A 1P9DU 1V5OA 1GJZA 4W9KA 5C23A 1Q0WB 3S2AA 2MP2B 2JXXA 1RFAA 4A20A 2NBUA 3AU5A 2CHXA 3KUCB 2L05A 1Z5SB 4MJSA 4BBNF 5G55A 3QHTA 3AULA 3PHXB 4W9EA 4II2B 4DHZE 3V6CB 3WIMA 4WQOB 2KDFB 4BVUC 4EEWA 3RUIB 3RULA 2R2QA 2RR9A 2DAFA 3DVNU 2G45B 3HHMA 1WI0A 2JPHA 2LXCA 1YQBA 4LCDE 3P2BA 3TMPB 4IW0A 2O2VB 5AZFA 4DK5A 2IO2B 4F7ZA 1WR1A 2KQ7A 3A4RA 3JSVA 5D94A 1LM8B 2FCMA 4I6PA 3IBEA 3QK0A 5CHVC 3OJ4B 4KVGB 4HCPB 3VVWB 3UIPB 2JT4B 3T9LA 3C0RB 4MGYE 1U4AA 2C7MB 2K39A 1LXDA 2IZVB 4NNJB 1GNUA 4FN2A 3QCAA 2DYMA 4HCNB 3QQ8B 3WAPA 2D07B 1A5RA 1UELA 4IUMB 4ZRJA 3NOBA 4ASWC 2B3AA 2ZZPB 3PLVA 2L0TA 1V2YA 3QAQA 1WGYA 2L00B 3ZDTA 3IHPC 4HXDA 2NR2A 3A33B 3PT2B 3VQIA 1NBFC 3D32A 2IBIB 1V6EA 2GBRA 2C60A 3H7PA 3DCGA 3HM6X 4JL9A 3V62A 3QC8B 2XEWA 3ZTDA 3NZUA 2N7EA 2REXA 2LGYA 3ML9A 4HPLB 2JZZA 4TQ0A 1WMHA 2LJ5A 2CR5A 2L3ZA 4G3XB 4PS3A 1YD8U 2LASA 3KUZA 2DYBA 1UH6A 3KYCD 4IWQA 4KZ0A 4WWOA 2FUHB 2LI5A 3IVFA 4MGIE 2AL6A 2FAZA 3SHQA 4PYZA 2MBEA 3L08A 2ZNVB 4BKSD 3U8ZA 3V60A 4G11A 1LQBA 4I6LB 3Q3JA 3EECA 2KHWB 2XK5A 2KWVB 4TKNA 1E8XA 2WWZA 4ICVA 4MSQB 2AEHA 4A3OA 2KKCA 1L2NA 4E3CA 2D3GA 4OVVA 4WJPA 1J0GA 2BWFA 3H7PB 2LRUA 1H4RA 2CKHB 1IP9A 3M63B 3VFKA 2KLCA 2CHWA 2N9PC 4GU2A 4MDKE 1WMHB 1WF9A 2NPTB 2IO3B 2N9XA 4AOFA 3U30A 4GGQA 3PRPB 3Q3FA 1Q5WB 5CHFA 3RZFA 1WM2A 4HPMB 2ZPYA 5KHQA 2KNBA 5CTRC 2LD9A 4PS7A 5EDSA 3WAMA 1OGWA 4ICUA 5TR5A 2DZJA 1KM7A 4IWOA 1UZXB 5DPTA 4AP4C 4EZJA 3QA8A 4GIVA 2NVUI 3L10B 2KTRB 1K8RB 1XQQA 4KSLC 2ZVNA 3DBSA 3DVGX 1GC6A 3TIXA 3PZDA 3L0WB 2K6QA 4FBJB 3WA0A 3ZNID 3CSTA 2V3SA 4P7IA 2MRPA 4FJYA 4RM9A 2GMIC 4MM3A 1IYFA 3DVGY 3WALA 2VRRB 3APFA 3APCA 5JHBA 2BPSA 1UBIA 1R4NI 2Z0EB 2ZVOA 1I42A 2KTFA 5E6PA 2ZEQA 4AUQC 4W9IA 2KXJA 1EUVB 1E90A 3IFWB 3VTUA 3X0WA 3ZLZA 3SD5A 3MHSD 2NCNA 1XT9B 2K8BA 1UGMA 4IWPA 4IM3A 4NPNA 2NBVB 3JW0X 4B6WA 4DBGA 2V1YA 2RPQA 4NY0A 3PGEA 2DZIA 2J7QB 3DDCB 1S1QB 1OEYA 3VUYA 2O6VD 4JIOU 3NY5A 3PREA 2HJ8A 4EZKA 2FCSA 1M94A 2HTHA 1WX7A 2DENB 2BGFA 3L16A 5DCNA 5LLIA 3UQBA 2D11A 1ZGUB 4WJQA 4ANWA 2MW5A 5JZEB 2KO3A 2KDBA 3AU4A 2KDEB 4DHZB 4J6IA 3EC8A 1SGHA 3QIJA 2L7RA 2KC1A 2R2OA 2MX2A 4CHKA 3VUXA 3JSVB 4ANVA 4HLEA 2WX1A 1P3QU 4N9F4 4HDQA 3VDZA 2M4NA 3W1SC 1WYWB 4WAAA 2KJRA 1P1AA 2NS5A 3PS6A 3QX1A 3RCZA 2XK5B 3R7RA 2RD0A 3OAWA 4F1SA 3UGBB 4HVBA 3HIZA 2LVOA 1WE7A 4GOCA 2KTRA 2CS4A 4FADA 4HJKA 1WJ4A 1TGZB 2KOXA 3CSFA 4KV2A 3RT3B 3A9KB 1WIAA 3R7QA 2BKRB 2ZPNA 2KC2A 5D6JB 3VAWA 3ALBA 1VD2A 2OJRA 5IAAC 3PHWB 2Z59B 3L17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K25 A;  4M8N A;  3VTV A;  5AEK B;  3PPA A;  5G2N A;  2ZNV C;  3TJP A;  4IM0 A;  4CYE A;  3DPD A;  2N1V A;  4K7U A;  1WZ3 A;  1WJ6 A;  1G6J A;  1WXS A;  3ECI A;  3UQA A;  1WFY A;  4ZDV A;  2JRH A;  2K8H A;  3VUW A;  3ZDM C;  5C1Z A;  3PLU A;  3K9O B;  3W1S A;  1HE8 A;  3PV1 A;  5J18 A;  4XZ4 A;  3ML8 A;  4URK A;  2KLG A;  4ANX A;  5L95 C;  1TBE A;  1J19 A;  1P98 A;  3V61 A;  3CF6 E;  2KWU B;  3KVF B;  2MQJ A;  4TV3 A;  5BO4 B;  5JHA A;  1WXA A;  2M8S A;  2N9E B;  5JH5 C;  4HWI B;  2I1J A;  4FUL A;  1E8Y A;  3LDZ E;  4M8M A;  1X1M A;  4MJS B;  1E8W A;  1ZKH A;  4ANU A;  2CHZ A;  1H8C A;  3UF8 A;  3M3J A;  1MG8 A;  3SDL C;  4XC2 A;  4B9K A;  3GOE A;  4ZYN A;  1V86 A;  2JUO A;  1EO6 A;  4GDK A;  2XBB C;  1EF1 A;  2NPT A;  2NBW B;  3A9J A;  2KDI A;  1WJN A;  3TL5 A;  2D2Q A;  2DHZ A;  1AAR A;  4I6N B;  3KW5 B;  4G50 A;  3VH3 B;  1IPG A;  2LGD A;  3CMM B;  4PYU A;  4W9H A;  4K1R B;  5CHW A;  2G4D B;  2MBB B;  4BKG A;  3BY4 B;  4E74 A;  2G4S A;  4NQK E;  3TCA A;  2BYV E;  2K1F A;  5D2M B;  2C7H A;  1WY8 A;  3ZUN A;  4EFO A;  2KAN A;  3ZNZ B;  4LDT D;  2I1K A;  2JZ3 B;  3H7S A;  4GMV A;  2PPH A;  2IO0 B;  3DOW A;  3EHV A;  2DX5 B;  1KLV A;  4II3 B;  2ZCB A;  5FR6 A;  2HE7 A;  3DQV A;  4GDL B;  4EOY A;  4AWJ A;  4ZRK A;  3R3M A;  2KVR A;  4HK2 A;  3MJW A;  1CMX B;  3QJZ A;  2M1M A;  2EKE C;  2YVC A;  4F8C B;  1KOT A;  2JRI B;  3NS8 A;  3R66 C;  1WM3 A;  3H6N A;  5DPW A;  3L13 A;  3WAO A;  2UWQ A;  2AYO B;  4GXB A;  2K8C A;  1WH3 A;  2PE9 A;  1Z2M A;  1LFD A;  2MA9 B;  4WWP A;  3V6E B;  2AWT A;  1EF5 A;  4WJO A;  1NI2 A;  2A5U A;  1C1Y B;  3A4S C;  3M95 A;  5J2R A;  1D3Z A;  4YL8 A;  4JQW C;  4W9C A;  4DDG D;  1WR6 E;  2D10 A;  1GG3 A;  2LRW A;  3DBH I;  4X57 B;  3TBL D;  2AL3 A;  3WAN A;  2G3Q B;  3VHT C;  4BKT A;  2MWS B;  3PTF C;  5E6N A;  3IG3 A;  1SIF A;  2FCQ A;  1S3S G;  1QZE A;  3K9P B;  1VCB A;  4G0N B;  1J8C A;  4W9D A;  3OLM D;  4CO7 A;  4GB9 A;  2DZK A;  2N4F A;  4AJW A;  3B1L X;  2KD0 A;  1BT0 