4FBVA

Crystal structure of the myxococcus xanthus hemagglutinin in complex with a3,a6-mannopentaose
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
266
structure length
266
Chain Sequence
AAYLVQNQWGGSQATWNPGGLWLIGARDKQNVVALDIKSDDGGKTLKGTMTYNGEGPIGFRGTLSSANNYTVENQWGGTSAPWQPGGVWVLGARDKQNIVAVSIKSNDGGKTLTGTTTYNGEGPIGFKSEVTDGDTYSVENQWGGSAAPWHSGGVWVLGTRGKQNVINVDAKSNDGGKTLSGTMTYNGEGPIGFRGTLTSPDTYTVENQWGGSTAPWNPGGFWMIGARNGQNVVALNVASSDGGKTLAGTMIYNGEGPIGFRARLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myxobacterial hemagglutinin
publication title Structural Insights into the Anti-HIV Activity of the Oscillatoria agardhii Agglutinin Homolog Lectin Family.
pubmed doi rcsb
source organism Myxococcus xanthus
molecule tags Carbohydrate binding protein
total genus 64
structure length 266
sequence length 266
ec nomenclature
pdb deposition date 2012-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17882 SBD OAA-family lectin sugar binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.450 Mainly Beta Beta Barrel Lipocalin Lipocalin 4fbvA02
2.40.128.450 Mainly Beta Beta Barrel Lipocalin Lipocalin 4fbvA01
4FBVA 4GK9A 4FBOA 3S5VA 2MWHA 4GU8A 3S5XA 3OBLA 4FBRA 3S60A
chains in the Genus database with same CATH superfamily
1LIDA 1P6PA 1DFVA 1DZMA 1GX8A 1X89A 3AEHA 5B2AO 1A2DA 1YWCA 1X8OA 3O19A 5K68A 2HZQA 2WQAE 4I60A 4YBUA 2IZFB 3V8UA 3CKGA 4COTA 4ZHCA 1HMRA 5HZ9A 5HCEC 1ZRYA 4QZTA 2OF9A 2F09A 4O49A 2RTAA 5AJCA 5H9KA 2OY5O 1VWJB 2QM9A 2QOMA 4ES7A 5L8OA 1JQPA 3STKA 2UZ2A 2JMBA 5IXGA 2X46A 1CBRA 5F6ZA 1GT3A 1HQPA 3FR4A 1I04A 2RTEB 3BU1A 2NNQA 1VWDB 4R0BA 4BGFA 4D6AA 1O1VA 3Q6LA 5D4AA 1EPAA 1N4JA 4YKOA 3ZI8A 5B5FA 1B0OA 3FW4A 2WQ9A 1KGLA 4INNA 1D3SA 4NP1A 4YCHA 3ZW0B 5HCDC 4ORWA 