4FBJB

Structure of the cif:nedd8 complex - photorhabdus luminescens cycle inhibiting factor in complex with human nedd8
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
74
structure length
74
Chain Sequence
b'MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLALR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein
molecule tags Cell cycle/protein binding
source organism Photorhabdus luminescens subsp. laumondii
publication title The molecular basis of Nedd8 deamidation by the bacterial effector protein Cif
rcsb
total genus 20
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4fbjB00
1J8CA 3NHEB 2HE7A 1LQBA 3QHTA 1GC7A 2RR9A 1E90A 4EFOA 3UINB 2NBWB 3JSVA 3DBHI 3DVGY 3HM3A 3JVZX 1D3ZA 5JHAA 2VRRB 2NBUA 1WZ3A 2JRHA 4TQ1A 2ASQA 2KLCA 4PYUA 4ICVA 2L8JA 4EUTA 1SIFA 4WWPA 2BKRB 3NY5A 2MBHA 3H7PB 3V6EB 4BKTA 2FCQA 1WGGA 3VVWB 3RULA 3VUWA 2LGXA 4E71A 2GBRA 3H1UA 3PS6A 5CTRC 1YIWA 4NNJB 1H4RA 4DWFA 3ZTDA 3PV1A 3BINA 2V3SA 4HPLB 4MGYE 1GUAB 3SDLC 4DDID 4GDLB 2MBQA 1YJ1A 3WAPA 4ANXA 3A9JB 2PE6B 2K6QA 1GC6A 4WAAA 2ZEQA 1V6EA 2DZMA 2FCSA 5AZGA 1WYWB 3PREA 5L95C 2J7QB 4PS3A 4W9HA 2BWFA 4F8CB 4GU2A 1YD8U 1E7VA 4A3PA 2XK5B 3QWZB 1V5TA 2GMIC 1P9DU 2LD9A 1TGZB 3TJPA 3W1SC 4WJQA 3S2AA 2AEHA 4II2B 3UGBB 5C23A 4IWQA 4EKUA 5CHVC 3L10B 4GSWA 2B3AA 3VUXA 4NQKE 2JPHA 1WRDB 2N7DA 2NBVB 3R3MA 3VTVA 3V60A 1A5RA 3V61A 2J0JA 2L0TA 2LXCA 1JRUA 4WJPA 3ML9A 3DOWA 4BKSA 1EF5A 3LJ3A 3DVGX 2ZCBA 1WR6E 3M95A 1J19A 2DZJA 3N3KB 1UBIA 2FAZA 2CKHB 2KTFA 3B1LX 2N7EA 2K6DB 1WXAA 4I6PA 3N30A 4KV2A 3A1QB 4EOYA 3QQ8B 1F9JA 2MSED 3C0RB 4HWIB 1E8WA 1EO6A 4KDLB 3TBLD 4KSKC 2G4DB 2OOBB 3HM6X 4RMAA 2KTRB 2MX2A 3L13A 4LJOB 3ZVVA 3IBEA 5KHOA 1L2NA 3IHPC 2MWSB 2JVCA 2ZPNA 2KTRA 3DDCB 3EC8A 2AL6A 4XZ4A 4TQ0A 3ECIA 2CHWA 5LLIA 2GBMA 2KJRA 2XBBC 3AU4A 4XX5A 2C7MB 2RGFA 2LUEA 4ZRJA 2IO3B 2DYBA 2R2QA 1V49A 3ENEA 2BYVE 2KHWB 3IG3A 4W9JA 4YL8A 4EZKA 1ZW7A 2IO2B 3R7QA 3UF8A 2K8BA 4MGKE 2W9NA 2DX5B 2C5LC 4ANUA 5J18A 4HDOA 4GDLA 5AZHA 2KC2A 2WYQA 3BY4B 3VTUA 4DDGD 3EFUA 3WIMA 2LRWA 3ONSA 3VDZA 2IO1B 3PPAA 4WQOB 1EF1A 2UYZB 4M0WB 2KFKB 5DPSA 3B08A 4JL9A 1T0YA 2ZNVC 3TCAA 2C60A 4DHJB 2UWQA 3U7DA 2NVUI 2O6VA 2BPSA 3PRPB 1UD7A 2MBOA 5D6JB 3TL5A 3ZNGC 4DK5A 2L7RA 2GBJA 3KUCB 2N9PC 2ZNVB 3R66C 2GOWA 4URKA 2FUHB 1IYFA 1X1MA 1UZXB 2C7NB 4MDKE 4ASWC 4X57B 4DBGA 2DYMA 2MBEA 3RD2A 3CSFA 4II3B 1VCBA 3CMMB 2D3GA 2ZVNA 2BGFA 2KFJA 5DCNA 3WANA 4AP4C 1QZEA 1U4AA 3RT3B 1KLVA 2K8HA 2O2VB 4G3XB 2Y5BB 1ISNA 3W1SA 1V5OA 3K9OB 5CX3A 1P1AA 3PGEA 3DBLI 2DAFA 3NZSA 4FHJA 2IYDB 2KK8A 4GDKA 2WDTB 3AULA 4GIVA 3KVFB 4N9F4 3GOEA 4K81A 2PPHA 4TV3A 4WWNA 2FCMA 2JWZA 2OJRA 2KDIA 1UBQA 2DZKA 3A9KB 4NAWA 3W1YA 2DZIA 2LGDA 2KLGA 4M8NA 3ZNID 1E8XA 3NS8A 2KVRA 2KQ7A 3ZLZA 3WA0A 1WMHB 2L76A 3DQVA 4HK2A 4W9KA 3VUYA 2KN5A 5L83A 4OVVA 1V81A 2KX0A 5G2NA 3ZDMC 3ZRCA 1Q1OA 2C9WB 3A4SC 3JSVB 4JLCA 5IA7A 1LM8B 1YX5B 5EDSA 2LASA 3ZRFA 3NOBA 2G4SA 3KH0A 2K8CA 3L0WB 1WH3A 2NS5A 2RSUA 1WM3A 3UIOB 1WE6A 1S1QB 2KQSA 4XC2A 3M63B 5G55A 2KJHB 3HIZA 2KJ6A 4KIKA 1NDDA 3RUIB 4MGIE 1UH6A 3R7RA 4AUQC 4ZDVA 3IVFA 2MBBB 3APDA 2JF5A 2G3QB 1WXVA 2HTHA 4FULA 2G45B 3PTFC 4IG7B 4K7UA 1WX8A 4MSMB 3I3TB 3OLMD 3OJ4B 5JH5C 3M62B 1WJNA 1EUVB 2EMTA 4WJNA 2MCNB 4KSLC 2AL3A 2MP2A 5IAAC 4MEMA 4BOZB 2AWTA 3APCA 5CHWA 2M17A 1XT9B 2MA9B 4NY0A 4ANWA 4LDTD 2BF8B 1WMHA 2KO3A 3NZUA 2KXJA 4PYZA 5CHFA 1NI2A 4BBNF 1Z2MA 1TZ1A 2CS4A 4ZYNA 2LVQA 1K8RB 2D2QA 2CU1A 3L17A 5HKHA 4MM3A 3QX1A 3ZO5B 2ZCCA 3SHQA 2JRIB 4E3CA 4ICUA 4HDQA 1WE7A 3JW0X 4K7SA 3QCAA 2L00B 1S3SG 3ALBA 3ZUNA 2N9XA 5LXHA 3Q3JA 5TR5A 3Q3FA 4G0NB 1I35A 5E6NA 3H9DA 1E8ZA 1C3TA 1V86A 2NPTA 1WIAA 4FHKA 4KDIC 4IM2A 4W9LA 4GOCA 2C7HA 1C1YB 2KDFB 1I42A 3RCZA 3CF6E 2EKEC 3PLUA 4FA6A 2M1MA 3DVNV 2K39A 3QARA 3X23A 1Z5SB 3A1QA 5BO4B 4BOSC 4FJVB 1R4NI 4LJPB 1TBEA 4IC7B 2LVOA 1WF9A 1WJ6A 4MH0E 5E6PA 1WGYA 1P3QU 4FLHA 1OEYJ 4FJZA 2LI5A 4LDTB 3U30A 4BKGA 2LJ5A 4AWJA 1M94A 5DPRA 2A5UA 3VH4B 4HJKA 2PEAA 1UGMA 2FIDA 2V4LA 2BYEA 4GDKB 4FADA 3TMPB 4JIOU 5AZFA 3LDZE 2FIFA 2GBKA 4W9DA 1E7UA 3N32A 5DPWA 1SGHA 1WXSA 4EEWA 4TKNA 4B6WA 2DENB 4P7IA 4K1RB 2KOXA 4RM9A 1OGWA 3PVLA 2N4FA 4MJSB 2Z0EB 4LCDE 3VHTC 5D2MB 2I1KA 4WWOA 2NPTB 2MW5A 3UIPB 3VH3B 4NJ6A 4DXAB 1UELA 4MJSA 5D94A 4J6IA 4CO7A 1KOTA 2N1WA 3PT2B 3AI5A 2YLMA 1BT0A 1SE9A 1YQBA 4G11A 4NPNA 3RYTA 2KD0A 2BYFA 3OAWA 1P98A 1WM2A 1P0RA 3K9PB 4BKSD 2MLBA 3EECA 4GN1A 1CMXB 1ZKHA 2BWES 1XD3B 2LRUA 1TTNA 4HPMB 2L0FA 2J0KA 4MGZE 4NJ7A 4W9CA 4E74A 2DAJA 3PHXB 3DBRI 1WR1A 5KHQA 3HHMA 2I1JA 3D32A 4A3OA 3PZDA 4GXBA 2Z0DB 4NQLB 3DPDA 4W9GA 4IM3A 1Q5WB 2REXA 5FR6A 1PQSA 5JZEB 2CR5A 3MJWA 3TIXA 2J0MA 2JT4B 3ZKJC 2HJ8A 1Q0WB 2L05A 2LVPA 1OTRB 1WGDA 2LZ6A 2EMSA 2GBNA 2JZ3B 4GMVA 2KMCA 4F1SA 2R2OA 4FJYA 4HCPB 3H7PA 3L54A 2ZPYA 2KWUB 3H7SA 3DVNU 3UQBA 1RAXA 2WWZA 4W9IA 2CHXA 4ANVA 3O65B 3QK0A 2BKFA 2KNBA 3QC8B 4M8MA 3VQIA 4JGHB 4AOFA 1WX9A 2IZVB 2FNJB 3VXWA 2PE9A 4IM0A 2L3ZA 3RZFA 3RZWC 4DHJD 5J2RA 2JUOA 3QIJA 1KM7A 3A9JA 4RM8A 3AXCA 4HLEA 4G50A 3WAOA 4ZRKA 5JHBA 3QJZA 1IPGA 2RD0A 2A4ZA 3H6NA 2HD5B 2KC1A 4CYEA 2KFKA 2AYOB 2M0XA 1G6JA 4W9FA 2M4NA 3A9KA 4A20A 1E8YA 1RLFA 4GGQA 4IWPA 3ZIMA 4HVBA 1MG8A 3ZDTA 5LXIB 1WJUA 3VAWA 4DHZE 3APFA 3WAMA 5J17A 1L7YA 3V6CB 3M3JA 1WX7A 2DYOA 2KWCA 2WX1A 4KZ0A 3PRMB 1KJTA 4BVUC 1WXMA 3T8MA 1GG3A 2KWVB 2NCNA 3QA8A 2LWPA 3ZNHB 4IW0A 4KIKB 2JZZA 2IY1B 4DHZB 3CSTA 2N9EB 2IY0B 3KUZA 4PS8A 4HCNB 3X0WA 4IUMB 2LXAA 2PJHA 1NBFC 1V2YA 1J0GA 1LFDA 2KKCA 4I6NB 1WY8A 1R4MI 3UQAA 2Z59B 1GNUA 3HK0A 3DBSA 2KZRA 1HE8A 4NAWB 3A4RA 3ZW3A 3WALA 2MP2B 3QAQA 5GMVA 5E6OA 1OEYA 2K1FA 2KANA 1IP9A 1RFAA 3OJ3A 3T9LA 3MHSD 2M8SA 1V80A 4PS7A 4TUUA 3MTNB 3PLVA 3AU5A 1WFYA 4K7WA 2IBIB 1WJ4A 3U8ZA 4KZCA 3KW5B 3PHWB 2D11A 3VTWA 3B0AA 1FXTB 2QHOA 4KVGB 3SU8X 4FBJB 1AARA 1WZ0A 4AJYB 2KDBA 2D07B 3IFWB 3KYCD 3P2BA 4B95A 1WGHA 1Y8RC 1VD2A 2ZVOA 2D10A 3L08A 2XK5A 4WJOA 2XEWA 2N1VA 2YVCA 2KX3A 5DPTA 3ZNZB 1RRBA 2ZJDA 3PRZA 4HXDA 2IO0B 3DCGA 4F7ZA 4W9EA 4MSQB 2MRPA 2O6VB 5D7GA 1YX6B 4OVUA 3KUDB 4FN2A 3A33B 3KYDD 1OQYA 2V1YA 4B9KA 1XQQA 1H8CA 3L16A 3ML8A 4IWOA 5C1ZA 1E5WA 5AEKB 4BFRA 3GZNI 2CHZA 4JQWC 1V9JA 4GB9A 2WX0A 3VFKA 2LGYA 2DHZA 2K25A 4EZLA 4EZJA 2NR2A 3JYUA 3ZTCA 2MQJA 1LXDA 3EHVA 1WI0A 1ZGUB 4MELA 2JXXA 2RPQA 4I6LB 3SD5A 2O2VA 2JY6A 4ZRIA 4BBNC 3PSEB 1WGRA 3V62A 2KDEB 4CHKA 2KMAA 2ZZPB 2FCNA 1GJZA 4AJWA 2O6VD
chains in the Genus database with same CATH superfamily