A;  2KMA A;  2Y5B B;  2MSE D;  3M62 B;  2PE6 B;  4MGZ E;  4K81 A;  3RYT A;  5KHO A;  2LGX A;  4FHK A;  2GBK A;  2BWE S;  3ZW3 A;  4DDI D;  1RRB A;  2DZM A;  2O2V A;  1E7V A;  2L8J A;  2MBH A;  2PEA A;  3O65 B;  2MCN B;  2PJH A;  3X23 A;  2GBJ A;  4GDK B;  2O6V B;  2RSU A;  1WJU A;  2JF5 A;  3ZNH B;  2IY1 B;  2WYQ A;  4DXA B;  4EUT A;  3QWZ B;  4WJN A;  3N32 A;  5HKH A;  2LVP A;  4NJ6 A;  3ZVV A;  1E7U A;  2ZJD A;  4MEM A;  4DHJ D;  3N30 A;  3DBR I;  1F9J A;  2KFJ A;  3H9D A;  4E71 A;  2YLM A;  2WX0 A;  1YX6 B;  1UD7 A;  2JVC A;  3A1Q A;  4BBN C;  4BKS A;  5GMV A;  5LXH A;  1WGR A;  4WWN A;  1L7Y A;  1I35 A;  4NQL B;  3ZTC A;  4W9G A;  1V5T A;  3PSE B;  2DAJ A;  4FJV B;  5DPS A;  3N3K B;  3A9J B;  1WZ0 A;  4M0W B;  3BIN A;  3VTW A;  1Q1O A;  2BYE A;  3ONS A;  4EKU A;  5E6O A;  2L76 A;  4HDO A;  2W9N A;  4AJY B;  1GC7 A;  1P0R A;  2KX3 A;  2LUE A;  2DYO A;  4KZC A;  2FID A;  1XD3 B;  2Z0D B;  3APD A;  3JYU A;  4NAW B;  3UIO B;  1ISN A;  3B08 A;  3OJ3 A;  3PRZ A;  3L54 A;  2EMS A;  1E8Z A;  4GSW A;  4GDL A;  1WXM A;  4IG7 B;  3B0A A;  3UIN B;  3H1U A;  1TTN A;  4NJ7 A;  3ZRF A;  2MLB A;  1WE6 A;  2V4L A;  3I3T B;  3T8M A;  2M17 A;  5D7G A;  4DHJ B;  4OVU A;  3A9K A;  3ENE A;  2MBQ A;  3NHE B;  2M0X A;  1V9J A;  4XX5 A;  4BOZ B;  4TQ1 A;  3KH0 A;  2N1W A;  4KDL B;  3ZIM A;  4BOS C;  2KZR A;  2KQS A;  3MTN B;  4B95 A;  2OOB B;  1Y8R C;  4EZL A;  2CU1 A;  4FJZ A;  1WGD A;  3GZN I;  4LJO B;  2IO1 B;  2KJH B;  4KIK A;  1WGG A;  2FNJ B;  1OTR B;  2IYD B;  4K7S A;  5L83 A;  4ZRI A;  3ZRC A;  1KJT A;  2O6V A;  2LZ6 A;  5AZH A;  1R4M I;  4JLC A;  3W1Y A;  4LJP B;  3HK0 A;  2ZCC A;  2MBO A;  1V81 A;  1YIW A;  2K6D B;  1WX9 A;  3RD2 A;  3U7D A;  3A1Q B;  2J0K A;  1C3T A;  4TUU A;  2ASQ A;  2GOW A;  1SE9 A;  1PQS A;  5LXI B;  1FXT B;  5DPR A;  2KN5 A;  4PS8 A;  3ZO5 B;  2GBN A;  2IY0 B;  1GUA B;  1YJ1 A;  1JRU A;  2A4Z A;  3ZNG C;  2BF8 B;  1T0Y A;  2C7N B;  3QAR A;  2GBM A;  3ZKJ C;  2LWP A;  2KFK A;  4GN1 A;  4K7W A;  2C9W B;  2WDT B;  4MSM B;  1V49 A;  3RZW C;  4W9J A;  3JVZ X;  2J0M A;  3LJ3 A;  2BYF A;  4RM8 A;  4DWF A;  4FA6 A;  3AXC A;  3PVL A;  2FIF A;  3KYD D;  2QHO A;  4JGH B;  2KK8 A;  1UBQ A;  4IM2 A;  4NAW A;  3AI5 A;  2KX0 A;  2MP2 A;  4FHJ A;  2KJ6 A;  2HD5 B;  1OEY J;  3SU8 X;  1WXV A;  2C5L C;  2RGF A;  1OQY A;  1V80 A;  4KSK C;  4LDT B;  4A3P A;  2LVQ A;  4W9F A;  1NDD A;  2EMT A;  3DBL I;  1TZ1 A;  3KUD B;  2JWZ A;  3PRM B;  4MEL A;  2FCN A;  1WX8 A;  2KFK B;  4RMA A;  5CX3 A;  2JY6 A;  3VXW A;  2J0J A;  2KWC A;  1E5W A;  4IC7 B;  4W9L A;  5J17 A;  2LXA A;  1YX5 B;  2N7D A;  3EFU A;  3NZS A;  4KDI C;  2BKF A;  4FLH A;  4KIK B;  3HM3 A;  4MGK E;  2KMC A;  4MH0 E;  4BFR A;  1WGH A;  2UYZ B;  1WRD B;  1RLF A;  5AZG A;  1ZW7 A;  3DVN V;  3VH4 B;  1RAX A;  2L0F A;  5IA7 A;  1P9D U;  1V5O A;  1GJZ A;  4W9K A;  5C23 A;  1Q0W B;  3S2A A;  2MP2 B;  2JXX A;  1RFA A;  4A20 A;  2NBU A;  3AU5 A;  2CHX A;  3KUC B;  2L05 A;  1Z5S B;  4MJS A;  4BBN F;  5G55 A;  3QHT A;  3AUL A;  3PHX B;  4W9E A;  4II2 B;  4DHZ E;  3V6C B;  3WIM A;  4WQO B;  2KDF B;  4BVU C;  4EEW A;  3RUI B;  3RUL A;  2R2Q A;  2RR9 A;  2DAF A;  3DVN U;  2G45 B;  3HHM A;  1WI0 A;  2JPH A;  2LXC A;  1YQB A;  4LCD E;  3P2B A;  3TMP B;  4IW0 A;  2O2V B;  5AZF A;  4DK5 A;  2IO2 B;  4F7Z A;  1WR1 A;  2KQ7 A;  3A4R A;  3JSV A;  5D94 A;  1LM8 B;  2FCM A;  4I6P A;  3IBE A;  3QK0 A;  5CHV C;  3OJ4 B;  4KVG B;  4HCP B;  3VVW B;  3UIP B;  2JT4 B;  3T9L A;  3C0R B;  4MGY E;  1U4A A;  2C7M B;  2K39 A;  1LXD A;  2IZV B;  4NNJ B;  1GNU A;  4FN2 A;  3QCA A;  2DYM A;  4HCN B;  3QQ8 B;  3WAP A;  2D07 B;  1A5R A;  1UEL A;  4IUM B;  4ZRJ A;  3NOB A;  4ASW C;  2B3A A;  2ZZP B;  3PLV A;  2L0T A;  1V2Y A;  3QAQ A;  1WGY A;  2L00 B;  3ZDT A;  3IHP C;  4HXD A;  2NR2 A;  3A33 B;  3PT2 B;  3VQI A;  1NBF C;  3D32 A;  2IBI B;  1V6E A;  2GBR A;  2C60 A;  3H7P A;  3DCG A;  3HM6 X;  4JL9 A;  3V62 A;  3QC8 B;  2XEW A;  3ZTD A;  3NZU A;  2N7E A;  2REX A;  2LGY A;  3ML9 A;  4HPL B;  2JZZ A;  4TQ0 A;  1WMH A;  2LJ5 A;  2CR5 A;  2L3Z A;  4G3X B;  4PS3 A;  1YD8 U;  2LAS A;  3KUZ A;  2DYB A;  1UH6 A;  3KYC D;  4IWQ A;  4KZ0 A;  4WWO A;  2FUH B;  2LI5 A;  3IVF A;  4MGI E;  2AL6 A;  2FAZ A;  3SHQ A;  4PYZ A;  2MBE A;  3L08 A;  2ZNV B;  4BKS D;  3U8Z A;  3V60 A;  4G11 A;  1LQB A;  4I6L B;  3Q3J A;  3EEC A;  2KHW B;  2XK5 A;  2KWV B;  4TKN A;  1E8X A;  2WWZ A;  4ICV A;  4MSQ B;  2AEH A;  4A3O A;  2KKC A;  1L2N A;  4E3C A;  2D3G A;  4OVV A;  4WJP A;  