1NP1A 1TW4A 4IBAA 5LJDA 4ARHA 2L68A 4GK9A 2NP1A 4AZNA 5EEEA 1EIOA 4NLIA 3CQRA 5FQ7E 4U46A 5D8JA 5B29A 5L8IA 4M7MA 2ACOA 1SWEA 4I3BA 2A13A 3P02A 1RXHA 2K62A 4MISA 1SXXA 3RY2A 2F01A 2JU3A 1Y0GA 2WPUA 1SY3A 1IJ8A 2AT8X 1GXAA 2BLGA 3FIQA 4NLJA 3U0DA 3RDXA 4CPIA 1KL3A 4ODDA 3WJGA 1LELA 1QY0A 1SXWA 2QCBA 1JIWI 4NNTA 4ORUA 3OE3A 2R56A 1VWRB 2GC9A 1SWDA 1SRHA 2AT5X 1EUOA 1VWKB 2IZDB 2WSJA 3B2KA 1N7YA 5HZQA 3SOTA 2FR3A 1GT5A 1ALBA 2JN3A 3FA7A 3KFFA 4CK4A 2Q2MA 2OFMX 5F7GA 4Z2OA 1KZXA 1I78A 1D2UA 1S7DA 1A57A 3STNA 3VE2A 1RXJA 4OS8A 1U18A 2HZRA 3FEKA 3EM0A 1SWTA 2JU8A 4QZUA 3FDCA 1EIIA 1W5RA 4LZVA 2VDFA 2YMSA 1LKEA 2UYWA 5LJBA 3IFBA 3K3LA 4TJZA 3RWXA 5K06A 1FENA 1ML7A 1EPBA 1JJJA 5EEDA 2RTNB 2AKQA 3HTYA 2RCQA 1MDCA 4ALBA 3UEWA 1SWFA 4LKTA 1T0VA 4KCAA 4BVMA 3F8AA 5BVSA 3FEPA 3SZIA 3FMZA 3RDUA 2AF5A 4BX7B 1OBQA 2W2AA 1E2TA 4M6SA 3KVNA 3NPOA 1QFTA 4ALOA 1PM1X 1I05A 2X8SA 4ZHGA 3OD9A 3D9WA 1SMPI 5CE4A 3P6CA 4KT5A 1IFCA 1OBPA 2ALLX 5JD2A 1SY2A 2HKDA 2OVEA 3ZW1A 1BSOA 2L67A 1MEPA 5HA0A 4NW4A 1I4UA 1SREA 4YFRA 2C4IA 2QOSC 3B2JA 4WHIA 1SWAA 2C1QA 4YCEA 4QGVA 5F58A 3JQOA 1LIEA 1QWDA 1NQMA 4AZRA 3NADA 4BJ8A 5IO6A 3B2LA 4ORSA 5JR8A 3RZYA 1ADLA 3VG3A 3WJCA 2W2FA 1W6FA 2RTDB 1STRB 1K3BA 4HPDA 1SWBA 1GGLA 3CWKA 4QGXA 4XMGA 3HK1A 1VWEB 4YVBA 1KFFA 1SLDB 1QY1A 4ML7B 5F2BA 1LFOA 3WJDA 2E4JA 3PQSA 3T2WA 4LZUA 2LFOA 1SY0A 3GE2A 4MVEA 4EXZA 4GETA 2WEXA 1MVGA 4N7CA 1X8NA 3MBTA 4GRJA 4TKHA 5B27A 3VG7A 3P24A 4A1YA 1H91A 1UREA 5IRAA 1NBXA 4CDDA 4TKBA 5L8NA 5EZ2A 4U8UM 2R73A 3P6GA 1OBUA 3LHNA 1VYGA 3ELXA 3OJYC 4U8UO 4JHQA 1ERXA 1SWRA 1BRQA 3VHMA 3PH5A 3ZQ3A 1VYOA 3FIDA 1MM9A 3JSQA 2CBSA 4EEJA 3WYPA 4YMYA 3APWA 5KIDA 1LNMA 4PJ2A 2OFAA 1Y9LA 4YGZA 1NC9A 3C76X 5D45A 1ZNGA 4CDEA 1RSUB 1OPBA 3BX8A 1DV9A 4HWMA 1SWGA 