1LQBA 1E90A 4ZHOA 3UINB 3I57A 3Q3NC 1HXYD 3DBHI 4OVZA 1QOBA 4QAYA 2VRRB 2NBUA 1WZ3A 3IAM1 2ASQA 2KLCA 3NUHB 4PYUA 2L8JA 4EUTA 1WSPA 1PYWD 2BKRB 3FAHA 3BK2A 2FCQA 3VUWA 1HTQA 4E71A 1YIWA 2Y5PA 3BINA 1GUAB 4GDLB 3BYTB 1ACCA 4ANXA 3GB1A 3I9V1 3VRBB 2FCSA 3P4RB 1WYWB 1KH0A 1N6ZA 4PS3A 4W9HA 4GU2A 4M0WA 4YSXB 1C76A 3W1SC 3UGBB 5C23A 4KKJA 3LYYA 1L0XB 4EKUA 3VUXA 1A5RA 3ML9A 2ZW1A 1SEBD 3LJ3A 3W5VB 2ZCBA 1WR6E 3M95A 1J19A 2DZJA 1GB4A 3DWGC 2CKHB 2KTFA 2N7EA 4I6PA 2IGGA 3B9JA 1F9JA 3C0RB 2TSSA 1EO6A 2BYTA 1JQ4A 3HM6X 4RMAA 3ZVVA 1L2NA 2ZPNA 1T3QA 2KTRA 1TS5A 2X8XX 2XBBC 4D2KA 2V9HA 2RGFA 3V60A 2DYBA 1V49A 2IDYA 5J18A 4HDOA 4GDLA 5AZHA 4P1BC 2WXRA 4WAFA 4C56C 2PKOA 4MH8A 3B08A 3VRAB 3AEEB 2NVUI 2O6VA 3PRPB 2L7RA 2GBJA 1AN8A 2N9PC 2ZNVB 1E0ZA 1CQVA 1X1MA 1V97A 3HRDD 4X57B 2ONQA 1ZXIA 3SFDB 1C4AA 2ZVNA 1K51A 2KFJA 2HTME 1TY0A 4MACA 2WXLA 1SBBB 3B2GA 4B0MA 4YSYB 1P1AA 3DBLI 2DAFA 4P16A 3ZJVA 1NENB 4GDKA 2KK8A 1L6VA 2OJRA 3A9KB 1UBQA 3ZJUA 1FNUA 2KLGA 1YJJA 4W9KA 4B0EA 5IN7A 2D5GA 5G2NA 3ZRCA 3AE3B 4YTNB 1Q1OA 2C9WB 2WU5B 3A4SC 3P4PB 4J3OD 3NOBA 4XDDA 1OFFA 1ZPSA 3DBHB 4UDUC 1FXAA 3L0WB 3UIOB 1PGAA 3M63B 3RUIB 4KIKA 3HIZA 2KJ6A 4ZDVA 1NDDA 3R7RA 4WQMA 2G45B 3PTFC 1WX8A 4MSMB 4R3DA 2IJ0A 1WGKA 1L5PA 3AN1A 3M62B 1FCLA 2MCNB 2AL3A 3MHZA 1SF0A 2LHEA 1WMHA 3NZUA 5CHFA 1T5XD 3NS1A 1EWCA 5HKHA 4OZAA 4MM3A 1NEKB 1Q10A 2ZCCA 1SJHD 2JU6X 3AEBB 5G5GA 4ZYSA 3Q3FA 4G0NB 3H9DA 1C3TA 1WIAA 2L52A 1C1YB 3P1MA 3RCZA 1XF5L 2M1MA 1MHHE 2K39A 2X38A 4BOSC 4FJVB 1R7SA 2HJ1A 5FR3A 2IPKD 1ZUD2 1WJ6A 1WF9A 4MH0E 4FLHA 4LDTB 1MJDA 2A5UA 4HJKA 3VH4B 1EWYC 2BYEA 5BMHA 4FADA 3TMPB 1T0RC 4JIOU 4XGAB 4W9DA 1KTKA 2CU3A 1R4MB 4EEWA 4TKNA 4B6WA 2DENB 3N9YC 3I63C 1L4ZB 4KKIA 1OGWA 3PVLA 2Z0EB 2I1KA 2KVZA 4WWOA 4REZA 1FRRA 2IGDA 4MJSA 2ACZB 4CO7A 1BT0A 1XCQL 2J52A 2PLPA 3K9PB 4BKSD 2MLBA 1XD3B 4E74A 4MGZE 2J0KA 4W9CA 3DBRI 4MM3B 1WR1A 2I1JA 3D32A 1QOFA 3BWUD 4IM3A 2J4XA 1PQSA 4LK0M 2JT4B 1UUPA 2BQQA 1OTRB 3BK1A 2KWUB 3V3XA 2WWZA 3IAS1 1M4VA 2KNBA 3QC8B 3VQIA 3T3OA 2JYTA 3Q6BA 2PE9A 2L3ZA 3RZFA 4DHJD 2NMQA 4IOIE 3WAOA 4ZRKA 4L1BA 3PZ8A 2RD0A 2A4ZA 3H6NA 2HD5B 2N9LA 1AW7A 2AYOB 2KFKA 2M0XA 1PGBA 1QQRA 1F52A 4A20A 4GGQA 4AQ7A 4DHZE 3M3JA 4C80A 2KWCA 2D3AA 2Z8LA 3PRMB 1KJTA 1IGCA 2KWVB 3MC0B 3QA8A 2LWPA 4IW0A 3Q8EA 4DHZB 4RF0A 4LNNA 4HCNB 1C78A 4N59A 3WCQA 3EGRA 1D5ZC 3ZYYX 3UQAA 2Z59B 4A8XC 3NRZA 3DBSA 5IO9A 4HJGE 2MJEA 3URYA 5BYRA 5GMVA 1IP9A 1C9FA 2LEKA 3OJ3A 4A55A 4TUUA 2G9HD 3MTNB 4ARCA 3AU5A 4K7WA 4KZCA 3PHWB 1L4DB 2QHOA 1N60A 3SU8X 2D07B 3IFWB 4M02A 2KWDA 1WGHA 1MHXA 2D10A 2XK5A 5EE1A 2KX3A 1UF0A 3RNEC 3ZNZB 1XCTL 4HXDA 4F7ZA 1YQ4B 4FN2A 5HG2A 2LGIA 2BBCA 2V1YA 4XWTA 2WP9B 4B9KA 1XQQA 3Q8AA 5AEKB 2CHZA 3Q69A 5IP4D 2LGYA 1E7PB 3N1XC 4FXCA 5GXGB 1WI0A 2JXXA 2EKIA 1WWTA 4I6LB 2JY6A 5HI1A 1WGRA 3KLSX 3NHEB 4BAXA 4EE2A 2PMVA 3QHTA 1GC7A 2RR9A 1RWSA 5EE0A 3P42A 3DVGY 3JVZX 1FIQA 5JHAA 3DBRB 4TQ1A 4ICVA 1V1PA 4WWPA 3H7PB 1TY2A 1WGGA 3VVWB 3TEZA 2GBRA 4IKGA 2I2YA 4IDIA 4N6EB 1JW9D 4US8A 2MBQA 1YJ1A 3WAPA 3A9JB 3AM9A 4WAAA 1FRDA 2H88B 3BVMA 2DZMA 3PREA 5L95C 2J7QB 4F8CB 5LNK1 1E7VA 5EE9A 2XK5B 3QWZB 2GMIC 1P9DU 3S2AA 2BTEA 4II2B 2INCC 5CHVC 3L10B 4NQKE 2NBVB 1WRDB 3R3MA 3VTVA 1JRUA 3DOWA 1HZ6A 2BS2B 4OZBA 1HQRD 3T3NA 2MEKA 1QKZA 3AMZA 4EOYA 3QQ8B 2MSED 4HWIB 1SJED 4USAA 3PO0A 4KDLB 4KSKC 1TKYA 3L13A 3RPFC 3IHPC 2SAKA 2M56B 2KJRA 3AU4A 2QMTA 3CWIA 2INDC 3FC4A 2XNAC 4YL8A 2BYVE 3IG3A 5G5HA 4EZKA 1ZW7A 2BB6A 2IO2B 3BY4B 2LRWA 3U7ZA 3VDZA 5EE3A 2LUMA 1EF1A 2UYZB 5DPSA 1I4RA 1R4NB 2ZNVC 2ON8A 2C60A 1GPXA 1EU4A 3U7DA 1B9RA 4DK5A 2BPSA 3TL5A 1D4BA 4MDKE 2DYMA 4II3B 2WXQA 4AP4C 1F1HA 5I4DA 1U4AA 3RT3B 4XDCA 1KLVA 2O2VB 3CIRB 1ISNA 3Q2AC 1V5OA 5CX3A 4FHJA 4WH4A 3GS2A 4N9F4 4ZOHC 2PPHA 4NAWA 3W1YA 1DGJA 2LGDA 3NS8A 3ZLZA 3WA0A 3AEDB 2L76A 1JWBD 4OVVA 1V81A 3ZDMC 3MC9A 3FKYA 1YX5B 5EDSA 2LASA 3ZRFA 2G4SA 1WM3A 2MJDA 1C4PA 5G55A 3GP7A 3IVFA 2HDEA 3APDA 4RGTA 1WJNA 4S17A 1TT5B 4MEMA 4BOZB 2AWTA 3DBLB 2M17A 4NY0A 4ANWA 2JZPA 2BF8B 1Z2MA 1TZ1A 4ZYNA 2LVQA 1K8RB 1C4CA 3SHQA 2JRIB 3MP9A 4HDQA 3QCAA 3ALBA 5E6NA 1E8ZA 1V86A 2C7HA 1I42A 3CF6E 3DVNV 4P1CC 3QARA 1YN3A 1Z5SB 5BO4B 2WS3B 2Q5WD 4IC7B 3U4EG 2LVOA 1WGYA 1P3QU 4OW0A 4FJZA 1M94A 1B1ZA 1K53A 2D3CA 2FIDA 2V4LA 3LDZE 1E7UA 3N32A 5DPWA 3NVWA 1SGHA 4A9AA 4P7IA 3Q14C 2AQ2B 2N4FA 4MJSB 1YOVB 4LCDE 3VHTC 1MI0A 2NPTB 1K52A 3VH3B 5D94A 4J6IA 1KOTA 2YLMA 3AV8A 1YQBA 4NPNA 2KD0A 3OAWA 1P98A 1WM2A 1P0RA 5AUIA 3EECA 4HPMB 1CMXB 1DYQA 2LRUA 1TTNA 1F77A 2L0FA 1JRPA 1FMAD 3HHMA 3AEFB 3PZDA 4GXBA 2Z0DB 2OHFA 2REXA 1TKGA 3MJWA 2QCZA 3ZKJC 1VJKA 2HJ8A 1KLUD 1CJEA 1Q0WB 2MHJA 2EMSA 4F1SA 4PK1A 2R2OA 3H7PA 4H2AA 2WXIA 2ZPYA 3L54A 4HKQA 1RFKA 3DVNU 1QT9A 2INPE 4W9IA 4ANVA 4M8MA 1SSNA 2CJOA 4ARIA 1WX9A 3RZWC 1ESFA 3Q3MC 2W55A 5J2RA 1KM7A 4RM8A 3AXCA 4HLEA 4LTUA 4CYEA 2PW9A 3BYYB 3A9KA 1RLFA 2W3SA 3LB8C 1WJUA 3VAWA 4US9A 1ET9A 3E56A 3WAMA 1DOYA 2BS4B 2WX1A 4MT5A 1JROA 3RI7C 3ZNHB 4KIKB 3ZQ4A 3AE1B 3KUZA 2IY0B 2MJ3A 4IUMB 2ZW0A 3ZXRA 2PJHA 1TYGB 2WXJA 1WY8A 3HK0A 3ZW3A 2V3NA 1N62A 1UWMA 2DLBA 2K1FA 3SR6A 3UI3A 1SE3A 1OQRA 3PLVA 1FFVA 1WFYA 2IBIB 1VZ6A 3U8ZA 4KVGB 2FE8A 1AARA 2WU2B 2KDBA 3KYCD 1FFUA 4RFBA 4B95A 1HTOA 1WYGA 4M01A 1L0YB 1Y8RC 1XLNA 1VD2A 2AQ1B 4ZHPA 3Q8BA 5DPTA 2KYWA 2Y5CA 1RRBA 2IO0B 4MSQB 1SE2A 1D5MC 4WURA 1YX6B 5E6JA 3I5JC 1JMLA 4OVUA 3PZ7A 1OQYA 1H8CA 1DOXA 2JSVX 5C1ZA 1E5WA 4GB9A 3AE6B 4RNAA 2K25A 4EZJA 3JYUA 1LXDA 3EHVA 2WGSA 2RPQA 3P63A 2RDBC 3SD5A 2O2VA 4ZRQA 4ZRIA 4BBNC 5JXVA 3V62A 3TEWA 2KDEB 4CHKA 2FCNA 1GJZA 4AJWA 1UNSA 1VZ7A 1VLBA 1ZP0B 2WXHA 2N7JA 2WXKA 1I7HA 1D3ZA 2MH7A 1T0SC 2JRHA 3AE5B 1VZ8A 4LNOA 4DXFA 1I4GA 2MBHA 3V6EB 4BKTA 1K50A 3ETRA 1L6UA 4LLGM 3ZXVA 3H1UA 1PGXA 3IT4B 2L1AA 4DWFA 2V3SA 4HPLB 2PTLA 2QC8A 1OQQA 2DNFA 3RNBC 4RGOS 2PE6B 2JWUA 2K6QA 1GC6A 1I4XA 1V6EA 5AZGA 2BWFA 1IUEA 1XO3A 2LD9A 1QOGA 1JWSD 4WJQA 2KAJA 1MPEA 4GSWA 2N7DA 5FK9C 2LXCA 3AE8B 4BKSA 1WRIA 3DVGX 3HUIA 3N3KB 2FAZA 2WDVB 3B1LX 2K6DB 1WXAA 4KV2A 1KRHA 1UGJA 2JQRB 1E8WA 1NYQA 3TBLD 2QILA 3IXSA 3GZNB 2KMMA 1JWUD 4LJOB 4ACFA 3DHIC 5KHOA 2MWSB 3DDCB 1QLBB 2AL6A 1TIFA 4WWMA 4TQ0A 1HZ5A 2CHWA 2GBMA 4DQOC 2RDHA 1RYJA 4ZRJA 2R2QA 3GE8C 2K8BA 2W9NA 3O13A 1TZOA 2K0PA 4Q2JA 4C4VA 4M00A 4C7YA 4DDGD 2EELA 3WIMA 3LXFA 3RNGC 3PPAA 4M0WB 2E3TA 2PVGC 1I4PA 4JL9A 1T0YA 2WXMA 4DHJB 1IBXA 2UWQA 3ZNGC 1J7BA 1J7CA 1IYFA 1UZXB 1STEA 4L2YA 4ASWC 3RD2A 1VCBA 3Q8FA 3CMMB 2D3GA 2BGFA 5H8YE 2VH2A 3WANA 3B2FA 1QZEA 3EA6A 4G3XB 2Y5BB 5H92C 3P4SB 2IYDB 2WQYB 3AULA 3GOEA 4P6VF 4TV3A 4KGRA 4WWNA 2FCMA 2KDIA 2DZKA 3GE3C 1E8XA 4K3BA 3DQVA 5FKAC 3VUYA 2KN5A 2KX0A 3JSVB 4JLCA 2J42A 1LM8B 3KH0A 3W2DA 1SE4A 1WH3A 2RSUA 1WE6A 2KQSA 2KJHB 1UH6A 2JF5A 2HTHA 4IG7B 4K7UA 3OLMD 5JH5C 2MP2A 5IAAC 3APCA 2MA9B 1FD6A 4C4VB 1GOZA 2KO3A 1NI2A 3L17A 3NZ3A 3BZDB 4E3CA 1VR9A 1WE7A 4K7SA 1S3SG 5LXHA 3EUB2 1E10A 1YQ3B 1MFWA 3TEYA 2NPTA 4FHKA 4IM2A 4W9LA 4GOCA 2N9KA 2KDFB 1E9MA 3SEBA 5IOIA 2GB1A 2QEJC 3A1QA 3AE7B 1TBEA 1LO5D 2LI5A 2JX5A 1EU3A 2PEAA 4GDKB 2GBKA 4LNIA 2FBWB 1F0ZA 4LNKA 4RM9A 1XLOA 1RM6C 5D3DA 2MW5A 4KX6B 2KQ4X 4NJ6A 1PUTA 3AI5A 1KLGD 4G11A 3RYTA 5MPOA 2BYFA 1SIJA 4JWSC 4GN1A 1ZKHA 4NJ7A 2BWES 4YSZB 3MFGA 1BUIC 4XE0A 2DAJA 3PHXB 2VZKB 5KHQA 4OZCA 1ZE3D 4A3OA 3W5UB 4NQLB 3DPDA 4W9GA 1Q5WB 5FR6A 5AUKA 3P4QB 2L05A 2LVPA 4GMVA 2GBNA 2JZ3B 2WNMA 1EM7A 3ABVB 3H7SA 3UQBA 4HKZE 3QK0A 1NYRA 2INNE 2IZVB 3VXWA 1I4QA 3R2IA 1N61A 1XLQA 2JUOA 3QIJA 1LGRA 3NVYA 5JHBA 4KGTA 2K22A 2KC1A 3AECB 4L23A 3RNCC 1G6JA 1P7EA 1SB3C 4IWPA 1MG4A 1DOIA 3ZDTA 5LXIB 3KWVA 3OG5A 4A6QA 3APFA 5J17A 1L7YA 3V6CB 1HEZE 1QOAA 3DWMA 3N1ZC 1MVKA 4BVUC 2RDGA 3T8MA 3AB5A 2WDQB 2B76B 4PS8A 2N9EB 1YNTE 3X0WA 1JWMD 1V1PB 1AYFA 5BYQA 1UWXA 1LFDA 2WXFA 4I6NB 2W3RA 1J7AA 1GNUA 3TEXA 2YEPF 4XYCA 2KZRA 4NAWB 2KDMA 3QAQA 1OEYA 1RFAA 3T9LA 2M8SA 1YMHE 2KACA 3VTWA 3B0AA 1ENFA 1C79A 4FBJB 1WZ0A 4RF1A 