1J0G A;  2BWF A;  3H7P B;  2LRU A;  1H4R A;  2CKH B;  1IP9 A;  3M63 B;  3VFK A;  2KLC A;  2CHW A;  2N9P C;  4GU2 A;  4MDK E;  1WMH B;  1WF9 A;  2NPT B;  2IO3 B;  2N9X A;  4AOF A;  3U30 A;  4GGQ A;  3PRP B;  3Q3F A;  1Q5W B;  5CHF A;  3RZF A;  1WM2 A;  4HPM B;  2ZPY A;  5KHQ A;  2KNB A;  5CTR C;  2LD9 A;  4PS7 A;  5EDS A;  3WAM A;  1OGW A;  4ICU A;  5TR5 A;  2DZJ A;  1KM7 A;  4IWO A;  1UZX B;  5DPT A;  4AP4 C;  4EZJ A;  3QA8 A;  4GIV A;  2NVU I;  3L10 B;  2KTR B;  1K8R B;  1XQQ A;  4KSL C;  2ZVN A;  3DBS A;  3DVG X;  1GC6 A;  3TIX A;  3PZD A;  3L0W B;  2K6Q A;  4FBJ B;  3WA0 A;  3ZNI D;  3CST A;  2V3S A;  4P7I A;  2MRP A;  4FJY A;  4RM9 A;  2GMI C;  4MM3 A;  1IYF A;  3DVG Y;  3WAL A;  2VRR B;  3APF A;  3APC A;  5JHB A;  2BPS A;  1UBI A;  1R4N I;  2Z0E B;  2ZVO A;  1I42 A;  2KTF A;  5E6P A;  2ZEQ A;  4AUQ C;  4W9I A;  2KXJ A;  1EUV B;  1E90 A;  3IFW B;  3VTU A;  3X0W A;  3ZLZ A;  3SD5 A;  3MHS D;  2NCN A;  1XT9 B;  2K8B A;  1UGM A;  4IWP A;  4IM3 A;  4NPN A;  2NBV B;  3JW0 X;  4B6W A;  4DBG A;  2V1Y A;  2RPQ A;  4NY0 A;  3PGE A;  2DZI A;  2J7Q B;  3DDC B;  1S1Q B;  1OEY A;  3VUY A;  2O6V D;  4JIO U;  3NY5 A;  3PRE A;  2HJ8 A;  4EZK A;  2FCS A;  1M94 A;  2HTH A;  1WX7 A;  2DEN B;  2BGF A;  3L16 A;  5DCN A;  5LLI A;  3UQB A;  2D11 A;  1ZGU B;  4WJQ A;  4ANW A;  2MW5 A;  5JZE B;  2KO3 A;  2KDB A;  3AU4 A;  2KDE B;  4DHZ B;  4J6I A;  3EC8 A;  1SGH A;  3QIJ A;  2L7R A;  2KC1 A;  2R2O A;  2MX2 A;  4CHK A;  3VUX A;  3JSV B;  4ANV A;  4HLE A;  2WX1 A;  1P3Q U;  4N9F 4;  4HDQ A;  3VDZ A;  2M4N A;  3W1S C;  1WYW B;  4WAA A;  2KJR A;  1P1A A;  2NS5 A;  3PS6 A;  3QX1 A;  3RCZ A;  2XK5 B;  3R7R A;  2RD0 A;  3OAW A;  4F1S A;  3UGB B;  4HVB A;  3HIZ A;  2LVO A;  1WE7 A;  4GOC A;  2KTR A;  2CS4 A;  4FAD A;  4HJK A;  1WJ4 A;  1TGZ B;  2KOX A;  3CSF A;  4KV2 A;  3RT3 B;  3A9K B;  1WIA A;  3R7Q A;  2BKR B;  2ZPN A;  2KC2 A;  5D6J B;  3VAW A;  3ALB A;  1VD2 A;  2OJR A;  5IAA C;  3PHW B;  2Z59 B;  3L17 A; 
#chains in the Genus database with same CATH topology
 2K25 A;  3ZJU A;  1JWB D;  1HA5 A;  2N1V A;  3Q3O C;  1WZ3 A;  1WJ6 A;  4K7U A;  5GXG B;  1WXS A;  1UUP A;  4ZDV A;  2N9K A;  3VUW A;  1YMH E;  2J4X A;  3L4P A;  3PLU A;  1HE8 A;  3ML8 A;  1XLN A;  4URK A;  2KLG A;  3MC0 B;  4ANX A;  1J19 A;  2R61 A;  4A6Q A;  3CF6 E;  1KF6 B;  4TV3 A;  1WXA A;  2M8S A;  2I1J A;  1X1M A;  2CHZ A;  1GOZ A;  1XCT L;  3DBR B;  2CU3 A;  4LNF A;  1V86 A;  2XBB C;  1EF1 A;  1WJN A;  2J53 A;  3Q8C A;  2K1F A;  3MC9 A;  2C7H A;  4RGO S;  4L23 A;  2JZ3 B;  2PPH A;  1ZXH A;  2IO0 B;  2DX5 B;  1V97 A;  1K53 A;  4II3 B;  2ZCB A;  1N60 A;  5FR6 A;  2HE7 A;  3DQV A;  4GDL B;  2W3S A;  2KVR A;  1ZDV A;  3MJW A;  1KOT A;  2JRI B;  3H6N A;  1FMA D;  1QT9 A;  2AYO B;  2FBW B;  4GXB A;  3V6E B;  5EE9 A;  3VRB B;  4JWS C;  3A4S C;  3GE3 C;  1JWA D;  3TBL D;  2G3Q B;  4HKQ A;  3UI3 A;  4ITK A;  2MWS B;  2XN9 C;  4ZYS A;  3KQ4 A;  1QZE A;  1VCB A;  3ZJV A;  4GB9 A;  2N4F A;  3B1L X;  4LNI A;  2BS3 B;  2GBK A;  3ZW3 A;  4DDI D;  2DZM A;  2MCN B;  2WLB A;  2EKI A;  2PJH A;  4GDK B;  1HXY D;  2WYQ A;  4WJN A;  3N32 A;  3AM9 A;  3ZVV A;  3P4S B;  2WXP A;  4C80 A;  2JVC A;  4BKS A;  5LXH A;  4WWN A;  1I35 A;  4NQL B;  3PSE B;  3AE5 B;  4FJV B;  3N3K B;  4AQ7 A;  1WZ0 A;  2N9L A;  2JWU A;  3DBL B;  3VTW A;  3BYT B;  4TSS A;  4C7Z A;  4EKU A;  2L76 A;  4R3D A;  4HRS A;  2GI9 A;  3UIO B;  4NAW B;  4OZC A;  4TMA B;  4C56 C;  2LEK A;  3L54 A;  1SB3 C;  1E8Z A;  1L0X B;  4GDL A;  1WXM A;  2KT7 A;  1N6Z A;  2KMM A;  3H1U A;  1TTN A;  4GLS C;  3I3T B;  4OVU A;  4RGT A;  3ENE A;  4XX5 A;  2UU7 A;  3KH0 A;  1F52 A;  2N1W A;  3MTN B;  2KQS A;  2PMV A;  2OOB B;  4UDU C;  2CU1 A;  4LJO B;  2IO1 B;  1OTR B;  2IYD B;  1I4H A;  1XXG A;  1B1Z A;  2LZ6 A;  1LO5 D;  4FXC A;  3AE9 B;  1YIW A;  2K6D B;  3RD2 A;  1WX9 A;  3U7D A;  1C3T A;  2ASQ A;  1SE9 A;  1E6E B;  2KN5 A;  1PYW D;  1I4R A;  2IY0 B;  1YJ1 A;  1STE A;  2PLP A;  2C7N B;  2GBM A;  3ZKJ C;  2G1E A;  5G5G A;  1FFV A;  1FO4 A;  1GB4 A;  2BYF A;  4XGA B;  3AXC A;  3KYD D;  2WU2 B;  2KK8 A;  3T3O A;  1UBQ A;  4IM2 A;  3MFG A;  1OEY J;  5BMG A;  1QLB B;  2LVQ A;  3U52 E;  1TS2 A;  1NDD A;  3X23 A;  1L2N A;  2FCN A;  3VXW A;  4LK0 M;  4W9L A;  5J17 A;  3W5V B;  4K3C A;  3W9C B;  1FEH A;  3HM3 A;  3J9C A;  1RLF A;  5AZG A;  1ZW7 A;  2WXK A;  5FKA C;  1ZXI A;  1GJZ A;  4W9K A;  3S2A A;  5EE0 A;  4WAF A;  3NS1 A;  3Q8F A;  1Q10 A;  3H8H A;  4BBN F;  1Z5S B;  4MJS A;  5G55 A;  4JE3 B;  2WS3 