2AT0X 1N9MA 2CZUA 2G8CO 4HPBA 3UEXA 1OEJA 1LICA 1SWKA 2IZAA 2PI3O 3NR3A 5KHPA 3ZUIA 1AELA 2WWPA 3UAQA 1JYDA 2OL7A 2A2GA 4ID2A 1ICMA 4A1HA 1E06A 1KL4A 1PMPA 2IZKA 3TZSA 4I9SA 1BEBA 2A5BA 1T68X 1W4TA 3BX7A 4O3ZA 1BWYA 1NGLA 1LDOA 5H9LA 2RD7C 4MIRA 5H8TA 1TOWA 1U0XA 3WJFA 4CPHA 1HQQA 3STMX 2M4LA 1JJUA 3FR2A 3U03A 4ZGUA 3CBSA 2RN4A 2RTQB 2Q39A 1BRPA 1RAVA 4DNEA 3TGCA 3KFIA 4Y0QA 3HOEA 2X45A 3Q34A 1VWAB 4L1NA 2IZCB 2RQ0A 2BSZA 2GTLN 4U3QA 5HBSA 3CR6A 2OFBA 3WXQA 4I3CA 2OVAA 2IZBA 1GX3A 1N0SA 1NDJA 3H3IA 2N93A 2RTMA 1VWLB 4BOEA 4HPCA 1LPJA 4GNYA 5BVTA 5AQ6A 1IKJA 2LBVA 4FBRA 3EMMA 3UEUA 4ZH6A 5K67A 1BJ7A 2FR2A 1PBOA 2FTBA 2OF8A 2OY7A 1GM6A 3L4RA 4GU8A 4YKMA 3SLOA 2OL6O 1JV4A 4NNSA 2MJIA 3BSZE 3OBLA 4OELA 3UEVA 1RSTB 1EXSA 1HMSA 1ZNKA 5DG4A 1KQXA 1VYFA 2BS5A 3FR5A 1B8EA 1YWAA 1G74A 1XKIA 3NBXX 4GJSA 3WJBA 4AZMA 1N43A 3D97A 3HWFA 4FBOA 1LF7A 1X8UA 2LBAA 4RUNA 5LJKA 1SLFB 4TLJA 4GGRA 2G5LA 3O2YA 4IRWA 3AUMO 4O4OA 4IB6A 3MG5A 3P6FA 1JMXA 2O62A 2Q4NA 3FENA 1VPRA 2W2BA 2CBRA 1FEMA 3VG2A 4AZOA 3NQ3A 4AZPA 1SXYA 4QYPA 4I9RA 4JNJA 2RTGB 1ZNHA 1TOUA 3D95A 3AKMA 2JGSA 2ZAGA 5HWZA 1ICNA 3EW1A 4GGZA 5EDCA 2K23A 1SA8A 2LKKA 4O4UA 2IZIA 3S5VA 2A8GA 1STSB 5HTEA 5FQ6E 2RTFB 5CSEA 3ZW1B 1JJXA 1STPA 3S60A 3VHHA 4CV7A 3ELZA 4I6SA 2FGSA 1SRIA 3TGBA 2I5ZO 1SXUA 3FA6A 4WBKA 4Y0SA 5DPQA 5BVQA 2LB6A 2RTOB 3CMPA 3F9DA 3FA9A 3U9PC 1UYNX 4MVKA 2FKJA 3SAOA 2I5VO 2RTJA 3QKGA 2IZJA 3EBKA 5B11O 1HBQA 2BC3A 2ANSA 4GDAA 4WFUA 3RBYA 1IW2A 2DJGA 1S2PA 3KFGA 5C0NA 3FW5A 2RCTA 4YFPA 3I17A 4NYQA 5HA1A 1JYJA 3C77X 3E3CA 4CSBA 1DC9A 2RA6A 4IB8A 1VWHB 3LV4A 1KT5A 2IFBA 2OVSA 4O4SA 2R74A 2JU7A 1SWSA 3MX7A 4Y5DA 1SWJA 1ACDA 2F73A 4XMCA 1JMZA 2X56A 4O3YA 5LKEA 1ZNDA 4GKCA 3NX2A 3T6LA 3RKGA 5HTDA 4O4XA 1IKEA 2MWHA 3D4RA 2IZHB 1YP7A 