2LHDA 2LFIA 2JYEA 1D6EC 3KQ4A 1PDXA 4NZLB 2ZVOA 3L08A 4WIPA 3RNFC 3BVGA 2G1EA 3DCGA 1CK1A 2O6VB 5HFYA 5D3IB 3KYDD 4BFRA 3GZNI 4JQWC 1V9JA 2LGSA 3SFEB 2DHZA 2PIAA 4RH6A 2MQJA 3RN9C 1ZGUB 3U2SC 1TS2A 3MC8A 4TSSA 1ET6A 3C8YA 2ZZPB 1J8CA 2HE7A 4JX1C 4EFOA 2NBWB 3JSVA 2DWQA 2J53A 3C19A 3Q8CA 3HM3A 2R61A 2WXGA 4N58A 1V1OA 2DBYA 2QSDA 2BW2A 2D3BA 1SIFA 1FM0D 3NY5A 1P7FA 3RULA 4YWGG 2LGXA 3J9CA 3PS6A 5CTRC 4NNJB 1H4RA 1ZXHA 3ZTDA 3PV1A 2VH1A 4MGYE 5BMIA 3SDLC 4DDID 2W54A 2RPVA 4KGSA 1ZDVA 4S0RA 4HPPA 2ZEQA 1ZDXA 1L0VB 1TJEA 1YD8U 4A3PA 1V5TA 1TGZB 3TJPA 2AEHA 3NG0A 4C00A 4IWQA 4JWUC 2B3AA 2JPHA 4NJCA 3V61A 2J0JA 2L0TA 5C2TB 4WJPA 4RCOA 1EF5A 3DHGC 4YXDB 2SEBD 3RNAC 1UBIA 2I38A 4HROA 3ZJTA 2K9XA 5HHDG 2KN4A 3N30A 3A1QB 2QIEB 1A70A 1NVID 2G4DB 2OOBB 2M19A 2KTRB 2MX2A 1TS4A 3IBEA 2UU7A 2JVCA 1IBXB 3EC8A 4XZ4A 1F2RC 3ECIA 5LLIA 1XLPA 3N20C 4JE3B 4XX5A 1V8CA 1TKEA 2C7MB 3AEGB 2LUEA 2IO3B 3ENEA 4ITKA 2KHWB 3R7QA 3UF8A 4MGKE 2DX5B 1KFYB 2C5LC 4ANUA 2L83A 2KC2A 2WYQA 2N0SB 3VTUA 3EFUA 1N63A 1FNWA 1KF6B 3ONSA 4XWWA 2IO1B 4WQOB 4K3CA 1JALA 2KFKB 3TCAA 1JCKB 1UD7A 2MBOA 5D6JB 3KUCB 3R66C 2OJWA 3FILA 2GOWA 3KWLA 4URKA 2FUHB 3TUOA 2C7NB 1YJIA 1FCCC 4DBGA 4HEA1 2MBEA 3CSFA 1HA5A 5DCNA 4GLSC 2K8HA 1QF6A 3W1SA 2AQ3B 2WXPA 3K9OB 1WXQA 3PGEA 3NZSA 1I4HA 2WDTB 4GIVA 3KVFB 1FXIA 4K81A 2JWZA 3E9SA 5T8IA 2DZIA 1NI3A 4M8NA 3ZNID 2KVRA 2KQ7A 1WMHB 2E6XA 2WLBA 4HK2A 3OWEB 1SXTA 3MJ5A 1YN4A 3IT6B 4PT5A 5L83A 2BB5A 4CQNA 3VR8B 5IA7A 3AEAB 4JPSA 2LJIA 4C7ZA 2K8CA 2NS5A 1S1QB 3EFCA 4AUQC 4MGIE 2MBBB 4A90A 2G3QB 1WXVA 4FULA 3RMKC 3U52E 3I3TB 4YT0B 1Y56A 3OJ4B 4WJNA 2EMTA 1EUVB 4KSLC 3NVZA 5CHWA 1XT9B 4LDTD 4PYZA 4BBNF 2KXJA 2CS4A 2D2QA 2CU1A 2KT7A 3NVVA 1JWAD 2YEPB 1T6BX 3QX1A 3ZO5B 4ICUA 3JW0X 3TSSA 2H89B 2L00B 4BZAA 2BVCA 3ZUNA 2N9XA 2GI9A 3Q3JA 5TR5A 2IGHA 1I35A 1BMLC 1FEHA 4KDIC 3RFZB 3AE9B 2EKEC 3PLUA 4FA6A 1D5XC 4NAMA 4RGNA 3X23A 1R4NI 4LJPB 5E6PA 3U30A 1OEYJ 2WXOA 4BKGA 1FNVA 2LJ5A 4AWJA 5DPRA 2CJNA 2W82A 1UGMA 1E6EB 2K5PA 2VZKD 5AZFA 4O1NA 3AH7A 2FIFA 4RGMA 1QILA 1C77A 1WXSA 5TSSA 4K1RB 2KOXA 3V05A 5D2MB 3UIPB 4DXAB 1UELA 3VR9B 2M0AA 2N1WA 3PT2B 2V0GA 1SE9A 2XN9C 1GAQB 1N5XA 2L32A 2NTTA 1GB1A 3W9CB 4XC2A 4DXGA 2NTSA 1T0QC 1FPYA 5JZEB 2CR5A 3TIXA 2J0MA 2V3PA 2ICIA 2AX5A 1WGDA 2LZ6A 2KMCA 4YTMB 4FJYA 4HCPB 1RAXA 2CHXA 3O65B 2BKFA 1F2RI 1FO4A 1N5WA 4JGHB 1ZOYB 4AOFA 4TMAB 2FNJB 4IM0A 1XXGA 4YTPB 3A9JA 2K3UA 3HVDA 4G50A 3R2TA 5BYSA 4OHJA 3QJZA 1IPGA 2OEDA 1YN5A 2PVOD 2BS3B 4W9FA 2M4NA 3BVZA 3AE4B 1E8YA 4HVBA 3ZIMA 4LNFA 4AS1A 1MG8A 3H8HA 2QDFA 2WDRB 2WHIA 1WX7A 2DYOA 4KZ0A 1WXMA 1GG3A 2NCNA 4ZRPA 2JZZA 2IY1B 3CSTA 5IKCM 1VDVA 3ZGZA 2V4IB 2LXAA 1CZPA 2RMMA 1NBFC 1V2YA 1J0GA 2KKCA 1PFDA 1R4MI 2GLSA 1HE8A 3A4RA 3WALA 2MP2B 5E6OA 2KANA 3MHSD 3L4PA 1V80A 3BIID 4PS7A 4HRSA 3DHHC 1BXTA 1WJ4A 3KW5B 2D11A 1FXTB 1TS3A 1IGDA 4AJYB 3AE2B 3P2BA 1AWDA 4WJOA 2XEWA 2N1VA 2YVCA 3N1YC 3NJTA 1VRAB 2ZJDA 2QJLA 3PRZA 4W9EA 3R8BA 2MRPA 2GRIA 5D7GA 3HVZA 3KUDB 3Q3OC 3A33B 3FILB 3L16A 3ML8A 4IWOA 2WX0A 3VFKA 1XEEA 4EZLA 2NR2A 3ZTCA 2WXNA 1ROEA 4MELA 5C3JB 2FUG1 2BT6A 2JXTA 2Y3AA 3PSEB 5BMGA 2LMCA 2KMAA 4W9JA 2O6VD
chains in the Genus database with same CATH topology
1J8CA 3NHEB 2HE7A 1LQBA 3QHTA 1GC7A 2RR9A 1E90A 4EFOA 3UINB 2NBWB 3JSVA 3DBHI 3DVGY 3HM3A 3JVZX 1D3ZA 5JHAA 2VRRB 2NBUA 1WZ3A 2JRHA 4TQ1A 2ASQA 2KLCA 4PYUA 4ICVA 2L8JA 4EUTA 1SIFA 4WWPA 2BKRB 3NY5A 2MBHA 3H7PB 3V6EB 4BKTA 2FCQA 1WGGA 3VVWB 3RULA 3VUWA 2LGXA 4E71A 2GBRA 3H1UA 3PS6A 5CTRC 1YIWA 4NNJB 1H4RA 4DWFA 3ZTDA 3PV1A 3BINA 2V3SA 4HPLB 4MGYE 1GUAB 3SDLC 4DDID 4GDLB 2MBQA 1YJ1A 3WAPA 4ANXA 3A9JB 2PE6B 2K6QA 1GC6A 4WAAA 2ZEQA 1V6EA 2DZMA 2FCSA 5AZGA 1WYWB 3PREA 5L95C 2J7QB 4PS3A 4W9HA 2BWFA 4F8CB 4GU2A 1YD8U 1E7VA 4A3PA 2XK5B 3QWZB 1V5TA 2GMIC 1P9DU 2LD9A 1TGZB 3TJPA 3W1SC 4WJQA 3S2AA 2AEHA 4II2B 3UGBB 5C23A 4IWQA 4EKUA 5CHVC 3L10B 4GSWA 2B3AA 3VUXA 4NQKE 2JPHA 1WRDB 2N7DA 2NBVB 3R3MA 3VTVA 3V60A 1A5RA 3V61A 2J0JA 2L0TA 2LXCA 1JRUA 4WJPA 3ML9A 3DOWA 4BKSA 1EF5A 3LJ3A 3DVGX 2ZCBA 1WR6E 3M95A 1J19A 2DZJA 3N3KB 1UBIA 2FAZA 2CKHB 2KTFA 3B1LX 2N7EA 2K6DB 1WXAA 4I6PA 3N30A 4KV2A 3A1QB 4EOYA 3QQ8B 1F9JA 2MSED 3C0RB 4HWIB 1E8WA 1EO6A 4KDLB 3TBLD 4KSKC 2G4DB 2OOBB 3HM6X 4RMAA 2KTRB 2MX2A 3L13A 4LJOB 3ZVVA 3IBEA 5KHOA 1L2NA 3IHPC 2MWSB 2JVCA 2ZPNA 2KTRA 3DDCB 3EC8A 2AL6A 4XZ4A 4TQ0A 3ECIA 2CHWA 5LLIA 2GBMA 2KJRA 2XBBC 3AU4A 4XX5A 2C7MB 2RGFA 2LUEA 4ZRJA 2IO3B 2DYBA 2R2QA 1V49A 3ENEA 2BYVE 2KHWB 3IG3A 4W9JA 4YL8A 4EZKA 1ZW7A 2IO2B 3R7QA 3UF8A 2K8BA 4MGKE 2W9NA 2DX5B 2C5LC 4ANUA 5J18A 4HDOA 4GDLA 5AZHA 2KC2A 2WYQA 3BY4B 3VTUA 4DDGD 3EFUA 3WIMA 2LRWA 3ONSA 3VDZA 2IO1B 3PPAA 4WQOB 1EF1A 2UYZB 4M0WB 2KFKB 5DPSA 3B08A 4JL9A 1T0YA 2ZNVC 3TCAA 2C60A 4DHJB 2UWQA 3U7DA 2NVUI 2O6VA 2BPSA 3PRPB 1UD7A 2MBOA 5D6JB 3TL5A 3ZNGC 4DK5A 2L7RA 2GBJA 3KUCB 2N9PC 2ZNVB 3R66C 2GOWA 4URKA 2FUHB 1IYFA 1X1MA 1UZXB 2C7NB 4MDKE 4ASWC 4X57B 4DBGA 2DYMA 2MBEA 3RD2A 3CSFA 4II3B 1VCBA 3CMMB 2D3GA 2ZVNA 2BGFA 2KFJA 5DCNA 3WANA 4AP4C 1QZEA 1U4AA 3RT3B 1KLVA 2K8HA 2O2VB 4G3XB 2Y5BB 1ISNA 3W1SA 1V5OA 3K9OB 5CX3A 1P1AA 3PGEA 3DBLI 2DAFA 3NZSA 4FHJA 2IYDB 2KK8A 4GDKA 2WDTB 3AULA 4GIVA 3KVFB 4N9F4 3GOEA 4K81A 2PPHA 4TV3A 4WWNA 2FCMA 2JWZA 2OJRA 2KDIA 1UBQA 2DZKA 3A9KB 4NAWA 3W1YA 2DZIA 2LGDA 2KLGA 4M8NA 3ZNID 1E8XA 3NS8A 2KVRA 2KQ7A 3ZLZA 3WA0A 1WMHB 2L76A 3DQVA 4HK2A 4W9KA 3VUYA 2KN5A 5L83A 4OVVA 1V81A 2KX0A 5G2NA 3ZDMC 3ZRCA 1Q1OA 2C9WB 3A4SC 3JSVB 4JLCA 5IA7A 1LM8B 1YX5B 5EDSA 2LASA 3ZRFA 3NOBA 2G4SA 3KH0A 2K8CA 3L0WB 1WH3A 2NS5A 2RSUA 1WM3A 3UIOB 1WE6A 1S1QB 2KQSA 4XC2A 3M63B 5G55A 2KJHB 3HIZA 2KJ6A 4KIKA 1NDDA 3RUIB 4MGIE 1UH6A 3R7RA 4AUQC 4ZDVA 3IVFA 2MBBB 3APDA 2JF5A 2G3QB 1WXVA 2HTHA 4FULA 2G45B 3PTFC 4IG7B 4K7UA 1WX8A 4MSMB 3I3TB 3OLMD 3OJ4B 5JH5C 3M62B 1WJNA 1EUVB 2EMTA 4WJNA 2MCNB 4KSLC 2AL3A 2MP2A 5IAAC 4MEMA 4BOZB 2AWTA 3APCA 5CHWA 2M17A 1XT9B 2MA9B 4NY0A 4ANWA 4LDTD 2BF8B 1WMHA 2KO3A 3NZUA 2KXJA 4PYZA 5CHFA 1NI2A 4BBNF 1Z2MA 1TZ1A 2CS4A 4ZYNA 2LVQA 1K8RB 2D2QA 2CU1A 3L17A 5HKHA 4MM3A 3QX1A 3ZO5B 2ZCCA 3SHQA 2JRIB 4E3CA 4ICUA 4HDQA 1WE7A 3JW0X 4K7SA 3QCAA 2L00B 1S3SG 3ALBA 3ZUNA 2N9XA 5LXHA 3Q3JA 5TR5A 3Q3FA 4G0NB 1I35A 5E6NA 3H9DA 1E8ZA 1C3TA 1V86A 2NPTA 1WIAA 4FHKA 4KDIC 4IM2A 4W9LA 4GOCA 2C7HA 1C1YB 2KDFB 1I42A 3RCZA 3CF6E 2EKEC 3PLUA 4FA6A 2M1MA 3DVNV 2K39A 3QARA 3X23A 1Z5SB 3A1QA 5BO4B 4BOSC 4FJVB 1R4NI 4LJPB 1TBEA 4IC7B 2LVOA 1WF9A 1WJ6A 4MH0E 5E6PA 1WGYA 1P3QU 4FLHA 1OEYJ 4FJZA 2LI5A 4LDTB 3U30A 4BKGA 2LJ5A 4AWJA 1M94A 5DPRA 2A5UA 3VH4B 4HJKA 2PEAA 1UGMA 2FIDA 2V4LA 2BYEA 4GDKB 4FADA 3TMPB 4JIOU 5AZFA 3LDZE 2FIFA 2GBKA 4W9DA 1E7UA 3N32A 5DPWA 1SGHA 1WXSA 4EEWA 4TKNA 4B6WA 2DENB 4P7IA 4K1RB 2KOXA 4RM9A 1OGWA 3PVLA 2N4FA 4MJSB 2Z0EB 4LCDE 3VHTC 5D2MB 2I1KA 4WWOA 2NPTB 2MW5A 3UIPB 3VH3B 4NJ6A 4DXAB 1UELA 4MJSA 5D94A 4J6IA 4CO7A 1KOTA 2N1WA 3PT2B 3AI5A 2YLMA 1BT0A 1SE9A 1YQBA 4G11A 4NPNA 3RYTA 2KD0A 2BYFA 3OAWA 1P98A 1WM2A 1P0RA 3K9PB 4BKSD 2MLBA 3EECA 4GN1A 1CMXB 1ZKHA 2BWES 1XD3B 2LRUA 1TTNA 4HPMB 2L0FA 2J0KA 4MGZE 4NJ7A 4W9CA 4E74A 2DAJA 3PHXB 3DBRI 1WR1A 5KHQA 3HHMA 2I1JA 3D32A 4A3OA 3PZDA 4GXBA 2Z0DB 4NQLB 