B;  3QHT A;  5JXV A;  1MHH E;  4C4V B;  4II2 B;  3V6C B;  2DWQ A;  3NRZ A;  4WQO B;  2H88 B;  3WCQ A;  4EEW A;  3P4P B;  3RUI B;  3RUL A;  2BVC A;  1WI0 A;  1VZ8 A;  2D3B A;  5BMI A;  3JSV A;  5D94 A;  1LM8 B;  2FCM A;  2INP E;  1ENF A;  2SAK A;  4HCP B;  2D5G A;  3VVW B;  3UIP B;  3NVZ A;  1U4A A;  1TS5 A;  1SE4 A;  1A5R A;  3HVZ A;  4ZRJ A;  3NOB A;  4ASW C;  4KKI A;  3MC8 A;  2B76 B;  3AE4 B;  2IBI B;  2C60 A;  1N62 A;  3QC8 B;  2JYT A;  2XEW A;  2REX A;  1IBX A;  3ML9 A;  2CR5 A;  2L3Z A;  3KUZ A;  1JWM D;  2WXN A;  4IWQ A;  4KZ0 A;  4WWO A;  2FUH B;  2CJO A;  2LI5 A;  1AYF A;  3IVF A;  1HTQ A;  3SHQ A;  1HTO A;  1D5X C;  4BKS D;  3Q3J A;  1SSN A;  1V1P A;  3EEC A;  2KHW B;  2WWZ A;  4ICV A;  4MSQ B;  2AEH A;  4A3O A;  2WDR B;  4WJP A;  3H7P B;  5T8I A;  3Q8E A;  3M63 B;  2WXH A;  2KLC A;  4GU2 A;  2Y3A A;  2K9X A;  2LMC A;  3U30 A;  2Y5C A;  1JQ4 A;  3PRP B;  5CHF A;  2DLB A;  4PS7 A;  3NVW A;  5EDS A;  1MVK A;  3R8B A;  2HTM E;  5DPT A;  3RNE C;  4AP4 C;  2L52 A;  1C78 A;  2RDH A;  1XQQ A;  1LGR A;  1GC6 A;  2K6Q A;  3PZ7 A;  2BS2 B;  1DYQ A;  2LGS A;  1TKG A;  2V3N A;  2QCZ A;  1FM0 D;  2V9H A;  2MH7 A;  1ZDX A;  1MFW A;  2K3U A;  1R4N I;  2Z0E B;  1GPX A;  4XWT A;  4MAC A;  2NTT A;  3N20 C;  4W9I A;  4XYC A;  1V8C A;  3TSS A;  1EUV B;  3Q69 A;  1YN5 A;  2W3R A;  1XT9 B;  2K8B A;  4J3O D;  5D3I B;  3JW0 X;  2RPQ A;  2HJ1 A;  4NY0 A;  2DZI A;  3DDC B;  2O6V D;  1FNV A;  2HJ8 A;  2FCS A;  4LNK A;  1JAL A;  2DEN B;  3DHG C;  5E6J A;  3RNC C;  1ZGU B;  5JZE B;  2KDE B;  1WYG A;  3EC8 A;  4ZHP A;  2IPK D;  3VUX A;  1P3Q U;  4HDQ A;  4WAA A;  2KJR A;  1P1A A;  3PS6 A;  1L6V A;  1TT5 B;  3IT4 B;  3UGB B;  4GOC A;  3RNG C;  2CS4 A;  4FAD A;  1EWY C;  1MI0 A;  3AE1 B;  4KV2 A;  1ZPS A;  3A9K B;  2ZPN A;  2KC2 A;  3VAW A;  3RPF C;  2OJR A;  1NYQ A;  2IGG A;  2Z59 B;  4M8N A;  3VTV A;  2AQ3 B;  1L5P A;  5G2N A;  3TJP A;  2MJ3 A;  3CWI A;  1G6J A;  2WXJ A;  3ECI A;  1WFY A;  3AE6 B;  2JRH A;  3NVV A;  5C1Z A;  2AQ2 B;  3P4Q B;  5BYQ A;  5L95 C;  1FNW A;  3FIL B;  1UGJ A;  3Q2A C;  4YSY B;  1QQR A;  2KYW A;  3PO0 A;  4ZRQ A;  1L0Y B;  4XC2 A;  3GOE A;  4ZYN A;  2JUO A;  1KLG D;  4MM3 B;  4GDK A;  2NBW B;  3A9J A;  4P6V F;  2KDI A;  1AAR A;  1TY0 A;  3KW5 B;  3VH3 B;  4BZA A;  2LGD A;  3CMM B;  4HEA 1;  4W9H A;  4BKG A;  1BXT A;  3BY4 B;  3Q6B A;  1XO3 A;  4NQK E;  2BYV E;  5D2M B;  2I1K A;  4GMV A;  4C00 A;  3EHV A;  4JX1 C;  3N1Z C;  4EOY A;  4AWJ A;  2FE8 A;  4HK2 A;  1CMX B;  2BQQ A;  2YVC A;  4ARC A;  1JW9 D;  5C2T B;  5DPW A;  3L13 A;  1NVI D;  4DQO C;  1GB1 A;  4WWP A;  2AWT A;  1TJE A;  2A5U A;  2MJD A;  1C1Y B;  3M95 A;  1D3Z A;  2L1A A;  4JQW C;  2NMQ A;  5MPO A;  1ET6 A;  1WR6 E;  2LRW A;  3RI7 C;  2AL3 A;  2SEB D;  3PTF C;  5E6N A;  3FC4 A;  3IG3 A;  2DZK A;  2KMA A;  2MSE D;  2VH2 A;  4K81 A;  2BWE S;  1CJE A;  2O2V A;  1E7V A;  2L8J A;  2PEA A;  2O6V B;  4US9 A;  3ZNH B;  4DXA B;  4EUT A;  2V0G A;  3QWZ B;  2LVP A;  3BVZ A;  2ZJD A;  4MEM A;  1AN8 A;  2WX0 A;  1UD7 A;  3A1Q A;  4BBN C;  3NJT A;  1L7Y A;  2QMT A;  2LFI A;  3ZTC A;  4W9G A;  3AEA B;  1TIF A;  2VZK B;  3SR6 A;  3BVM A;  2DYO A;  4KZC A;  3JYU A;  3ZJT A;  3PRZ A;  3OJ3 A;  2EMS A;  4GSW A;  3I9V 1;  4OZB A;  4NJ7 A;  3ZRF A;  2WDV B;  2MLB A;  2V4L A;  2D3C A;  3B2F A;  3T8M A;  2M17 A;  4A9A A;  2I38 A;  3A9K A;  2MBQ A;  2M0X A;  4TQ1 A;  4KDL B;  1ACC A;  3ZIM A;  2KZR A;  4B95 A;  1Y8R C;  2OJW A;  1SBB B;  4NJC A;  4L1B A;  2KJH B;  2J52 A;  4ZRI A;  1KJT A;  4JLC A;  3W1Y A;  2ZCC A;  3C8Y A;  2J0K A;  2GOW A;  3W5U B;  5LXI B;  1VRA B;  4PS8 A;  1C4P A;  2GBN A;  3RNA C;  3AN1 A;  2A4Z A;  1T0S C;  4PK1 A;  1AWD A;  4AS1 A;  2KFK A;  4GN1 A;  4K7W A;  2J42 A;  5H8Y E;  1RM6 C;  3RZW C;  2WQY B;  1SE2 A;  4RM8 A;  2IND C;  4KKJ A;  4MH8 A;  3AI5 A;  1WXV A;  2C5L C;  1OQY A;  4ZHO A;  1FFU A;  3PRM B;  3DBL I;  5CX3 A;  2KFK B;  3AEC B;  2WGS A;  3GS2 A;  2JY6 A;  3P1M A;  5BMH A;  4PT5 A;  4IKG A;  1UWM A;  3Q8B A;  1YX5 B;  3EFU A;  1WRI A;  2PVG C;  4ARI A;  1WRD B;  3DVN V;  3VH4 B;  5IA7 A;  5C23 A;  1RFA A;  3AE7 B;  2NBU A;  3AU5 A;  1P7F A;  2KWD A;  3GE8 C;  4ZRP A;  1R4N B;  3WIM A;  2M56 B;  1I4P A;  2KDF B;  3HVD A;  3ZXR A;  2R2Q A;  2RR9 A;  4MT5 A;  1UF0 A;  1YQ4 B;  1YQB A;  3P42 A;  3TMP B;  4IW0 A;  3DHH C;  3A4R A;  2KQ7 A;  3IBE A;  4KVG B;  1F77 A;  3C0R B;  4YTM B;  1NEK B;  1KLU D;  2C7M B;  4NNJ B;  4FN2 A;  1GNU A;  2ZW1 A;  4WUR A;  2CJN A;  4HCN B;  3QQ8 B;  