5HZ5A 2FKGA 2JW1A 4Y59A 1GKAA 5FENA 4JGLA 3G7XA 4KH8A 4UU2A 3AKNA 5IRUA 1NP4A 1UZ2X 3NQ9A 3B2IA 1RXKA 2OY1O 2QMIA 3APXA 3PDFA 4DCBA 1E00A 2FS6A 1KQWA 1FELA 3EYCA 4JO6A 4N7DA 4ZJ0A 1ERBA 3QQ2A 1PTSA 2Y32A 1SWLA 1QFVA 4YDAA 2G7BA 2GTFX 3FLLA 3P6DA 4ZCBA 3WZNA 3SZJA 4YH0A 3APUA 1CJ5A 2QO5A 3MM0A 5LJEA 1BSYA 2OFRX 1BBPA 3CKFA 1AB0A 3WZQA 2IZGB 1DF8A 4BX6A 3PEDA 3PK2A 4OMWA 3VE1A 4D6BA 2RTCB 4Z6JA 4CPHB 4IB9A 3SZHA 2FS7A 3VU1A 1PEEA 2KTSA 1CBQA 1FDQA 5HAEA 4C5PA 2RTKA 1BM5A 1BLRA 1VWNB 3KZAA 2OZQA 2VFBA 4KC7A 3TGAA 1YWDA 2A0AA 1MOYA 2HLVA 3CBCA 2XKLA 2Z4IA 2ZSCA 3PH6A 4ORRA 4OS3A 3WZPA 3WZOA 4O9SA 3BLGA 3VG4A 1WUBA 4ZH9A 4ON1A 2CZTA 4GGTA 1RBPA 3BY0A 2VFCA 4A60A 3P6EA 3PP6A 1HBPA 1MUPA 4O3WA 3HPEA 2GJ5A 3I0AA 1YP6A 3IA8A 5B10O 4ZFXA 1R0UA 2OYBO 3WVMA 5D47A 1KL5A 2GH7A 4WFVA 3RDQA 2A2UA 5D48A 4GDZA 3P6HA 2WR6A 3PPTA 3T2XA 4PSQA 3C78X 4I95A 2OY8A 2RTIB 3RSWA 1A3YA 5L3YA 5F1EA 1CBIA 2KT4B 1EW3A 1OEEA 5LJGA 4ZHHA 2MM3A 2CM4A 1TXLA 2BT9A 2IZLB 1SWPA 2MHDA 2NNDA 2RTRB 2X8TA 2ZAIA 3EC5A 1MK5A 1SRJA 3F6ZB 4IABA 1DF3A 4K19A 1Y52X 2L9CA 2JOZA 4XMDA 1QG5A 3JS1A 4QYNA 2G79A 1N9YA 3VG6A 3BDRA 4FGIB 2DJFA 4OKAA 4IMOA 1NQNA 4QQ1A 5LJHA 3S26A 1X71A 1LDQA 4YDBA 4EKVA 1JZUA 1U17A 3LTWA 4EDEA 4MVIA 1L6MA 3O22A 2HYSA 1VWCB 4AZQA 3WOVA 4LQZA 1KZWA 1CRBA 1FTPA 1EQDA 1DZKA 1LCVA 1XCAA 4BX5A 3MVFA 2NNEA 4IAWA 5EDBA 2XSTA 2AVIA 4OEMA 1JBHA 3BU9A 3D96A 1DZPA 1FJ1E 1AVEA 3APVA 3T1DA 1Y55X 2G78A 3B2HA 5HZ8A 2RTHB 2L5PA 2A5CA 3TF6A 4OS0A 4HFOA 2AH7X 3KFHA 3HOLA 5B3MO 4XMHA 4I3DA 4U8UN 4ZR2A 5H9AA 1GX9A 2AL0X 1HXZA 2BS6A 2KD2A 4DQ4A 1G5WA 1S44A 3HWEA 1SLGB 3RDOA 4LKPA 1GT4A 4GH7A 4ZHFA 2FHLA 1LIFA 4ORYA 3HWGA 4ZHDA 2Y3EA 4TNNA 1IIUA 4ZGFA 1KOIA 2MO5A 3VHIA 1MX7A 2A3FX 3T6FA 1VWMB 2CM9A 4CPEA 3NP1A 1EALA 3ZZVA 