3DPDA 4W9GA 4IM3A 1Q5WB 2REXA 5FR6A 1PQSA 5JZEB 2CR5A 3MJWA 3TIXA 2J0MA 2JT4B 3ZKJC 2HJ8A 1Q0WB 2L05A 2LVPA 1OTRB 1WGDA 2LZ6A 2EMSA 2GBNA 2JZ3B 4GMVA 2KMCA 4F1SA 2R2OA 4FJYA 4HCPB 3H7PA 3L54A 2ZPYA 2KWUB 3H7SA 3DVNU 3UQBA 1RAXA 2WWZA 4W9IA 2CHXA 4ANVA 3O65B 3QK0A 2BKFA 2KNBA 3QC8B 4M8MA 3VQIA 4JGHB 4AOFA 1WX9A 2IZVB 2FNJB 3VXWA 2PE9A 4IM0A 2L3ZA 3RZFA 3RZWC 4DHJD 5J2RA 2JUOA 3QIJA 1KM7A 3A9JA 4RM8A 3AXCA 4HLEA 4G50A 3WAOA 4ZRKA 5JHBA 3QJZA 1IPGA 2RD0A 2A4ZA 3H6NA 2HD5B 2KC1A 4CYEA 2KFKA 2AYOB 2M0XA 1G6JA 4W9FA 2M4NA 3A9KA 4A20A 1E8YA 1RLFA 4GGQA 4IWPA 3ZIMA 4HVBA 1MG8A 3ZDTA 5LXIB 1WJUA 3VAWA 4DHZE 3APFA 3WAMA 5J17A 1L7YA 3V6CB 3M3JA 1WX7A 2DYOA 2KWCA 2WX1A 4KZ0A 3PRMB 1KJTA 4BVUC 1WXMA 3T8MA 1GG3A 2KWVB 2NCNA 3QA8A 2LWPA 3ZNHB 4IW0A 4KIKB 2JZZA 2IY1B 4DHZB 3CSTA 2N9EB 2IY0B 3KUZA 4PS8A 4HCNB 3X0WA 4IUMB 2LXAA 2PJHA 1NBFC 1V2YA 1J0GA 1LFDA 2KKCA 4I6NB 1WY8A 1R4MI 3UQAA 2Z59B 1GNUA 3HK0A 3DBSA 2KZRA 1HE8A 4NAWB 3A4RA 3ZW3A 3WALA 2MP2B 3QAQA 5GMVA 5E6OA 1OEYA 2K1FA 2KANA 1IP9A 1RFAA 3OJ3A 3T9LA 3MHSD 2M8SA 1V80A 4PS7A 4TUUA 3MTNB 3PLVA 3AU5A 1WFYA 4K7WA 2IBIB 1WJ4A 3U8ZA 4KZCA 3KW5B 3PHWB 2D11A 3VTWA 3B0AA 1FXTB 2QHOA 4KVGB 3SU8X 4FBJB 1AARA 1WZ0A 4AJYB 2KDBA 2D07B 3IFWB 3KYCD 3P2BA 4B95A 1WGHA 1Y8RC 1VD2A 2ZVOA 2D10A 3L08A 2XK5A 4WJOA 2XEWA 2N1VA 2YVCA 2KX3A 5DPTA 3ZNZB 1RRBA 2ZJDA 3PRZA 4HXDA 2IO0B 3DCGA 4F7ZA 4W9EA 4MSQB 2MRPA 2O6VB 5D7GA 1YX6B 4OVUA 3KUDB 4FN2A 3A33B 3KYDD 1OQYA 2V1YA 4B9KA 1XQQA 1H8CA 3L16A 3ML8A 4IWOA 5C1ZA 1E5WA 5AEKB 4BFRA 3GZNI 2CHZA 4JQWC 1V9JA 4GB9A 2WX0A 3VFKA 2LGYA 2DHZA 2K25A 4EZLA 4EZJA 2NR2A 3JYUA 3ZTCA 2MQJA 1LXDA 3EHVA 1WI0A 1ZGUB 4MELA 2JXXA 2RPQA 4I6LB 3SD5A 2O2VA 2JY6A 4ZRIA 4BBNC 3PSEB 1WGRA 3V62A 2KDEB 4CHKA 2KMAA 2ZZPB 2FCNA 1GJZA 4AJWA 2O6VD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J8C A;  3NHE B;  2HE7 A;  1LQB A;  3QHT A;  1GC7 A;  2RR9 A;  1E90 A;  4EFO A;  3UIN B;  2NBW B;  3JSV A;  3DBH I;  3DVG Y;  3HM3 A;  3JVZ X;  1D3Z A;  5JHA A;  2VRR B;  2NBU A;  1WZ3 A;  2JRH A;  4TQ1 A;  2ASQ A;  2KLC A;  4PYU A;  4ICV A;  2L8J A;  4EUT A;  1SIF A;  4WWP A;  2BKR B;  3NY5 A;  2MBH A;  3H7P B;  3V6E B;  4BKT A;  2FCQ A;  1WGG A;  3VVW B;  3RUL A;  3VUW A;  2LGX A;  4E71 A;  2GBR A;  3H1U A;  3PS6 A;  5CTR C;  1YIW A;  4NNJ B;  1H4R A;  4DWF A;  3ZTD A;  3PV1 A;  3BIN A;  2V3S A;  4HPL B;  4MGY E;  1GUA B;  3SDL C;  4DDI D;  4GDL B;  2MBQ A;  1YJ1 A;  3WAP A;  4ANX A;  3A9J B;  2PE6 B;  2K6Q A;  1GC6 A;  4WAA A;  2ZEQ A;  1V6E A;  2DZM A;  2FCS A;  5AZG A;  1WYW B;  3PRE A;  5L95 C;  2J7Q B;  4PS3 A;  4W9H A;  2BWF A;  4F8C B;  4GU2 A;  1YD8 U;  1E7V A;  4A3P A;  2XK5 B;  3QWZ B;  1V5T A;  2GMI C;  1P9D U;  2LD9 A;  1TGZ B;  3TJP A;  3W1S C;  4WJQ A;  3S2A A;  2AEH A;  4II2 B;  3UGB B;  5C23 A;  4IWQ A;  4EKU A;  5CHV C;  3L10 B;  4GSW A;  2B3A A;  3VUX A;  4NQK E;  2JPH A;  1WRD B;  2N7D A;  2NBV B;  3R3M A;  3VTV A;  3V60 A;  1A5R A;  3V61 A;  2J0J A;  2L0T A;  2LXC A;  1JRU A;  4WJP A;  3ML9 A;  3DOW A;  4BKS A;  1EF5 A;  3LJ3 A;  3DVG X;  2ZCB A;  1WR6 E;  3M95 A;  1J19 A;  2DZJ A;  3N3K B;  1UBI A;  2FAZ A;  2CKH B;  2KTF A;  3B1L X;  2N7E A;  2K6D B;  1WXA A;  4I6P A;  3N30 A;  4KV2 A;  3A1Q B;  4EOY A;  3QQ8 B;  1F9J A;  2MSE D;  3C0R B;  4HWI B;  1E8W A;  1EO6 A;  4KDL B;  3TBL D;  4KSK C;  2G4D B;  2OOB B;  3HM6 X;  4RMA A;  2KTR B;  2MX2 A;  3L13 A;  4LJO B;  3ZVV A;  3IBE A;  5KHO A;  1L2N A;  3IHP C;  2MWS B;  2JVC A;  2ZPN A;  2KTR A;  3DDC B;  3EC8 A;  2AL6 A;  4XZ4 A;  4TQ0 A;  3ECI A;  2CHW A;  5LLI A;  2GBM A;  2KJR A;  2XBB C;  3AU4 A;  4XX5 A;  2C7M B;  2RGF A;  2LUE A;  4ZRJ A;  2IO3 B;  2DYB A;  2R2Q A;  1V49 A;  3ENE A;  2BYV E;  2KHW B;  3IG3 A;  4W9J A;  4YL8 A;  4EZK A;  1ZW7 A;  2IO2 B;  3R7Q A;  3UF8 A;  2K8B A;  4MGK E;  2W9N A;  2DX5 B;  2C5L C;  4ANU A;  5J18 A;  4HDO A;  4GDL A;  5AZH A;  2KC2 A;  2WYQ A;  3BY4 B;  3VTU A;  4DDG D;  3EFU A;  3WIM A;  2LRW A;  3ONS A;  3VDZ A;  2IO1 B;  3PPA A;  4WQO B;  1EF1 A;  2UYZ B;  4M0W B;  2KFK B;  5DPS A;  3B08 A;  4JL9 A;  1T0Y A;  2ZNV C;  3TCA A;  2C60 A;  4DHJ B;  2UWQ A;  3U7D A;  2NVU I;  2O6V A;  2BPS A;  3PRP B;  1UD7 A;  2MBO A;  5D6J B;  3TL5 A;  3ZNG C;  4DK5 A;  2L7R A;  2GBJ A;  3KUC B;  2N9P C;  2ZNV B;  3R66 C;  2GOW A;  4URK A;  2FUH B;  1IYF A;  1X1M A;  1UZX B;  2C7N B;  4MDK E;  4ASW C;  4X57 B;  4DBG A;  2DYM A;  2MBE A;  3RD2 A;  3CSF A;  4II3 B;  1VCB A;  3CMM B;  2D3G A;  2ZVN A;  2BGF A;  2KFJ A;  5DCN A;  3WAN A;  4AP4 C;  1QZE A;  1U4A A;  3RT3 B;  1KLV A;  2K8H A;  2O2V B;  4G3X B;  2Y5B B;  1ISN A;  3W1S A;  1V5O A;  3K9O B;  5CX3 A;  1P1A A;  3PGE A;  3DBL I;  2DAF A;  3NZS A;  4FHJ A;  2IYD B;  2KK8 A;  4GDK A;  2WDT B;  3AUL A;  4GIV A;  3KVF B;  4N9F 4;  3GOE A;  4K81 A;  2PPH A;  4TV3 A;  4WWN A;  2FCM A;  2JWZ A;  2OJR A;  2KDI A;  1UBQ A;  2DZK A;  3A9K B;  4NAW A;  3W1Y A;  2DZI A;  2LGD A;  2KLG A;  4M8N A;  3ZNI D;  1E8X A;  3NS8 A;  2KVR A;  2KQ7 A;  3ZLZ A;  3WA0 A;  1WMH B;  2L76 A;  3DQV A;  4HK2 A;  4W9K A;  3VUY A;  2KN5 A;  5L83 A;  4OVV A;  1V81 A;  2KX0 A;  5G2N A;  3ZDM C;  3ZRC A;  1Q1O A;  2C9W B;  3A4S C;  3JSV B;  4JLC A;  5IA7 A;  1LM8 B;  1YX5 B;  5EDS A;  2LAS A;  3ZRF A;  3NOB A;  2G4S A;  3KH0 A;  2K8C A;  3L0W B;  1WH3 A;  2NS5 A;  2RSU A;  1WM3 A;  3UIO B;  1WE6 A;  1S1Q B;  2KQS A;  4XC2 A;  3M63 B;  5G55 A;  2KJH B;  3HIZ A;  2KJ6 A;  4KIK A;  1NDD A;  3RUI B;  4MGI E;  1UH6 A;  3R7R A;  4AUQ C;  4ZDV A;  3IVF A;  2MBB B;  3APD A;  2JF5 A;  2G3Q B;  1WXV A;  2HTH A;  4FUL A;  2G45 B;  3PTF C;  4IG7 B;  4K7U A;  1WX8 A;  4MSM B;  3I3T B;  3OLM D;  3OJ4 B;  5JH5 C;  3M62 B;  1WJN A;  1EUV B;  2EMT A;  4WJN A;  2MCN B;  4KSL C;  2AL3 A;  2MP2 A;  5IAA C;  4MEM A;  4BOZ B;  2AWT A;  3APC A;  5CHW A;  2M17 A;  1XT9 B;  2MA9 B;  4NY0 A;  4ANW A;  4LDT D;  2BF8 B;  1WMH A;  2KO3 A;  3NZU A;  2KXJ A;  4PYZ A;  5CHF A;  1NI2 A;  4BBN F;  1Z2M A;  1TZ1 A;  2CS4 A;  4ZYN A;  2LVQ A;  1K8R B;  2D2Q A;  2CU1 A;  3L17 A;  5HKH A;  4MM3 A;  3QX1 A;  3ZO5 B;  2ZCC A;  3SHQ A;  2JRI B;  4E3C A;  4ICU A;  4HDQ A;  1WE7 A;  3JW0 X;  4K7S A;  3QCA A;  2L00 B;  1S3S G;  3ALB A;  3ZUN A;  2N9X A;  5LXH A;  3Q3J A;  5TR5 A;  3Q3F A;  4G0N B;  1I35 A;  5E6N A;  3H9D A;  1E8Z A;  1C3T A;  1V86 A;  2NPT A;  1WIA A;  4FHK A;  4KDI C;  4IM2 A;  4W9L A;  4GOC A;  2C7H A;  1C1Y B;  2KDF B;  1I42 A;  3RCZ A;  3CF6 E;  2EKE C;  3PLU A;  4FA6 A;  2M1M A;  3DVN V;  2K39 A;  3QAR A;  3X23 A;  1Z5S B;  3A1Q A;  5BO4 B;  4BOS C;  4FJV B;  1R4N I;  4LJP B;  1TBE A;  4IC7 B;  2LVO A;  1WF9 A;  1WJ6 A;  4MH0 E;  5E6P A;  1WGY A;  1P3Q U;  4FLH A;  1OEY J;  4FJZ A;  2LI5 A;  4LDT B;  3U30 A;  4BKG A;  2LJ5 A;  4AWJ A;  1M94 A;  5DPR A;  2A5U A;  3VH4 B;  4HJK A;  2PEA A;  1UGM A;  2FID A;  2V4L A;  2BYE A;  4GDK B;  4FAD A;  3TMP B;  4JIO U;  5AZF A;  3LDZ E;  2FIF A;  2GBK A;  4W9D A;  1E7U A;  3N32 A;  5DPW A;  1SGH A;  1WXS A;  4EEW A;  4TKN A;  4B6W A;  2DEN B;  4P7I A;  4K1R B;  2KOX A;  4RM9 A;  1OGW A;  3PVL A;  2N4F A;  4MJS B;  2Z0E B;  4LCD E;  3VHT C;  5D2M B;  2I1K A;  4WWO A;  2NPT B;  2MW5 A;  3UIP B;  3VH3 B;  4NJ6 A;  4DXA B;  1UEL A;  4MJS A;  5D94 A;  4J6I A;  4CO7 A;  1KOT A;  2N1W A;  3PT2 B;  3AI5 A;  2YLM A;  1BT0 A;  1SE9 A;  1YQB A;  4G11 A;  4NPN A;  3RYT A;  2KD0 A;  2BYF A;  3OAW A;  1P98 A;  1WM2 A;  1P0R A;  3K9P B;  4BKS D;  2MLB A;  3EEC A;  4GN1 A;  1CMX B;  1ZKH A;  2BWE S;  1XD3 B;  2LRU A;  1TTN A;  4HPM B;  2L0F A;  2J0K A;  4MGZ E;  4NJ7 A;  4W9C A;  4E74 A;  2DAJ A;  3PHX B;  3DBR I;  1WR1 A;  5KHQ A;  3HHM A;  2I1J A;  3D32 A;  4A3O A;  3PZD A;  4GXB A;  2Z0D B;  4NQL B;  3DPD A;  4W9G A;  4IM3 A;  1Q5W B;  2REX A;  5FR6 A;  1PQS A;  5JZE B;  2CR5 A;  3MJW A;  3TIX A;  2J0M A;  2JT4 B;  3ZKJ C;  2HJ8 A;  1Q0W B;  2L05 A;  2LVP A;  1OTR B;  1WGD A;  2LZ6 A;  2EMS A;  2GBN A;  2JZ3 B;  4GMV A;  2KMC A;  4F1S A;  2R2O A;  4FJY A;  4HCP B;  3H7P A;  3L54 A;  2ZPY A;  2KWU B;  3H7S A;  3DVN U;  3UQB A;  1RAX A;  2WWZ A;  4W9I A;  2CHX A;  4ANV A;  3O65 B;  3QK0 A;  2BKF A;  2KNB A;  3QC8 B;  4M8M A;  3VQI A;  4JGH B;  4AOF A;  1WX9 A;  2IZV B;  2FNJ B;  3VXW A;  2PE9 A;  4IM0 A;  2L3Z A;  3RZF A;  3RZW C;  4DHJ D;  5J2R A;  2JUO A;  3QIJ A;  1KM7 A;  3A9J A;  4RM8 A;  3AXC A;  4HLE A;  4G50 A;  3WAO A;  4ZRK A;  5JHB A;  3QJZ A;  1IPG A;  2RD0 A;  2A4Z A;  3H6N A;  2HD5 B;  2KC1 A;  4CYE A;  2KFK A;  2AYO B;  2M0X A;  1G6J A;  4W9F A;  2M4N A;  3A9K A;  4A20 A;  1E8Y A;  1RLF A;  4GGQ A;  4IWP A;  3ZIM A;  4HVB A;  1MG8 A;  3ZDT A;  5LXI B;  1WJU A;  3VAW A;  4DHZ E;  3APF A;  3WAM A;  5J17 A;  1L7Y A;  3V6C B;  3M3J A;  1WX7 A;  2DYO A;  2KWC A;  2WX1 A;  4KZ0 A;  3PRM B;  1KJT A;  4BVU C;  1WXM A;  3T8M A;  1GG3 A;  2KWV B;  2NCN A;  3QA8 A;  2LWP A;  3ZNH B;  4IW0 A;  4KIK B;  2JZZ A;  2IY1 B;  4DHZ B;  3CST A;  2N9E B;  2IY0 B;  3KUZ A;  4PS8 A;  4HCN B;  3X0W A;  4IUM B;  2LXA A;  2PJH A;  1NBF C;  1V2Y A;  1J0G A;  1LFD A;  2KKC A;  4I6N B;  1WY8 A;  1R4M I;  3UQA A;  2Z59 B;  1GNU A;  3HK0 A;  3DBS A;  2KZR A;  1HE8 A;  4NAW B;  3A4R A;  3ZW3 A;  3WAL A;  2MP2 B;  3QAQ A;  5GMV A;  5E6O A;  1OEY A;  2K1F A;  2KAN A;  1IP9 A;  1RFA A;  3OJ3 A;  3T9L A;  3MHS D;  2M8S A;  1V80 A;  4PS7 A;  4TUU A;  3MTN B;  3PLV A;  3AU5 A;  1WFY A;  4K7W A;  2IBI B;  1WJ4 A;  3U8Z A;  4KZC A;  3KW5 B;  3PHW B;  2D11 A;  3VTW A;  3B0A A;  1FXT B;  2QHO A;  4KVG B;  3SU8 X;  4FBJ B;  1AAR A;  1WZ0 A;  4AJY B;  2KDB A;  2D07 B;  3IFW B;  3KYC D;  3P2B A;  4B95 A;  1WGH A;  1Y8R C;  1VD2 A;  2ZVO A;  2D10 A;  3L08 A;  2XK5 A;  4WJO A;  2XEW A;  2N1V A;  2YVC A;  2KX3 A;  5DPT A;  3ZNZ B;  1RRB A;  2ZJD A;  3PRZ A;  4HXD A;  2IO0 B;  3DCG A;  4F7Z A;  4W9E A;  4MSQ B;  2MRP A;  2O6V B;  5D7G A;  1YX6 B;  4OVU A;  3KUD B;  4FN2 A;  3A33 B;  3KYD D;  1OQY A;  2V1Y A;  4B9K A;  1XQQ A;  1H8C A;  3L16 A;  3ML8 A;  4IWO A;  5C1Z A;  1E5W A;  5AEK B;  4BFR A;  3GZN I;  2CHZ A;  4JQW C;  1V9J A;  4GB9 A;  2WX0 A;  3VFK A;  2LGY A;  2DHZ A;  2K25 A;  4EZL A;  4EZJ A;  2NR2 A;  3JYU A;  3ZTC A;  2MQJ A;  1LXD A;  3EHV A;  1WI0 A;  1ZGU B;  4MEL A;  2JXX A;  2RPQ A;  4I6L B;  3SD5 A;  2O2V A;  2JY6 A;  4ZRI A;  4BBN C;  3PSE B;  1WGR A;  3V62 A;  2KDE B;  4CHK A;  2KMA A;  2ZZP B;  2FCN A;  1GJZ A;  4AJW A;  2O6V D; 
#chains in the Genus database with same CATH topology
 1LQB A;  1E90 A;  4ZHO A;  3UIN B;  3I57 A;  3Q3N C;  1HXY D;  3DBH I;  4OVZ A;  1QOB A;  4QAY A;  2VRR B;  2NBU A;  1WZ3 A;  3IAM 1;  2ASQ A;  2KLC A;  3NUH B;  4PYU A;  2L8J A;  4EUT A;  1WSP A;  1PYW D;  2BKR B;  3FAH A;  3BK2 A;  2FCQ A;  3VUW A;  1HTQ A;  4E71 A;  1YIW A;  2Y5P A;  3BIN A;  1GUA B;  4GDL B;  3BYT B;  1ACC A;  4ANX A;  3GB1 A;  3I9V 1;  3VRB B;  2FCS A;  3P4R B;  1WYW B;  1KH0 A;  1N6Z A;  4PS3 A;  4W9H A;  4GU2 A;  4M0W A;  4YSX B;  1C76 A;  3W1S C;  3UGB B;  5C23 A;  4KKJ A;  3LYY A;  1L0X B;  4EKU A;  3VUX A;  1A5R A;  3ML9 A;  2ZW1 A;  1SEB D;  3LJ3 A;  3W5V B;  2ZCB A;  1WR6 E;  3M95 A;  1J19 A;  2DZJ A;  1GB4 A;  3DWG C;  2CKH B;  2KTF A;  2N7E A;  4I6P A;  2IGG A;  3B9J A;  1F9J A;  3C0R B;  2TSS A;  1EO6 A;  2BYT A;  1JQ4 A;  3HM6 X;  4RMA A;  3ZVV A;  1L2N A;  2ZPN A;  1T3Q A;  2KTR A;  1TS5 A;  2X8X X;  2XBB C;  4D2K A;  2V9H A;  2RGF A;  3V60 A;  2DYB A;  1V49 A;  2IDY A;  5J18 A;  4HDO A;  4GDL A;  5AZH A;  4P1B C;  2WXR A;  4WAF A;  4C56 C;  2PKO A;  4MH8 A;  3B08 A;  3VRA B;  3AEE B;  2NVU I;  2O6V A;  3PRP B;  2L7R A;  2GBJ A;  1AN8 A;  2N9P C;  2ZNV B;  1E0Z A;  1CQV A;  1X1M A;  1V97 A;  3HRD D;  4X57 B;  2ONQ A;  1ZXI A;  3SFD B;  1C4A A;  2ZVN A;  1K51 A;  2KFJ A;  2HTM E;  1TY0 A;  4MAC A;  2WXL A;  1SBB B;  3B2G A;  4B0M A;  4YSY B;  1P1A A;  3DBL I;  2DAF A;  4P16 A;  3ZJV A;  1NEN B;  4GDK A;  2KK8 A;  1L6V A;  2OJR A;  3A9K B;  1UBQ A;  3ZJU A;  1FNU A;  2KLG A;  1YJJ A;  4W9K A;  4B0E A;  5IN7 A;  2D5G A;  5G2N A;  3ZRC A;  3AE3 B;  4YTN B;  1Q1O A;  2C9W B;  2WU5 B;  3A4S C;  3P4P B;  4J3O D;  3NOB A;  4XDD A;  1OFF A;  1ZPS A;  3DBH B;  4UDU C;  1FXA A;  3L0W B;  3UIO B;  1PGA A;  3M63 B;  3RUI B;  4KIK A;  3HIZ A;  2KJ6 A;  4ZDV A;  1NDD A;  3R7R A;  4WQM A;  2G45 B;  3PTF C;  1WX8 A;  4MSM B;  4R3D A;  2IJ0 A;  1WGK A;  1L5P A;  3AN1 A;  3M62 B;  1FCL A;  2MCN B;  2AL3 A;  3MHZ A;  1SF0 A;  2LHE A;  1WMH A;  3NZU A;  5CHF A;  1T5X D;  3NS1 A;  1EWC A;  5HKH A;  4OZA A;  4MM3 A;  1NEK B;  1Q10 A;  2ZCC A;  1SJH D;  2JU6 X;  3AEB B;  5G5G A;  4ZYS A;  3Q3F A;  4G0N B;  3H9D A;  1C3T A;  1WIA A;  2L52 A;  1C1Y B;  3P1M A;  3RCZ A;  1XF5 L;  2M1M A;  1MHH E;  2K39 A;  2X38 A;  4BOS C;  4FJV B;  1R7S A;  2HJ1 A;  5FR3 A;  2IPK D;  1ZUD 2;  1WJ6 A;  1WF9 A;  4MH0 E;  4FLH A;  4LDT B;  1MJD A;  2A5U A;  4HJK A;  3VH4 B;  1EWY C;  2BYE A;  5BMH A;  4FAD A;  3TMP B;  1T0R C;  4JIO U;  4XGA B;  4W9D A;  1KTK A;  2CU3 A;  1R4M B;  4EEW A;  4TKN A;  4B6W A;  2DEN B;  3N9Y C;  3I63 C;  1L4Z B;  4KKI A;  1OGW A;  3PVL A;  2Z0E B;  2I1K A;  2KVZ A;  4WWO A;  4REZ A;  1FRR A;  2IGD A;  4MJS A;  2ACZ B;  4CO7 A;  1BT0 A;  1XCQ L;  2J52 A;  2PLP A;  3K9P B;  4BKS D;  2MLB A;  1XD3 B;  4E74 A;  4MGZ E;  2J0K A;  4W9C A;  3DBR I;  4MM3 B;  1WR1 A;  2I1J A;  3D32 A;  1QOF A;  3BWU D;  4IM3 A;  2J4X A;  1PQS A;  4LK0 M;  2JT4 B;  1UUP A;  2BQQ A;  1OTR B;  3BK1 A;  2KWU B;  3V3X A;  2WWZ A;  3IAS 1;  1M4V A;  2KNB A;  3QC8 B;  3VQI A;  3T3O A;  2JYT A;  3Q6B A;  2PE9 A;  2L3Z A;  3RZF A;  4DHJ D;  2NMQ A;  4IOI E;  3WAO A;  4ZRK A;  4L1B A;  3PZ8 A;  2RD0 A;  2A4Z A;  3H6N A;  2HD5 B;  2N9L A;  1AW7 A;  2AYO B;  2KFK A;  2M0X A;  1PGB A;  1QQR A;  1F52 A;  4A20 A;  4GGQ A;  4AQ7 A;  4DHZ E;  3M3J A;  4C80 A;  2KWC A;  2D3A A;  2Z8L A;  3PRM B;  1KJT A;  1IGC A;  2KWV B;  3MC0 B;  3QA8 A;  2LWP A;  4IW0 A;  3Q8E A;  4DHZ B;  4RF0 A;  4LNN A;  4HCN B;  1C78 A;  4N59 A;  3WCQ A;  3EGR A;  1D5Z C;  3ZYY X;  3UQA A;  2Z59 B;  4A8X C;  3NRZ A;  3DBS A;  5IO9 A;  4HJG E;  2MJE A;  3URY A;  5BYR A;  5GMV A;  1IP9 A;  1C9F A;  2LEK A;  3OJ3 A;  4A55 A;  4TUU A;  2G9H D;  3MTN B;  4ARC A;  3AU5 A;  4K7W A;  4KZC A;  3PHW B;  1L4D B;  2QHO A;  1N60 