2L83 A;  4RNA A;  3TEX A;  1L4D B;  2V3P A;  1YOV B;  3I57 A;  2L0T A;  2LJI A;  2L00 B;  3VQI A;  3A33 B;  1EWC A;  1NBF C;  2BB6 A;  3AED B;  3DCG A;  3GP7 A;  3Q3M C;  4YTN B;  3ZTD A;  3C19 A;  4HPL B;  4DXF A;  2LJ5 A;  2DYB A;  1UH6 A;  3KYC D;  5IP4 D;  5AUK A;  1QOA A;  4YXD B;  3SEB A;  3U8Z A;  3TEZ A;  4I6L B;  1VJK A;  4N6E B;  1E8X A;  4E3C A;  4YSX B;  1H4R A;  4JPS A;  1TS4 A;  3VFK A;  1WMH B;  1PUT A;  2NPT B;  2WHI A;  4AOF A;  1Q5W B;  4P1B C;  2OED A;  2KNB A;  5TR5 A;  4C7Y A;  2DZJ A;  1KM7 A;  4IWO A;  4USA A;  4EZJ A;  3QA8 A;  4GIV A;  2KTR B;  2ZVN A;  3TIX A;  3L0W B;  4FBJ B;  3WA0 A;  3ZNI D;  2V3S A;  2MRP A;  2Q5W D;  3WAL A;  3O13 A;  5JHB A;  3B9J A;  2K0P A;  2BPS A;  1UBI A;  3EA6 A;  1I42 A;  3ZGZ A;  2ON8 A;  2W54 A;  3LB8 C;  4JWU C;  4AUQ C;  3AV8 A;  4XE0 A;  3DHI C;  1E90 A;  2AQ1 B;  2GLS A;  3VR8 B;  3X0W A;  3SD5 A;  1I4X A;  3MHS D;  2NTS A;  2K5P A;  4IM3 A;  4NPN A;  2NBV B;  2PW9 A;  5I4D A;  3EUB 2;  1OQR A;  3AEB B;  3R2T A;  1OEY A;  1V1P B;  1F1H A;  3AMZ A;  1JML A;  2BS4 B;  5IKC M;  1SE3 A;  5DCN A;  5LLI A;  2LHD A;  4WJQ A;  2KDB A;  4J6I A;  4A8X C;  3AE8 B;  2KC1 A;  4ANV A;  4HLE A;  4N9F 4;  2M4N A;  2INN E;  3EFC A;  3CIR B;  3B2G A;  3EGR A;  3BK2 A;  5C3J B;  4N59 A;  2KAC A;  1XF5 L;  3R7Q A;  2KVZ A;  3N1X C;  1VD2 A;  2G9H D;  2KAJ A;  3L17 A;  1OFF A;  5AEK B;  3PPA A;  3E56 A;  4CYE A;  2BTE A;  3TEY A;  1MHX A;  3N1Y C;  2JSV X;  3ZDM C;  3R2I A;  3W1S A;  5J18 A;  3PV1 A;  4IDI A;  1TBE A;  2EEL A;  1P98 A;  3V61 A;  3KVF B;  5BO4 B;  2N0S B;  4MJS B;  1E8W A;  4ANU A;  3RFZ B;  1YN4 A;  2RPV A;  1A70 A;  1VZ6 A;  3KWV A;  3SDL C;  3IXS A;  1SJH D;  2JQR B;  2V4I B;  2VH1 A;  2NPT A;  3I5J C;  1IPG A;  5CHW A;  1KRH A;  1FIQ A;  4E74 A;  2G4S A;  3TCA A;  1KFY B;  2E6X A;  1WY8 A;  3ZUN A;  3KWL A;  4LDT D;  2GB1 A;  2QSD A;  4OZA A;  3R3M A;  3AE3 B;  1WM3 A;  5BYR A;  1TKE A;  2L32 A;  3WAO A;  2UWQ A;  1EU4 A;  2K8C A;  2DNF A;  2PE9 A;  1Z2M A;  1T0R C;  1C77 A;  5J2R A;  1NI2 A;  4ACF A;  4W9C A;  2D10 A;  1GG3 A;  3DBH I;  4X57 B;  3AB5 A;  5TSS A;  1PFD A;  2WXQ A;  1SIF A;  1S3S G;  2E3T A;  1J8C A;  4W9D A;  3OLM D;  4AJW A;  2KD0 A;  2Y5B B;  3M62 B;  4MGZ E;  4RFB A;  2LGX A;  4FHK A;  1RRB A;  4A55 A;  2GBJ A;  2RSU A;  1WJU A;  2IY1 B;  4DHJ D;  3DBR I;  1F9J A;  1E0Z A;  2KFJ A;  1RYJ A;  3RNF C;  1VLB A;  4S17 A;  3U4E G;  2BT6 A;  2DAJ A;  5DPS A;  2PTL A;  3NZ3 A;  1Y56 A;  3A9J B;  1Q1O A;  2WXF A;  3ZYY X;  4S0R A;  4O1N A;  3ONS A;  5IO9 A;  5E6O A;  3OWE B;  2W9N A;  4HDO A;  1ZE3 D;  1GC7 A;  1P0R A;  2KX3 A;  2LUE A;  2FID A;  1XD3 B;  2Z0D B;  1ISN A;  3B08 A;  2OHF A;  1J7A A;  3B0A A;  3PZ8 A;  1T5X D;  1N63 A;  1FXA A;  1KTK A;  4DHJ B;  3NHE B;  1ZUD 2;  4BOS C;  1QF6 A;  4EZL A;  2WXI A;  3ZXV A;  1SJE D;  4KIK A;  1WGG A;  2PKO A;  3ZRC A;  2O6V A;  4OHJ A;  4LJP B;  3NVY A;  4LLG M;  1V81 A;  2RMM A;  4RF0 A;  3A1Q B;  4TUU A;  2MJE A;  1PQS A;  1ROE A;  2BBC A;  3ZO5 B;  1XLQ A;  1GUA B;  1JRU A;  2KN4 A;  3ZNG C;  2BF8 B;  1T0Y A;  3VRA B;  4M0W A;  1QKZ A;  3Q8A A;  2C9W B;  2WDT B;  2W55 A;  3VR9 B;  2WU5 B;  3JVZ X;  1WWT A;  2J0M A;  4H2A A;  1C4C A;  1T3Q A;  4FA6 A;  1E9M A;  2QHO A;  2K22 A;  2VZK D;  4NAW A;  2MP2 A;  4FHJ A;  2RGF A;  1E10 A;  3KUD B;  2QIL A;  2JWZ A;  4RMA A;  4MEL A;  2J0J A;  2KWC A;  3KLS X;  4IC7 B;  1DOY A;  3RN9 C;  2LXA A;  1ESF A;  2N7D A;  4P16 A;  2JXT A;  2WXR A;  1QIL A;  3BVG A;  3NZS A;  2BKF A;  1HEZ E;  4MGK E;  4MH0 E;  4BFR A;  1HZ5 A;  1P9D U;  1C9F A;  3GZN B;  2MP2 B;  3BWU D;  2JXX A;  3MJ5 A;  1YNT E;  2QIE B;  3MP9 A;  3KUC B;  3PHX B;  1NEN B;  2MEK A;  4BVU C;  5HHD G;  3ETR A;  2DAF A;  2G45 B;  3HHM A;  3FAH A;  1MPE A;  2JPH A;  2O2V B;  4DK5 A;  1FRR A;  4B0M A;  3QK0 A;  5CHV C;  4RF1 A;  1RWS A;  2QC8 A;  1ZP0 B;  2JT4 B;  3T9L A;  3RNB C;  2JX5 A;  2K39 A;  1FRD A;  2KDM A;  3QCA A;  1VZ7 A;  1JWU D;  3WAP A;  4IUM B;  3FKY A;  2B3A A;  2ZZP B;  3PLV A;  1V2Y A;  5HFY A;  1WGY A;  1B9R A;  4HXD A;  3PT2 B;  1RFK A;  3D32 A;  2GBR A;  3URY A;  3H7P A;  3HM6 X;  4JL9 A;  3NZU A;  2N7E A;  2LGY A;  2RDG A;  1XEE A;  1WMH A;  4WIP A;  4G3X B;  2LAS A;  2WXM A;  4WWM A;  4PYZ A;  2MBE A;  2ZNV B;  3V60 A;  1LQB A;  4D2K A;  2KKC A;  2M0A A;  4XDD A;  4OVV A;  1J0G A;  2CKH B;  4P1C C;  4KX6 B;  5AUI A;  4MDK E;  1WF9 A;  2IO3 B;  4RGN A;  4GGQ A;  4YTP B;  1OQQ A;  1TY2 A;  3RZF A;  2ZPY A;  3HUI A;  5KHQ A;  1SXT A;  4NZL B;  5CTR C;  2LD9 A;  3P63 A;  3WAM A;  4ICU A;  1UZX B;  2NVU I;  1R7S A;  1K8R B;  3DBS A;  3T3N A;  1CQV A;  3DVG X;  1HZ6 A;  4ZOH C;  4A90 A;  3IT6 B;  1UNS A;  1JCK B;  3V05 A;  3TUO A;  3DVG Y;  1V1O A;  3APC A;  2ZVO A;  1MG4 A;  2KTF A;  5E6P A;  3IFW B;  3VTU A;  2LGI A;  1C79 A;  4LNO A;  2V1Y A;  2J7Q B;  3VUY A;  4JIO U;  2HTH A;  1VDV A;  3TEW A;  3L16 A;  1FCC C;  2D11 A;  4HPP A;  1UWX A;  1SEB D;  3QIJ A;  2L7R A;  2R2O A;  2MX2 A;  4CHK A;  3JSV B;  2WX1 A;  3VDZ A;  3ABV B;  1WYW B;  2NS5 A;  3QX1 A;  2X38 A;  3RCZ A;  2XK5 B;  1XLP A;  1QOG A;  3AEF B;  4F1S A;  2WXG A;  4K3B A;  4HVB A;  2LVO A;  1WE7 A;  3NG0 A;  2KTR A;  1D5Z C;  2JU6 X;  2N7J A;  3CSF A;  2KOX A;  4WH4 A;  1WIA A;  2BKR B;  5D3D A;  3GB1 A;  3ALB A;  3AEG B;  4P7I A;  2Z8L A;  1I7H A;  2ZNV C;  1IGC A;  4IM0 A;  1J7C A;  3DPD A;  3SFD B;  2WXL A;  3UQA A;  2K8H A;  3K9O B;  1JWS D;  4XZ4 A;  3OG5 A;  2BB5 A;  2KWU B;  2MQJ A;  5JHA A;  2N9E B;  5JH5 C;  4HWI B;  4FUL A;  1E8Y A;  3LDZ E;  4M8M A;  1ZKH A;  1ET9 A;  2D3A A;  4C4V A;  2BYT A;  1H8C A;  3UF8 A;  3M3J A;  1MG8 A;  4B9K A;  1EO6 A;  1N5X A;  2ACZ B;  1KH0 A;  3TL5 A;  2D2Q A;  2DHZ A;  4I6N B;  4G50 A;  4PYU A;  4K1R B;  2G4D B;  2MBB B;  3BZD B;  1M4V A;  1F2R C;  4OVZ A;  4EFO A;  2KAN A;  3ZNZ B;  4L2Y A;  3H7S A;  3DOW A;  1KLV A;  5HG2 A;  4HJG E;  4ZRK A;  3DBH B;  3QJZ A;  2M1M A;  2EKE C;  4F8C B;  2ICI A;  3NS8 A;  3R66 C;  1NYR A;  1WH3 A;  1LFD A;  2MA9 B;  1DOI A;  1EF5 A;  4WJO A;  5EE1 A;  1BUI C;  3HRD D;  4YL8 A;  2I2Y A;  2H89 B;  4DDG D;  1N61 A;  3WAN A;  3VHT C;  4BKT A;  5EE3 A;  2FCQ A;  3K9P B;  4G0N B;  4QAY A;  1PGX A;  4CO7 A;  1BT0 A;  2PE6 B;  3RYT A;  5KHO A;  1D6E C;  1MJD A;  2WDQ B;  2AX5 A;  2MBH A;  3O65 B;  4CQN A;  2FUG 1;  2JF5 A;  5HKH A;  4NJ6 A;  1F0Z A;  5FR3 A;  1E7U A;  1WXQ A;  3N30 A;  3P4R B;  2JYE A;  3H9D A;  4E71 A;  2YLM A;  1TZO A;  1YX6 B;  2QJL A;  5GMV A;  1WGR A;  5BYS A;  1V5T A;  1E7P B;  2QEJ C;  1N5W A;  4EE2 A;  3LYY A;  4M0W B;  3BIN A;  1BML C;  3BYY B;  2BYE A;  4IOI E;  4M02 A;  4AJY B;  2INC C;  2KQ4 X;  4KGS A;  1FXI A;  1HQR D;  1FPY A;  3APD A;  2M19 A;  4YWG G;  5HI1 A;  4IG7 B;  3UIN B;  4YSZ B;  5LNK 1;  1WE6 A;  4LNN A;  3V3X A;  5D7G A;  4YT0 B;  1V9J A;  4BOZ B;  3BII D;  4HRO A;  1JRO A;  2IGD A;  4FJZ A;  2LHE A;  1IGD A;  1WGD A;  3GZN I;  2JZP A;  2FNJ B;  2HDE A;  4K7S A;  5L83 A;  5AZH A;  1R4M I;  2WP9 B;  1FCL A;  3HK0 A;  2MBO A;  2DBY A;  1D4B A;  4XWW A;  2PIA A;  4RGM A;  2RDB C;  4NAM A;  4BAX A;  1FXT B;  1FNU A;  5DPR A;  1TS3 A;  3E9S A;  3QAR A;  1SF0 A;  2LWP A;  3IAM 1;  4B0E A;  2IDY A;  2ONQ A;  1DOX A;  4MSM B;  1V49 A;  4M01 A;  5IN7 A;  1R4M B;  4W9J A;  3LJ3 A;  1GAQ B;  4DWF A;  3PVL A;  4DXG A;  2FIF A;  4JGH B;  1QOB A;  1K52 A;  1C76 A;  2YEP B;  2KX0 A;  4HKZ E;  2KJ6 A;  2HD5 B;  1QOF A;  1SIJ A;  2WXO A;  4RCO A;  3SU8 X;  4KSK C;  1V80 A;  4LDT B;  4A3P A;  1WGK A;  4W9F A;  1IUE A;  1YN3 A;  3SFE B;  2EMT A;  1TZ1 A;  3N9Y C;  2TSS A;  1WX8 A;  2IGH A;  1E5W A;  4Q2J A;  2WNM A;  4KDI C;  4FLH A;  4KIK B;  2KMC A;  1L0V B;  1WGH A;  2UYZ B;  3NUH B;  1RAX A;  2L0F A;  1P7E A;  1V5O A;  3Q3N C;  1Q0W B;  3AEE B;  1NI3 A;  1TKY A;  4A20 A;  1K51 A;  3IAS 1;  2W82 A;  2CHX A;  2L05 A;  1L4Z B;  3AUL A;  4W9E A;  2XNA C;  4DHZ E;  4REZ A;  1YJI A;  5G5H A;  3I63 C;  3DVN U;  2LXC A;  4LCD E;  3P2B A;  3DWG C;  5FK9 C;  5AZF A;  2IO2 B;  5IOI A;  4F7Z A;  1WR1 A;  4I6P A;  5H92 C;  3OJ4 B;  1T0Q C;  4MGY E;  1LXD A;  4KGT A;  2IZV B;  3AE2 B;  1AW7 A;  4KGR A;  2DYM A;  2D07 B;  1UEL A;  1EM7 A;  1CZP A;  1YQ3 B;  3BK1 A;  3QAQ A;  3ZDT A;  1XCQ L;  3IHP C;  3MHZ A;  2NR2 A;  2QDF A;  1V6E A;  1DGJ A;  3RMK C;  1L6U A;  3V62 A;  3ZQ4 A;  1TYG B;  2JZZ A;  4TQ0 A;  4PS3 A;  1YD8 U;  3LXF A;  3DWM A;  1CK1 A;  1PGA A;  4MGI E;  2AL6 A;  2FAZ A;  3L08 A;  1JRP A;  4G11 A;  2XK5 A;  4TKN A;  2KWV B;  1PGB A;  2BW2 A;  1PDX A;  1I4Q A;  2D3G A;  4LTU A;  2BWF A;  1T6B X;  2LRU A;  1IP9 A;  4OW0 A;  2CHW A;  2N9P C;  1EU3 A;  1F2R I;  1J7B A;  2N9X A;  3U2S C;  2IJ0 A;  3Q3F A;  1WM2 A;  4HPM B;  1I4G A;  2X8X X;  4WQM A;  1OGW A;  3FIL A;  3L10 B;  4KSL C;  4M00 A;  1FD6 A;  1VR9 A;  3PZD A;  3CST A;  4FJY A;  4RM9 A;  2GMI C;  4MM3 A;  1IYF A;  3U7Z A;  2YEP F;  2VRR B;  3APF A;  2MHJ A;  2ZEQ A;  2KXJ A;  4US8 A;  1C4A A;  3ZLZ A;  1ZOY B;  2NCN A;  1UGM A;  4IWP A;  2GRI A;  3Q14 C;  4B6W A;  4DBG A;  1K50 A;  3PGE A;  1S1Q B;  1YJJ A;  3NY5 A;  3PRE A;  4EZK A;  4RH6 A;  1M94 A;  2LUM A;  1WX7 A;  1WSP A;  2BGF A;  3UQB A;  1IBX B;  4ANW A;  2MW5 A;  2KO3 A;  2Y5P A;  4XDC A;  3AU4 A;  4DHZ B;  1SGH A;  2ZW0 A;  3W1S C;  1XLO A;  3R7R A;  3W2D A;  2RD0 A;  3AH7 A;  3OAW A;  1D5M C;  3HIZ A;  4HJK A;  1WJ4 A;  1TGZ B;  3RT3 B;  5D6J B;  2PVO D;  4N58 A;  5IAA C;  3PHW B; 
#chains in the Genus database with same CATH homology
 2K25 A;  4M8N A;  3VTV A;  5AEK B;  3PPA A;  5G2N A;  2ZNV C;  3TJP A;  4IM0 A;  4CYE A;  3DPD A;  2N1V A;  4K7U A;  1WZ3 A;  1WJ6 A;  1G6J A;  1WXS A;  3ECI A;  3UQA A;  1WFY A;  4ZDV A;  2JRH A;  2K8H A;  3VUW A;  3ZDM C;  5C1Z A;  3PLU A;  3K9O B;  3W1S A;  1HE8 A;  3PV1 A;  5J18 A;  4XZ4 A;  3ML8 A;  4URK A;  2KLG A;  4ANX A;  5L95 C;  1TBE A;  1J19 A;  1P98 A;  3V61 A;  3CF6 E;  2KWU B;  3KVF B;  2MQJ A;  4TV3 A;  5BO4 B;  5JHA A;  1WXA A;  2M8S A;  2N9E B;  5JH5 C;  4HWI B;  2I1J A;  4FUL A;  1E8Y A;  3LDZ E;  4M8M A;  1X1M A;  4MJS B;  1E8W A;  1ZKH A;  4ANU A;  2CHZ A;  1H8C A;  3UF8 A;  3M3J A;  1MG8 A;  3SDL C;  4XC2 A;  4B9K A;  3GOE A;  4ZYN A;  1V86 A;  2JUO A;  1EO6 A;  4GDK A;  2XBB C;  1EF1 A;  2NPT A;  2NBW B;  3A9J A;  2KDI A;  1WJN A;  3TL5 A;  2D2Q A;  2DHZ A;  1AAR A;  4I6N B;  3KW5 B;  4G50 A;  3VH3 B;  1IPG A;  2LGD A;  3CMM B;  4PYU A;  4W9H A;  4K1R B;  5CHW A;  2G4D B;  2MBB B;  4BKG A;  3BY4 B;  4E74 A;  2G4S A;  4NQK E;  3TCA A;  2BYV E;  2K1F A;  5D2M B;  2C7H A;  1WY8 A;  3ZUN A;  4EFO A;  2KAN A;  3ZNZ B;  4LDT D;  2I1K A;  2JZ3 B;  3H7S A;  4GMV A;  2PPH A;  2IO0 B;  3DOW A;  3EHV A;  2DX5 B;  1KLV A;  4II3 B;  2ZCB A;  5FR6 A;  2HE7 A;  3DQV A;  4GDL B;  4EOY A;  4AWJ A;  4ZRK A;  3R3M A;  2KVR A;  4HK2 A;  3MJW A;  1CMX B;  3QJZ A;  2M1M A;  2EKE C;  2YVC A;  4F8C B;  1KOT A;  2JRI B;  3NS8 A;  3R66 C;  1WM3 A;  3H6N A;  5DPW A;  3L13 A;  3WAO A;  2UWQ A;  2AYO B;  4GXB A;  2K8C A;  1WH3 A;  2PE9 A;  1Z2M A;  1LFD A;  2MA9 B;  4WWP A;  3V6E B;  2AWT A;  1EF5 A;  4WJO A;  1NI2 A;  2A5U A;  1C1Y B;  3A4S C;  3M95 A;  5J2R A;  1D3Z A;  4YL8 A;  4JQW C;  4W9C A;  4DDG D;  1WR6 E;  2D10 A;  1GG3 A;  2LRW A;  3DBH I;  4X57 B;  3TBL D;  2AL3 A;  3WAN A;  2G3Q B;  3VHT C;  4BKT A;  2MWS B;  3PTF C;  5E6N A;  3IG3 A;  1SIF A;  2FCQ A;  1S3S G;  1QZE A;  3K9P B;  1VCB A;  4G0N B;  1J8C A;  4W9D A;  3OLM D;  4CO7 A;  4GB9 A;  2DZK A;  2N4F A;  4AJW A;  3B1L X;  2KD0 A;  1BT0 A;  2KMA A;  2Y5B B;  2MSE D;  3M62 B;  2PE6 B;  4MGZ E;  4K81 A;  3RYT A;  5KHO A;  2LGX A;  4FHK A;  2GBK A;  2BWE S;  3ZW3 A;  4DDI D;  1RRB A;  2DZM A;  2O2V A;  1E7V A;  2L8J A;  2MBH A;  2PEA A;  3O65 B;  2MCN B;  2PJH A;  3X23 A;  2GBJ A;  4GDK B;  2O6V B;  2RSU A;  1WJU A;  2JF5 A;  3ZNH B;  2IY1 B;  2WYQ A;  4DXA B;  4EUT A;  3QWZ B;  4WJN A;  3N32 A;  5HKH A;  2LVP A;  4NJ6 A;  3ZVV A;  1E7U A;  2ZJD A;  4MEM A;  4DHJ D;  3N30 A;  3DBR I;  1F9J A;  2KFJ A;  3H9D A;  4E71 A;  2YLM A;  2WX0 A;  1YX6 B;  1UD7 A;  2JVC A;  3A1Q A;  4BBN C;  4BKS A;  5GMV A;  5LXH A;  1WGR A;  4WWN A;  1L7Y A;  1I35 A;  4NQL B;  3ZTC A;  4W9G A;  1V5T A;  3PSE B;  2DAJ A;  4FJV B;  5DPS A;  3N3K B;  3A9J B;  1WZ0 A;  4M0W B;  3BIN A;  3VTW A;  1Q1O A;  2BYE A;  3ONS A;  4EKU A;  5E6O A;  2L76 A;  4HDO A;  2W9N A;  4AJY B;  1GC7 A;  1P0R A;  2KX3 A;  2LUE A;  2DYO A;  4KZC A;  2FID A;  1XD3 B;  2Z0D B;  3APD A;  3JYU A;  4NAW B;  3UIO B;  1ISN A;  3B08 A;  3OJ3 A;  3PRZ A;  3L54 A;  2EMS A;  1E8Z A;  4GSW A;  4GDL A;  1WXM A;  4IG7 B;  3B0A A;  3UIN B;  3H1U A;  1TTN A;  4NJ7 A;  3ZRF A;  2MLB A;  1WE6 A;  2V4L A;  3I3T B;  3T8M A;  2M17 A;  5D7G A;  4DHJ B;  4OVU A;  3A9K A;  3ENE A;  2MBQ A;  3NHE B;  2M0X A;  1V9J A;  4XX5 A;  4BOZ B;  4TQ1 A;  3KH0 A;  2N1W A;  4KDL B;  3ZIM A;  4BOS C;  2KZR A;  2KQS A;  3MTN B;  4B95 A;  2OOB B;  1Y8R C;  4EZL A;  2CU1 A;  4FJZ A;  1WGD A;  3GZN I;  4LJO B;  2IO1 B;  2KJH B;  4KIK A;  1WGG A;  2FNJ B;  1OTR B;  2IYD B;  4K7S A;  5L83 A;  4ZRI A;  3ZRC A;  1KJT A;  2O6V A;  2LZ6 A;  5AZH A;  1R4M I;  4JLC A;  3W1Y A;  4LJP B;  3HK0 A;  2ZCC A;  2MBO A;  1V81 A;  1YIW A;  2K6D B;  1WX9 A;  3RD2 A;  3U7D A;  3A1Q B;  2J0K A;  1C3T A;  4TUU A;  2ASQ A;  2GOW A;  1SE9 A;  1PQS A;  5LXI B;  1FXT B;  5DPR A;  2KN5 A;  4PS8 A;  3ZO5 B;  2GBN A;  2IY0 B;  1GUA B;  1YJ1 A;  1JRU A;  2A4Z A;  3ZNG C;  2BF8 B;  1T0Y A;  2C7N B;  3QAR A;  2GBM A;  3ZKJ C;  2LWP A;  2KFK A;  4GN1 A;  4K7W A;  2C9W B;  2WDT B;  4MSM B;  