A;  3SU8 X;  2D07 B;  3IFW B;  4M02 A;  2KWD A;  1WGH A;  1MHX A;  2D10 A;  2XK5 A;  5EE1 A;  2KX3 A;  1UF0 A;  3RNE C;  3ZNZ B;  1XCT L;  4HXD A;  4F7Z A;  1YQ4 B;  4FN2 A;  5HG2 A;  2LGI A;  2BBC A;  2V1Y A;  4XWT A;  2WP9 B;  4B9K A;  1XQQ A;  3Q8A A;  5AEK B;  2CHZ A;  3Q69 A;  5IP4 D;  2LGY A;  1E7P B;  3N1X C;  4FXC A;  5GXG B;  1WI0 A;  2JXX A;  2EKI A;  1WWT A;  4I6L B;  2JY6 A;  5HI1 A;  1WGR A;  3KLS X;  3NHE B;  4BAX A;  4EE2 A;  2PMV A;  3QHT A;  1GC7 A;  2RR9 A;  1RWS A;  5EE0 A;  3P42 A;  3DVG Y;  3JVZ X;  1FIQ A;  5JHA A;  3DBR B;  4TQ1 A;  4ICV A;  1V1P A;  4WWP A;  3H7P B;  1TY2 A;  1WGG A;  3VVW B;  3TEZ A;  2GBR A;  4IKG A;  2I2Y A;  4IDI A;  4N6E B;  1JW9 D;  4US8 A;  2MBQ A;  1YJ1 A;  3WAP A;  3A9J B;  3AM9 A;  4WAA A;  1FRD A;  2H88 B;  3BVM A;  2DZM A;  3PRE A;  5L95 C;  2J7Q B;  4F8C B;  5LNK 1;  1E7V A;  5EE9 A;  2XK5 B;  3QWZ B;  2GMI C;  1P9D U;  3S2A A;  2BTE A;  4II2 B;  2INC C;  5CHV C;  3L10 B;  4NQK E;  2NBV B;  1WRD B;  3R3M A;  3VTV A;  1JRU A;  3DOW A;  1HZ6 A;  2BS2 B;  4OZB A;  1HQR D;  3T3N A;  2MEK A;  1QKZ A;  3AMZ A;  4EOY A;  3QQ8 B;  2MSE D;  4HWI B;  1SJE D;  4USA A;  3PO0 A;  4KDL B;  4KSK C;  1TKY A;  3L13 A;  3RPF C;  3IHP C;  2SAK A;  2M56 B;  2KJR A;  3AU4 A;  2QMT A;  3CWI A;  2IND C;  3FC4 A;  2XNA C;  4YL8 A;  2BYV E;  3IG3 A;  5G5H A;  4EZK A;  1ZW7 A;  2BB6 A;  2IO2 B;  3BY4 B;  2LRW A;  3U7Z A;  3VDZ A;  5EE3 A;  2LUM A;  1EF1 A;  2UYZ B;  5DPS A;  1I4R A;  1R4N B;  2ZNV C;  2ON8 A;  2C60 A;  1GPX A;  1EU4 A;  3U7D A;  1B9R A;  4DK5 A;  2BPS A;  3TL5 A;  1D4B A;  4MDK E;  2DYM A;  4II3 B;  2WXQ A;  4AP4 C;  1F1H A;  5I4D A;  1U4A A;  3RT3 B;  4XDC A;  1KLV A;  2O2V B;  3CIR B;  1ISN A;  3Q2A C;  1V5O A;  5CX3 A;  4FHJ A;  4WH4 A;  3GS2 A;  4N9F 4;  4ZOH C;  2PPH A;  4NAW A;  3W1Y A;  1DGJ A;  2LGD A;  3NS8 A;  3ZLZ A;  3WA0 A;  3AED B;  2L76 A;  1JWB D;  4OVV A;  1V81 A;  3ZDM C;  3MC9 A;  3FKY A;  1YX5 B;  5EDS A;  2LAS A;  3ZRF A;  2G4S A;  1WM3 A;  2MJD A;  1C4P A;  5G55 A;  3GP7 A;  3IVF A;  2HDE A;  3APD A;  4RGT A;  1WJN A;  4S17 A;  1TT5 B;  4MEM A;  4BOZ B;  2AWT A;  3DBL B;  2M17 A;  4NY0 A;  4ANW A;  2JZP A;  2BF8 B;  1Z2M A;  1TZ1 A;  4ZYN A;  2LVQ A;  1K8R B;  1C4C A;  3SHQ A;  2JRI B;  3MP9 A;  4HDQ A;  3QCA A;  3ALB A;  5E6N A;  1E8Z A;  1V86 A;  2C7H A;  1I42 A;  3CF6 E;  3DVN V;  4P1C C;  3QAR A;  1YN3 A;  1Z5S B;  5BO4 B;  2WS3 B;  2Q5W D;  4IC7 B;  3U4E G;  2LVO A;  1WGY A;  1P3Q U;  4OW0 A;  4FJZ A;  1M94 A;  1B1Z A;  1K53 A;  2D3C A;  2FID A;  2V4L A;  3LDZ E;  1E7U A;  3N32 A;  5DPW A;  3NVW A;  1SGH A;  4A9A A;  4P7I A;  3Q14 C;  2AQ2 B;  2N4F A;  4MJS B;  1YOV B;  4LCD E;  3VHT C;  1MI0 A;  2NPT B;  1K52 A;  3VH3 B;  5D94 A;  4J6I A;  1KOT A;  2YLM A;  3AV8 A;  1YQB A;  4NPN A;  2KD0 A;  3OAW A;  1P98 A;  1WM2 A;  1P0R A;  5AUI A;  3EEC A;  4HPM B;  1CMX B;  1DYQ A;  2LRU A;  1TTN A;  1F77 A;  2L0F A;  1JRP A;  1FMA D;  3HHM A;  3AEF B;  3PZD A;  4GXB A;  2Z0D B;  2OHF A;  2REX A;  1TKG A;  3MJW A;  2QCZ A;  3ZKJ C;  1VJK A;  2HJ8 A;  1KLU D;  1CJE A;  1Q0W B;  2MHJ A;  2EMS A;  4F1S A;  4PK1 A;  2R2O A;  3H7P A;  4H2A A;  2WXI A;  2ZPY A;  3L54 A;  4HKQ A;  1RFK A;  3DVN U;  1QT9 A;  2INP E;  4W9I A;  4ANV A;  4M8M A;  1SSN A;  2CJO A;  4ARI A;  1WX9 A;  3RZW C;  1ESF A;  3Q3M C;  2W55 A;  5J2R A;  1KM7 A;  4RM8 A;  3AXC A;  4HLE A;  4LTU A;  4CYE A;  2PW9 A;  3BYY B;  3A9K A;  1RLF A;  2W3S A;  3LB8 C;  1WJU A;  3VAW A;  4US9 A;  1ET9 A;  3E56 A;  3WAM A;  1DOY A;  2BS4 B;  2WX1 A;  4MT5 A;  1JRO A;  3RI7 C;  3ZNH B;  4KIK B;  3ZQ4 A;  3AE1 B;  3KUZ A;  2IY0 B;  2MJ3 A;  4IUM B;  2ZW0 A;  3ZXR A;  2PJH A;  1TYG B;  2WXJ A;  1WY8 A;  3HK0 A;  3ZW3 A;  2V3N A;  1N62 A;  1UWM A;  2DLB A;  2K1F A;  3SR6 A;  3UI3 A;  1SE3 A;  1OQR A;  3PLV A;  1FFV A;  1WFY A;  2IBI B;  1VZ6 A;  3U8Z A;  4KVG B;  2FE8 A;  1AAR A;  2WU2 B;  2KDB A;  3KYC D;  1FFU A;  4RFB A;  4B95 A;  1HTO A;  1WYG A;  4M01 A;  1L0Y B;  1Y8R C;  1XLN A;  1VD2 A;  2AQ1 B;  4ZHP A;  3Q8B A;  5DPT A;  2KYW A;  2Y5C A;  1RRB A;  2IO0 B;  4MSQ B;  1SE2 A;  1D5M C;  4WUR A;  1YX6 B;  5E6J A;  3I5J C;  1JML A;  4OVU A;  3PZ7 A;  1OQY A;  1H8C A;  1DOX A;  2JSV X;  5C1Z A;  1E5W A;  4GB9 A;  3AE6 B;  4RNA A;  2K25 A;  4EZJ A;  3JYU A;  1LXD A;  3EHV A;  2WGS A;  2RPQ A;  3P63 A;  2RDB C;  3SD5 A;  2O2V A;  4ZRQ A;  4ZRI A;  4BBN C;  5JXV A;  3V62 A;  3TEW A;  2KDE B;  4CHK A;  2FCN A;  1GJZ A;  4AJW A;  1UNS A;  1VZ7 A;  1VLB A;  1ZP0 B;  2WXH A;  2N7J A;  2WXK A;  1I7H A;  1D3Z A;  2MH7 A;  1T0S C;  2JRH A;  3AE5 B;  1VZ8 A;  4LNO A;  4DXF A;  1I4G A;  2MBH A;  3V6E B;  4BKT A;  1K50 A;  3ETR A;  1L6U A;  4LLG M;  3ZXV A;  3H1U A;  1PGX A;  3IT4 B;  2L1A A;  4DWF A;  2V3S A;  4HPL B;  2PTL A;  2QC8 A;  1OQQ A;  2DNF A;  3RNB C;  4RGO S;  2PE6 B;  2JWU A;  2K6Q A;  1GC6 A;  1I4X A;  1V6E A;  5AZG A;  2BWF A;  1IUE A;  1XO3 A;  2LD9 A;  1QOG A;  1JWS D;  4WJQ A;  2KAJ A;  1MPE A;  4GSW A;  2N7D A;  5FK9 C;  2LXC A;  3AE8 B;  4BKS A;  1WRI A;  3DVG X;  3HUI A;  3N3K B;  2FAZ A;  2WDV B;  3B1L X;  2K6D B;  1WXA A;  4KV2 A;  1KRH A;  1UGJ A;  2JQR B;  1E8W A;  1NYQ A;  3TBL D;  2QIL A;  3IXS A;  3GZN B;  2KMM A;  1JWU D;  4LJO B;  4ACF A;  3DHI C;  5KHO A;  2MWS B;  3DDC B;  1QLB B;  2AL6 A;  1TIF A;  4WWM A;  4TQ0 A;  1HZ5 A;  2CHW A;  2GBM A;  4DQO C;  2RDH A;  1RYJ A;  4ZRJ A;  2R2Q A;  3GE8 C;  2K8B A;  2W9N A;  3O13 A;  1TZO A;  2K0P A;  4Q2J A;  4C4V A;  4M00 A;  4C7Y A;  4DDG D;  2EEL A;  3WIM A;  3LXF A;  3RNG C;  3PPA A;  4M0W B;  2E3T A;  2PVG C;  1I4P A;  4JL9 A;  1T0Y A;  2WXM A;  4DHJ B;  1IBX A;  2UWQ A;  3ZNG C;  1J7B A;  1J7C A;  1IYF A;  1UZX B;  1STE A;  4L2Y A;  4ASW C;  3RD2 A;  1VCB A;  3Q8F A;  3CMM B;  2D3G A;  2BGF A;  5H8Y E;  2VH2 A;  3WAN A;  3B2F A;  1QZE A;  3EA6 A;  4G3X B;  2Y5B B;  5H92 C;  3P4S B;  2IYD B;  2WQY B;  3AUL A;  3GOE A;  4P6V F;  4TV3 A;  4KGR A;  4WWN A;  2FCM A;  2KDI A;  2DZK A;  3GE3 C;  1E8X A;  4K3B A;  3DQV A;  5FKA C;  3VUY A;  2KN5 A;  2KX0 A;  3JSV B;  4JLC A;  2J42 A;  1LM8 B;  3KH0 A;  3W2D A;  1SE4 A;  1WH3 A;  2RSU A;  1WE6 A;  2KQS A;  2KJH B;  1UH6 A;  2JF5 A;  2HTH A;  4IG7 B;  4K7U A;  3OLM D;  5JH5 C;  2MP2 A;  5IAA C;  3APC A;  2MA9 B;  1FD6 A;  4C4V B;  1GOZ A;  2KO3 A;  1NI2 A;  3L17 A;  3NZ3 A;  3BZD B;  4E3C A;  1VR9 A;  1WE7 A;  4K7S A;  1S3S G;  5LXH A;  3EUB 2;  1E10 A;  1YQ3 B;  1MFW A;  3TEY A;  2NPT A;  4FHK A;  4IM2 A;  4W9L A;  4GOC A;  2N9K A;  2KDF B;  1E9M A;  3SEB A;  5IOI A;  2GB1 A;  2QEJ C;  3A1Q A;  3AE7 B;  1TBE A;  1LO5 D;  2LI5 A;  2JX5 A;  1EU3 A;  2PEA A;  4GDK B;  2GBK A;  4LNI A;  2FBW B;  1F0Z A;  4LNK A;  4RM9 A;  1XLO A;  1RM6 C;  5D3D A;  2MW5 A;  4KX6 B;  2KQ4 X;  4NJ6 A;  1PUT A;  3AI5 A;  1KLG D;  4G11 A;  3RYT A;  5MPO A;  2BYF A;  1SIJ A;  4JWS C;  4GN1 A;  1ZKH A;  4NJ7 A;  2BWE S;  4YSZ B;  3MFG A;  1BUI C;  4XE0 A;  2DAJ A;  3PHX B;  2VZK B;  5KHQ A;  4OZC A;  1ZE3 D;  4A3O A;  3W5U B;  4NQL B;  3DPD A;  4W9G A;  1Q5W B;  5FR6 A;  5AUK A;  3P4Q B;  2L05 A;  