1V49 A;  3RZW C;  4W9J A;  3JVZ X;  2J0M A;  3LJ3 A;  2BYF A;  4RM8 A;  4DWF A;  4FA6 A;  3AXC A;  3PVL A;  2FIF A;  3KYD D;  2QHO A;  4JGH B;  2KK8 A;  1UBQ A;  4IM2 A;  4NAW A;  3AI5 A;  2KX0 A;  2MP2 A;  4FHJ A;  2KJ6 A;  2HD5 B;  1OEY J;  3SU8 X;  1WXV A;  2C5L C;  2RGF A;  1OQY A;  1V80 A;  4KSK C;  4LDT B;  4A3P A;  2LVQ A;  4W9F A;  1NDD A;  2EMT A;  3DBL I;  1TZ1 A;  3KUD B;  2JWZ A;  3PRM B;  4MEL A;  2FCN A;  1WX8 A;  2KFK B;  4RMA A;  5CX3 A;  2JY6 A;  3VXW A;  2J0J A;  2KWC A;  1E5W A;  4IC7 B;  4W9L A;  5J17 A;  2LXA A;  1YX5 B;  2N7D A;  3EFU A;  3NZS A;  4KDI C;  2BKF A;  4FLH A;  4KIK B;  3HM3 A;  4MGK E;  2KMC A;  4MH0 E;  4BFR A;  1WGH A;  2UYZ B;  1WRD B;  1RLF A;  5AZG A;  1ZW7 A;  3DVN V;  3VH4 B;  1RAX A;  2L0F A;  5IA7 A;  1P9D U;  1V5O A;  1GJZ A;  4W9K A;  5C23 A;  1Q0W B;  3S2A A;  2MP2 B;  2JXX A;  1RFA A;  4A20 A;  2NBU A;  3AU5 A;  2CHX A;  3KUC B;  2L05 A;  1Z5S B;  4MJS A;  4BBN F;  5G55 A;  3QHT A;  3AUL A;  3PHX B;  4W9E A;  4II2 B;  4DHZ E;  3V6C B;  3WIM A;  4WQO B;  2KDF B;  4BVU C;  4EEW A;  3RUI B;  3RUL A;  2R2Q A;  2RR9 A;  2DAF A;  3DVN U;  2G45 B;  3HHM A;  1WI0 A;  2JPH A;  2LXC A;  1YQB A;  4LCD E;  3P2B A;  3TMP B;  4IW0 A;  2O2V B;  5AZF A;  4DK5 A;  2IO2 B;  4F7Z A;  1WR1 A;  2KQ7 A;  3A4R A;  3JSV A;  5D94 A;  1LM8 B;  2FCM A;  4I6P A;  3IBE A;  3QK0 A;  5CHV C;  3OJ4 B;  4KVG B;  4HCP B;  3VVW B;  3UIP B;  2JT4 B;  3T9L A;  3C0R B;  4MGY E;  1U4A A;  2C7M B;  2K39 A;  1LXD A;  2IZV B;  4NNJ B;  1GNU A;  4FN2 A;  3QCA A;  2DYM A;  4HCN B;  3QQ8 B;  3WAP A;  2D07 B;  1A5R A;  1UEL A;  4IUM B;  4ZRJ A;  3NOB A;  4ASW C;  2B3A A;  2ZZP B;  3PLV A;  2L0T A;  1V2Y A;  3QAQ A;  1WGY A;  2L00 B;  3ZDT A;  3IHP C;  4HXD A;  2NR2 A;  3A33 B;  3PT2 B;  3VQI A;  1NBF C;  3D32 A;  2IBI B;  1V6E A;  2GBR A;  2C60 A;  3H7P A;  3DCG A;  3HM6 X;  4JL9 A;  3V62 A;  3QC8 B;  2XEW A;  3ZTD A;  3NZU A;  2N7E A;  2REX A;  2LGY A;  3ML9 A;  4HPL B;  2JZZ A;  4TQ0 A;  1WMH A;  2LJ5 A;  2CR5 A;  2L3Z A;  4G3X B;  4PS3 A;  1YD8 U;  2LAS A;  3KUZ A;  2DYB A;  1UH6 A;  3KYC D;  4IWQ A;  4KZ0 A;  4WWO A;  2FUH B;  2LI5 A;  3IVF A;  4MGI E;  2AL6 A;  2FAZ A;  3SHQ A;  4PYZ A;  2MBE A;  3L08 A;  2ZNV B;  4BKS D;  3U8Z A;  3V60 A;  4G11 A;  1LQB A;  4I6L B;  3Q3J A;  3EEC A;  2KHW B;  2XK5 A;  2KWV B;  4TKN A;  1E8X A;  2WWZ A;  4ICV A;  4MSQ B;  2AEH A;  4A3O A;  2KKC A;  1L2N A;  4E3C A;  2D3G A;  4OVV A;  4WJP A;  1J0G A;  2BWF A;  3H7P B;  2LRU A;  1H4R A;  2CKH B;  1IP9 A;  3M63 B;  3VFK A;  2KLC A;  2CHW A;  2N9P C;  4GU2 A;  4MDK E;  1WMH B;  1WF9 A;  2NPT B;  2IO3 B;  2N9X A;  4AOF A;  3U30 A;  4GGQ A;  3PRP B;  3Q3F A;  1Q5W B;  5CHF A;  3RZF A;  1WM2 A;  4HPM B;  2ZPY A;  5KHQ A;  2KNB A;  5CTR C;  2LD9 A;  4PS7 A;  5EDS A;  3WAM A;  1OGW A;  4ICU A;  5TR5 A;  2DZJ A;  1KM7 A;  4IWO A;  1UZX B;  5DPT A;  4AP4 C;  4EZJ A;  3QA8 A;  4GIV A;  2NVU I;  3L10 B;  2KTR B;  1K8R B;  1XQQ A;  4KSL C;  2ZVN A;  3DBS A;  3DVG X;  1GC6 A;  3TIX A;  3PZD A;  3L0W B;  2K6Q A;  4FBJ B;  3WA0 A;  3ZNI D;  3CST A;  2V3S A;  4P7I A;  2MRP A;  4FJY A;  4RM9 A;  2GMI C;  4MM3 A;  1IYF A;  3DVG Y;  3WAL A;  2VRR B;  3APF A;  3APC A;  5JHB A;  2BPS A;  1UBI A;  1R4N I;  2Z0E B;  2ZVO A;  1I42 A;  2KTF A;  5E6P A;  2ZEQ A;  4AUQ C;  4W9I A;  2KXJ A;  1EUV B;  1E90 A;  3IFW B;  3VTU A;  3X0W A;  3ZLZ A;  3SD5 A;  3MHS D;  2NCN A;  1XT9 B;  2K8B A;  1UGM A;  4IWP A;  4IM3 A;  4NPN A;  2NBV B;  3JW0 X;  4B6W A;  4DBG A;  2V1Y A;  2RPQ A;  4NY0 A;  3PGE A;  2DZI A;  2J7Q B;  3DDC B;  1S1Q B;  1OEY A;  3VUY A;  2O6V D;  4JIO U;  3NY5 A;  3PRE A;  2HJ8 A;  4EZK A;  2FCS A;  1M94 A;  2HTH A;  1WX7 A;  2DEN B;  2BGF A;  3L16 A;  5DCN A;  5LLI A;  3UQB A;  2D11 A;  1ZGU B;  4WJQ A;  4ANW A;  2MW5 A;  5JZE B;  2KO3 A;  2KDB A;  3AU4 A;  2KDE B;  4DHZ B;  4J6I A;  3EC8 A;  1SGH A;  3QIJ A;  2L7R A;  2KC1 A;  2R2O A;  2MX2 A;  4CHK A;  3VUX A;  3JSV B;  4ANV A;  4HLE A;  2WX1 A;  1P3Q U;  4N9F 4;  4HDQ A;  3VDZ A;  2M4N A;  3W1S C;  1WYW B;  4WAA A;  2KJR A;  1P1A A;  2NS5 A;  3PS6 A;  3QX1 A;  3RCZ A;  2XK5 B;  3R7R A;  2RD0 A;  3OAW A;  4F1S A;  3UGB B;  4HVB A;  3HIZ A;  2LVO A;  1WE7 A;  4GOC A;  2KTR A;  2CS4 A;  4FAD A;  4HJK A;  1WJ4 A;  1TGZ B;  2KOX A;  3CSF A;  4KV2 A;  3RT3 B;  3A9K B;  1WIA A;  3R7Q A;  2BKR B;  2ZPN A;  2KC2 A;  5D6J B;  3VAW A;  3ALB A;  1VD2 A;  2OJR A;  5IAA C;  3PHW B;  2Z59 B;  3L17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...