2LVP A;  4GMV A;  2GBN A;  2JZ3 B;  2WNM A;  1EM7 A;  3ABV B;  3H7S A;  3UQB A;  4HKZ E;  3QK0 A;  1NYR A;  2INN E;  2IZV B;  3VXW A;  1I4Q A;  3R2I A;  1N61 A;  1XLQ A;  2JUO A;  3QIJ A;  1LGR A;  3NVY A;  5JHB A;  4KGT A;  2K22 A;  2KC1 A;  3AEC B;  4L23 A;  3RNC C;  1G6J A;  1P7E A;  1SB3 C;  4IWP A;  1MG4 A;  1DOI A;  3ZDT A;  5LXI B;  3KWV A;  3OG5 A;  4A6Q A;  3APF A;  5J17 A;  1L7Y A;  3V6C B;  1HEZ E;  1QOA A;  3DWM A;  3N1Z C;  1MVK A;  4BVU C;  2RDG A;  3T8M A;  3AB5 A;  2WDQ B;  2B76 B;  4PS8 A;  2N9E B;  1YNT E;  3X0W A;  1JWM D;  1V1P B;  1AYF A;  5BYQ A;  1UWX A;  1LFD A;  2WXF A;  4I6N B;  2W3R A;  1J7A A;  1GNU A;  3TEX A;  2YEP F;  4XYC A;  2KZR A;  4NAW B;  2KDM A;  3QAQ A;  1OEY A;  1RFA A;  3T9L A;  2M8S A;  1YMH E;  2KAC A;  3VTW A;  3B0A A;  1ENF A;  1C79 A;  4FBJ B;  1WZ0 A;  4RF1 A;  2LHD A;  2LFI A;  2JYE A;  1D6E C;  3KQ4 A;  1PDX A;  4NZL B;  2ZVO A;  3L08 A;  4WIP A;  3RNF C;  3BVG A;  2G1E A;  3DCG A;  1CK1 A;  2O6V B;  5HFY A;  5D3I B;  3KYD D;  4BFR A;  3GZN I;  4JQW C;  1V9J A;  2LGS A;  3SFE B;  2DHZ A;  2PIA A;  4RH6 A;  2MQJ A;  3RN9 C;  1ZGU B;  3U2S C;  1TS2 A;  3MC8 A;  4TSS A;  1ET6 A;  3C8Y A;  2ZZP B;  1J8C A;  2HE7 A;  4JX1 C;  4EFO A;  2NBW B;  3JSV A;  2DWQ A;  2J53 A;  3C19 A;  3Q8C A;  3HM3 A;  2R61 A;  2WXG A;  4N58 A;  1V1O A;  2DBY A;  2QSD A;  2BW2 A;  2D3B A;  1SIF A;  1FM0 D;  3NY5 A;  1P7F A;  3RUL A;  4YWG G;  2LGX A;  3J9C A;  3PS6 A;  5CTR C;  4NNJ B;  1H4R A;  1ZXH A;  3ZTD A;  3PV1 A;  2VH1 A;  4MGY E;  5BMI A;  3SDL C;  4DDI D;  2W54 A;  2RPV A;  4KGS A;  1ZDV A;  4S0R A;  4HPP A;  2ZEQ A;  1ZDX A;  1L0V B;  1TJE A;  1YD8 U;  4A3P A;  1V5T A;  1TGZ B;  3TJP A;  2AEH A;  3NG0 A;  4C00 A;  4IWQ A;  4JWU C;  2B3A A;  2JPH A;  4NJC A;  3V61 A;  2J0J A;  2L0T A;  5C2T B;  4WJP A;  4RCO A;  1EF5 A;  3DHG C;  4YXD B;  2SEB D;  3RNA C;  1UBI A;  2I38 A;  4HRO A;  3ZJT A;  2K9X A;  5HHD G;  2KN4 A;  3N30 A;  3A1Q B;  2QIE B;  1A70 A;  1NVI D;  2G4D B;  2OOB B;  2M19 A;  2KTR B;  2MX2 A;  1TS4 A;  3IBE A;  2UU7 A;  2JVC A;  1IBX B;  3EC8 A;  4XZ4 A;  1F2R C;  3ECI A;  5LLI A;  1XLP A;  3N20 C;  4JE3 B;  4XX5 A;  1V8C A;  1TKE A;  2C7M B;  3AEG B;  2LUE A;  2IO3 B;  3ENE A;  4ITK A;  2KHW B;  3R7Q A;  3UF8 A;  4MGK E;  2DX5 B;  1KFY B;  2C5L C;  4ANU A;  2L83 A;  2KC2 A;  2WYQ A;  2N0S B;  3VTU A;  3EFU A;  1N63 A;  1FNW A;  1KF6 B;  3ONS A;  4XWW A;  2IO1 B;  4WQO B;  4K3C A;  1JAL A;  2KFK B;  3TCA A;  1JCK B;  1UD7 A;  2MBO A;  5D6J B;  3KUC B;  3R66 C;  2OJW A;  3FIL A;  2GOW A;  3KWL A;  4URK A;  2FUH B;  3TUO A;  2C7N B;  1YJI A;  1FCC C;  4DBG A;  4HEA 1;  2MBE A;  3CSF A;  1HA5 A;  5DCN A;  4GLS C;  2K8H A;  1QF6 A;  3W1S A;  2AQ3 B;  2WXP A;  3K9O B;  1WXQ A;  3PGE A;  3NZS A;  1I4H A;  2WDT B;  4GIV A;  3KVF B;  1FXI A;  4K81 A;  2JWZ A;  3E9S A;  5T8I A;  2DZI A;  1NI3 A;  4M8N A;  3ZNI D;  2KVR A;  2KQ7 A;  1WMH B;  2E6X A;  2WLB A;  4HK2 A;  3OWE B;  1SXT A;  3MJ5 A;  1YN4 A;  3IT6 B;  4PT5 A;  5L83 A;  2BB5 A;  4CQN A;  3VR8 B;  5IA7 A;  3AEA B;  4JPS A;  2LJI A;  4C7Z A;  2K8C A;  2NS5 A;  1S1Q B;  3EFC A;  4AUQ C;  4MGI E;  2MBB B;  4A90 A;  2G3Q B;  1WXV A;  4FUL A;  3RMK C;  3U52 E;  3I3T B;  4YT0 B;  1Y56 A;  3OJ4 B;  4WJN A;  2EMT A;  1EUV B;  4KSL C;  3NVZ A;  5CHW A;  1XT9 B;  4LDT D;  4PYZ A;  4BBN F;  2KXJ A;  2CS4 A;  2D2Q A;  2CU1 A;  2KT7 A;  3NVV A;  1JWA D;  2YEP B;  1T6B X;  3QX1 A;  3ZO5 B;  4ICU A;  3JW0 X;  3TSS A;  2H89 B;  2L00 B;  4BZA A;  2BVC A;  3ZUN A;  2N9X A;  2GI9 A;  3Q3J A;  5TR5 A;  2IGH A;  1I35 A;  1BML C;  1FEH A;  4KDI C;  3RFZ B;  3AE9 B;  2EKE C;  3PLU A;  4FA6 A;  1D5X C;  4NAM A;  4RGN A;  3X23 A;  1R4N I;  4LJP B;  5E6P A;  3U30 A;  1OEY J;  2WXO A;  4BKG A;  1FNV A;  2LJ5 A;  4AWJ A;  5DPR A;  2CJN A;  2W82 A;  1UGM A;  1E6E B;  2K5P A;  2VZK D;  5AZF A;  4O1N A;  3AH7 A;  2FIF A;  4RGM A;  1QIL A;  1C77 A;  1WXS A;  5TSS A;  4K1R B;  2KOX A;  3V05 A;  5D2M B;  3UIP B;  4DXA B;  1UEL A;  3VR9 B;  2M0A A;  2N1W A;  3PT2 B;  2V0G A;  1SE9 A;  2XN9 C;  1GAQ B;  1N5X A;  2L32 A;  2NTT A;  1GB1 A;  3W9C B;  4XC2 A;  4DXG A;  2NTS A;  1T0Q C;  1FPY A;  5JZE B;  2CR5 A;  3TIX A;  2J0M A;  2V3P A;  2ICI A;  2AX5 A;  1WGD A;  2LZ6 A;  2KMC A;  4YTM B;  4FJY A;  4HCP B;  1RAX A;  2CHX A;  3O65 B;  2BKF A;  1F2R I;  1FO4 A;  1N5W A;  4JGH B;  1ZOY B;  4AOF A;  4TMA B;  2FNJ B;  4IM0 A;  1XXG A;  4YTP B;  3A9J A;  2K3U A;  3HVD A;  4G50 A;  3R2T A;  5BYS A;  4OHJ A;  3QJZ A;  1IPG A;  2OED A;  1YN5 A;  2PVO D;  2BS3 B;  4W9F A;  2M4N A;  3BVZ A;  3AE4 B;  1E8Y A;  4HVB A;  3ZIM A;  4LNF A;  4AS1 A;  1MG8 A;  3H8H A;  2QDF A;  2WDR B;  2WHI A;  1WX7 A;  2DYO A;  4KZ0 A;  1WXM A;  1GG3 A;  2NCN A;  4ZRP A;  2JZZ A;  2IY1 B;  3CST A;  5IKC M;  1VDV A;  3ZGZ A;  2V4I B;  2LXA A;  1CZP A;  2RMM A;  1NBF C;  1V2Y A;  1J0G A;  2KKC A;  1PFD A;  1R4M I;  2GLS A;  1HE8 A;  3A4R A;  3WAL A;  2MP2 B;  5E6O A;  2KAN A;  3MHS D;  3L4P A;  1V80 A;  3BII D;  4PS7 A;  4HRS A;  3DHH C;  1BXT A;  1WJ4 A;  3KW5 B;  2D11 A;  1FXT B;  1TS3 A;  1IGD A;  4AJY B;  3AE2 B;  3P2B A;  1AWD A;  4WJO A;  2XEW A;  2N1V A;  2YVC A;  3N1Y C;  3NJT A;  1VRA B;  2ZJD A;  2QJL A;  3PRZ A;  4W9E A;  3R8B A;  2MRP A;  2GRI A;  5D7G A;  3HVZ A;  3KUD B;  3Q3O C;  3A33 B;  3FIL B;  3L16 A;  3ML8 A;  4IWO A;  2WX0 A;  3VFK A;  1XEE A;  4EZL A;  2NR2 A;  3ZTC A;  2WXN A;  1ROE A;  4MEL A;  5C3J B;  2FUG 1;  2BT6 A;  2JXT A;  2Y3A A;  3PSE B;  5BMG A;  2LMC A;  2KMA A;  4W9J A;  2O6V D; 
#chains in the Genus database with same CATH homology
 1J8C A;  3NHE B;  2HE7 A;  1LQB A;  3QHT A;  1GC7 A;  2RR9 A;  1E90 A;  4EFO A;  3UIN B;  2NBW B;  3JSV A;  3DBH I;  3DVG Y;  3HM3 A;  3JVZ X;  1D3Z A;  5JHA A;  2VRR B;  2NBU A;  1WZ3 A;  2JRH A;  4TQ1 A;  2ASQ A;  2KLC A;  4PYU A;  4ICV A;  2L8J A;  4EUT A;  1SIF A;  4WWP A;  2BKR B;  3NY5 A;  2MBH A;  3H7P B;  3V6E B;  4BKT A;  2FCQ A;  1WGG A;  3VVW B;  3RUL A;  3VUW A;  2LGX A;  4E71 A;  2GBR A;  3H1U A;  3PS6 A;  5CTR C;  1YIW A;  4NNJ B;  1H4R A;  4DWF A;  3ZTD A;  3PV1 A;  3BIN A;  2V3S A;  4HPL B;  4MGY E;  1GUA B;  3SDL C;  4DDI D;  4GDL B;  2MBQ A;  1YJ1 A;  3WAP A;  4ANX A;  3A9J B;  2PE6 B;  2K6Q A;  1GC6 A;  4WAA A;  2ZEQ A;  1V6E A;  2DZM A;  2FCS A;  5AZG A;  1WYW B;  3PRE A;  5L95 C;  2J7Q B;  4PS3 A;  4W9H A;  2BWF A;  4F8C B;  4GU2 A;  1YD8 U;  1E7V A;  4A3P A;  2XK5 B;  3QWZ B;  1V5T A;  2GMI C;  1P9D U;  2LD9 A;  1TGZ B;  3TJP A;  3W1S C;  4WJQ A;  3S2A A;  2AEH A;  4II2 B;  3UGB B;  5C23 A;  4IWQ A;  4EKU A;  5CHV C;  3L10 B;  4GSW A;  2B3A A;  3VUX A;  4NQK E;  2JPH A;  1WRD B;  2N7D A;  2NBV B;  3R3M A;  3VTV A;  3V60 A;  1A5R A;  3V61 A;  2J0J A;  2L0T A;  2LXC A;  1JRU A;  4WJP A;  3ML9 A;  3DOW A;  4BKS A;  1EF5 A;  3LJ3 A;  3DVG X;  2ZCB A;  1WR6 E;  3M95 A;  1J19 A;  2DZJ A;  3N3K B;  1UBI A;  2FAZ A;  2CKH B;  2KTF A;  3B1L X;  2N7E A;  2K6D B;  1WXA A;  4I6P A;  3N30 A;  4KV2 A;  3A1Q B;  4EOY A;  3QQ8 B;  1F9J A;  2MSE D;  3C0R B;  4HWI B;  1E8W A;  1EO6 A;  4KDL B;  3TBL D;  4KSK C;  2G4D B;  2OOB B;  3HM6 X;  4RMA A;  2KTR B;  2MX2 A;  3L13 A;  4LJO B;  3ZVV A;  3IBE A;  5KHO A;  1L2N A;  3IHP C;  2MWS B;  2JVC A;  2ZPN A;  2KTR A;  3DDC B;  3EC8 A;  2AL6 A;  4XZ4 A;  4TQ0 A;  3ECI A;  2CHW A;  5LLI A;  2GBM A;  2KJR A;  2XBB C;  3AU4 A;  4XX5 A;  2C7M B;  2RGF A;  2LUE A;  4ZRJ A;  2IO3 B;  2DYB A;  2R2Q A;  1V49 A;  3ENE A;  2BYV E;  2KHW B;  3IG3 A;  4W9J A;  4YL8 A;  4EZK A;  1ZW7 A;  2IO2 B;  3R7Q A;  3UF8 A;  2K8B A;  4MGK E;  2W9N A;  2DX5 B;  2C5L C;  4ANU A;  5J18 A;  4HDO A;  4GDL A;  5AZH A;  2KC2 A;  2WYQ A;  3BY4 B;  3VTU A;  4DDG D;  3EFU A;  3WIM A;  2LRW A;  3ONS A;  3VDZ A;  2IO1 B;  3PPA A;  4WQO B;  1EF1 A;  2UYZ B;  4M0W B;  2KFK B;  5DPS A;  3B08 A;  4JL9 A;  1T0Y A;  2ZNV C;  3TCA A;  2C60 A;  4DHJ B;  2UWQ A;  3U7D A;  2NVU I;  2O6V A;  2BPS A;  3PRP B;  1UD7 A;  2MBO A;  5D6J B;  3TL5 A;  3ZNG C;  4DK5 A;  2L7R A;  2GBJ A;  3KUC B;  2N9P C;  2ZNV B;  3R66 C;  2GOW A;  4URK A;  2FUH B;  1IYF A;  1X1M A;  1UZX B;  2C7N B;  4MDK E;  4ASW C;  4X57 B;  4DBG A;  2DYM A;  2MBE A;  3RD2 A;  3CSF A;  4II3 B;  1VCB A;  3CMM B;  2D3G A;  2ZVN A;  2BGF A;  2KFJ A;  5DCN A;  3WAN A;  4AP4 C;  1QZE A;  1U4A A;  3RT3 B;  1KLV A;  2K8H A;  2O2V B;  4G3X B;  2Y5B B;  1ISN A;  3W1S A;  1V5O A;  3K9O B;  5CX3 A;  1P1A A;  3PGE A;  3DBL I;  2DAF A;  3NZS A;  4FHJ A;  2IYD B;  2KK8 A;  4GDK A;  2WDT B;  3AUL A;  4GIV A;  3KVF B;  4N9F 4;  3GOE A;  4K81 A;  2PPH A;  4TV3 A;  4WWN A;  2FCM A;  2JWZ A;  2OJR A;  2KDI A;  1UBQ A;  2DZK A;  3A9K B;  4NAW A;  3W1Y A;  2DZI A;  2LGD A;  2KLG A;  4M8N A;  3ZNI D;  1E8X A;  3NS8 A;  2KVR A;  2KQ7 A;  3ZLZ A;  3WA0 A;  1WMH B;  2L76 A;  3DQV A;  4HK2 A;  4W9K A;  3VUY A;  2KN5 A;  5L83 A;  4OVV A;  1V81 A;  2KX0 A;  5G2N A;  3ZDM C;  3ZRC A;  1Q1O A;  2C9W B;  3A4S C;  3JSV B;  4JLC A;  5IA7 A;  1LM8 B;  1YX5 B;  5EDS A;  2LAS A;  3ZRF A;  3NOB A;  2G4S A;  3KH0 A;  2K8C A;  3L0W B;  1WH3 A;  2NS5 A;  2RSU A;  1WM3 A;  3UIO B;  1WE6 A;  1S1Q B;  2KQS A;  4XC2 A;  3M63 B;  5G55 A;  2KJH B;  3HIZ A;  2KJ6 A;  4KIK A;  1NDD A;  3RUI B;  4MGI E;  1UH6 A;  3R7R A;  4AUQ C;  4ZDV A;  3IVF A;  2MBB B;  3APD A;  2JF5 A;  2G3Q B;  1WXV A;  2HTH A;  4FUL A;  2G45 B;  3PTF C;  4IG7 B;  4K7U A;  1WX8 A;  4MSM B;  3I3T B;  3OLM D;  3OJ4 B;  5JH5 C;  3M62 B;  1WJN A;  1EUV B;  2EMT A;  4WJN A;  2MCN B;  4KSL C;  2AL3 A;  2MP2 A;  5IAA C;  4MEM A;  4BOZ B;  2AWT A;  3APC A;  5CHW A;  2M17 A;  1XT9 B;  2MA9 B;  4NY0 A;  4ANW A;  4LDT D;  2BF8 B;  1WMH A;  2KO3 A;  3NZU A;  2KXJ A;  4PYZ A;  5CHF A;  1NI2 A;  4BBN F;  1Z2M A;  1TZ1 A;  2CS4 A;  4ZYN A;  2LVQ A;  1K8R B;  2D2Q A;  2CU1 A;  3L17 A;  5HKH A;  4MM3 A;  3QX1 A;  3ZO5 B;  2ZCC A;  3SHQ A;  2JRI B;  4E3C A;  4ICU A;  4HDQ A;  1WE7 A;  3JW0 X;  4K7S A;  3QCA A;  2L00 B;  1S3S G;  3ALB A;  3ZUN A;  2N9X A;  5LXH A;  3Q3J A;  5TR5 A;  3Q3F A;  4G0N B;  1I35 A;  5E6N A;  3H9D A;  1E8Z A;  1C3T A;  1V86 A;  2NPT A;  1WIA A;  4FHK A;  4KDI C;  4IM2 A;  4W9L A;  4GOC A;  2C7H A;  1C1Y B;  2KDF B;  1I42 A;  3RCZ A;  3CF6 E;  2EKE C;  3PLU A;  4FA6 A;  2M1M A;  3DVN V;  2K39 A;  3QAR A;  3X23 A;  1Z5S B;  3A1Q A;  5BO4 B;  4BOS C;  4FJV B;  1R4N I;  4LJP B;  1TBE A;  4IC7 B;  2LVO A;  1WF9 A;  1WJ6 A;  4MH0 E;  5E6P A;  1WGY A;  1P3Q U;  4FLH A;  1OEY J;  4FJZ A;  2LI5 A;  4LDT B;  3U30 A;  4BKG A;  2LJ5 A;  4AWJ A;  1M94 A;  5DPR A;  2A5U A;  3VH4 B;  4HJK A;  2PEA A;  1UGM A;  2FID A;  2V4L A;  2BYE A;  4GDK B;  4FAD A;  3TMP B;  4JIO U;  5AZF A;  3LDZ E;  2FIF A;  2GBK A;  4W9D A;  1E7U A;  3N32 A;  5DPW A;  1SGH A;  1WXS A;  4EEW A;  4TKN A;  4B6W A;  2DEN B;  4P7I A;  4K1R B;  2KOX A;  4RM9 A;  1OGW A;  3PVL A;  2N4F A;  4MJS B;  2Z0E B;  4LCD E;  3VHT C;  5D2M B;  2I1K A;  4WWO A;  2NPT B;  2MW5 A;  3UIP B;  3VH3 B;  4NJ6 A;  4DXA B;  1UEL A;  4MJS A;  5D94 A;  4J6I A;  4CO7 A;  1KOT A;  2N1W A;  3PT2 B;  3AI5 A;  2YLM A;  1BT0 A;  1SE9 A;  1YQB A;  4G11 A;  4NPN A;  3RYT A;  2KD0 A;  2BYF A;  3OAW A;  1P98 A;  1WM2 A;  1P0R A;  3K9P B;  4BKS D;  2MLB A;  3EEC A;  4GN1 A;  1CMX B;  1ZKH A;  2BWE S;  1XD3 B;  2LRU A;  1TTN A;  4HPM B;  2L0F A;  2J0K A;  4MGZ E;  4NJ7 A;  4W9C A;  4E74 A;  2DAJ A;  3PHX B;  3DBR I;  1WR1 A;  5KHQ A;  3HHM A;  2I1J A;  3D32 A;  4A3O A;  3PZD A;  4GXB A;  2Z0D B;  4NQL B;  3DPD A;  4W9G A;  4IM3 A;  1Q5W B;  2REX A;  5FR6 A;  1PQS A;  5JZE B;  2CR5 A;  3MJW A;  3TIX A;  2J0M A;  2JT4 B;  3ZKJ C;  2HJ8 A;  1Q0W B;  2L05 A;  2LVP A;  1OTR B;  1WGD A;  2LZ6 A;  2EMS A;  2GBN A;  2JZ3 B;  4GMV A;  2KMC A;  4F1S A;  2R2O A;  4FJY A;  4HCP B;  3H7P A;  3L54 A;  2ZPY A;  2KWU B;  3H7S A;  3DVN U;  3UQB A;  1RAX A;  2WWZ A;  4W9I A;  2CHX A;  4ANV A;  3O65 B;  3QK0 A;  2BKF A;  2KNB A;  3QC8 B;  4M8M A;  3VQI A;  4JGH B;  4AOF A;  1WX9 A;  2IZV B;  2FNJ B;  3VXW A;  2PE9 A;  4IM0 A;  2L3Z A;  3RZF A;  3RZW C;  4DHJ D;  5J2R A;  2JUO A;  3QIJ A;  1KM7 A;  3A9J A;  4RM8 A;  3AXC A;  4HLE A;  4G50 A;  3WAO A;  4ZRK A;  5JHB A;  3QJZ A;  1IPG A;  2RD0 A;  2A4Z A;  3H6N A;  2HD5 B;  2KC1 A;  4CYE A;  2KFK A;  2AYO B;  2M0X A;  1G6J A;  4W9F A;  2M4N A;  3A9K A;  4A20 A;  1E8Y A;  1RLF A;  4GGQ A;  4IWP A;  3ZIM A;  4HVB A;  1MG8 A;  3ZDT A;  5LXI B;  1WJU A;  3VAW A;  4DHZ E;  3APF A;  3WAM A;  5J17 A;  1L7Y A;  3V6C B;  3M3J A;  1WX7 A;  2DYO A;  2KWC A;  2WX1 A;  4KZ0 A;  3PRM B;  1KJT A;  4BVU C;  1WXM A;  3T8M A;  1GG3 A;  2KWV B;  2NCN A;  3QA8 A;  2LWP A;  3ZNH B;  4IW0 A;  4KIK B;  2JZZ A;  2IY1 B;  4DHZ B;  3CST A;  2N9E B;  2IY0 B;  3KUZ A;  4PS8 A;  4HCN B;  3X0W A;  4IUM B;  2LXA A;  2PJH A;  1NBF C;  1V2Y A;  1J0G A;  1LFD A;  2KKC A;  4I6N B;  1WY8 A;  1R4M I;  3UQA A;  2Z59 B;  1GNU A;  3HK0 A;  3DBS A;  2KZR A;  1HE8 A;  4NAW B;  3A4R A;  3ZW3 A;  3WAL A;  2MP2 B;  3QAQ A;  5GMV A;  5E6O A;  1OEY A;  2K1F A;  2KAN A;  1IP9 A;  1RFA A;  3OJ3 A;  3T9L A;  3MHS D;  2M8S A;  1V80 A;  4PS7 A;  4TUU A;  3MTN B;  3PLV A;  3AU5 A;  1WFY A;  4K7W A;  2IBI B;  1WJ4 A;  3U8Z A;  4KZC A;  3KW5 B;  3PHW B;  2D11 A;  3VTW A;  3B0A A;  1FXT B;  2QHO A;  4KVG B;  3SU8 X;  4FBJ B;  1AAR A;  1WZ0 A;  4AJY B;  2KDB A;  2D07 B;  3IFW B;  3KYC D;  3P2B A;  4B95 A;  1WGH A;  1Y8R C;  1VD2 A;  2ZVO A;  2D10 A;  3L08 A;  2XK5 A;  4WJO A;  2XEW A;  2N1V A;  2YVC A;  2KX3 A;  5DPT A;  3ZNZ B;  1RRB A;  2ZJD A;  3PRZ A;  4HXD A;  2IO0 B;  3DCG A;  4F7Z A;  4W9E A;  4MSQ B;  2MRP A;  2O6V B;  5D7G A;  1YX6 B;  4OVU A;  3KUD B;  4FN2 A;  3A33 B;  3KYD D;  1OQY A;  2V1Y A;  4B9K A;  1XQQ A;  1H8C A;  3L16 A;  3ML8 A;  4IWO A;  5C1Z A;  1E5W A;  5AEK B;  4BFR A;  3GZN I;  2CHZ A;  4JQW C;  1V9J A;  4GB9 A;  2WX0 A;  3VFK A;  2LGY A;  2DHZ A;  2K25 A;  4EZL A;  4EZJ A;  2NR2 A;  3JYU A;  3ZTC A;  2MQJ A;  1LXD A;  3EHV A;  1WI0 A;  1ZGU B;  4MEL A;  2JXX A;  2RPQ A;  4I6L B;  3SD5 A;  2O2V A;  2JY6 A;  4ZRI A;  4BBN C;  3PSE B;  1WGR A;  3V62 A;  2KDE B;  4CHK A;  2KMA A;  2ZZP B;  2FCN A;  1GJZ A;  4AJW A;  2O6V D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...