1TVQA 3HWDA 3SLJA 5CHKA 3WYQA 1DZJA 2KW1A 1UYOX 3ZW0A 1PBYA 4GNWA 2WEWA 4QAEA 4QNIA 5FFHA 3WBGA 4XMFA 4GD9A 1GKAB 1SWQA 1QQSA 1B56A 1SWOA 2ASNX 1CBSA 3FYFA 4YFQA 4YBPA 2AT6X 4EQAC 3RY1A 1G85A 3CQNA 4NYRA 2X4MA 1O1UA 1E5PA 4OMXA 1HN2A 1E02A 2QO6A 4O3XB 2KTDA 1SWUA 1VWGB 4YGGA 3FA8A 2FRSA 2RTPB 1KT7A 4FQBB 3BS2A 4UU3A 4Y0RA 1KXOA 5LJCA 2Z4HA 4TQ2A 5F6BA 4IAXA 3RE6A 2AMMX 2CAMA 2Y3FA 4Z27A 3N91A 5KICA 3RDMA 1VWIB 2ACPX 2WUTA 4GJVA 1LCZA 1B4MA 1VWBB 2BHVA 1HY2A 4MEEA 1EI5A 4TKJA 4CDFA 1GT1A 1YWBA 1X8QA 5LKFA 2P8GA 5HCCC 1K24A 3PQUA 4GE1A 3VPJE 4A8ZA 4BX6B 2POAA 4FBVA 2RTBB 5FQ8E 1OPAA 3SLTA 3BRNA 4KC8A 4CDCA 2YG2A 1G7NA 1X8PA 1AVDA 3DTQA 5AEOA 2Q2PA 2X32A 3WJEA 1SWCA 4NV7A 1AQBA 1KT3A 5FAZA 3X00A 1VWPB 5HZ6A 1YIVA 4RUUA 1KT4A 4NV8A 3DSZA 1VWQB 4AW8A 3EW2A 4CPFA 1AVGI 1SRGA 1SLEB 4BBOA 2GTLM 1BSQA 1SRFA 2HNXA 1ZNEA 2FT9A 2GTLO 4EFGA 1Y9TA 1Z24A 4Y0PA 4L3RA 5H9NA 1KT6A 2AT3X 5EPQA 4B55A 1OSPO 1Y53X 4GZVA 1HXLA 4BX7A 1MX8A 2QO4A 1VWOB 3KQ0A 1A18A 1SWHA 3RE5A 4AYHA 5IRWA 3PECA 4IB7A 4Z2PA 2X34A 2IZEB 3VG5A 3EBWA 1YUPA 4BCSA 1LUQA 2PY1A 4GUZA 2X55A 1RLBE 1VWFB 1ZNLA 3VGWA 3ZW2A 5AJBA 3ZWEA 4DQ3A 2DM5A 3RDSA 4MVLA 1OEKA 5BYPA 3FELA 4KIIA 2FHNX 1HMTA 2OL8O 2C1SA 2FWVA 4XMEA 3ZUOA 2FLJA 2Q9SA 3NQKA 5CYBA 4Z28A 3NX1A 4ORXA 2X8FA 1SWNA 3GAQA 1FE3A 2LA7A 4QGWA 4HPAA 5B5GA 1SY1A 4IMNA 5IO7A 1I06A 4BX5B 1T8VA 1IFBA 1LIBA 4BQUA 2OVDA 1QABE 4Z2VA 1QY2A 2HMBA 4QRLA 2RTLA 4U9CA 2EU7X 3S5XA 1LCWA 2MF6A 1I9HA 1WBIA 1O8VA 4YGHA 5IO5A
chains in the Genus database with same CATH topology
1LIDA 1P6PA 1DFVA 1DZMA 1GX8A 1X89A 1A2DA 1YWCA 1X8OA 3O19A 2HZQA 2WQAE 4YBUA 3V8UA 4ZHCA 4COTA 1HMRA 5HZ9A 5HCEC 1ZRYA 4QZTA 2F09A 4O49A 5H9KA 5AJCA 5L8OA 2QM9A 4ES7A 3STKA 2JMBA 2X46A 1CBRA 5F6ZA 1GT3A 1HQPA 3FR4A 1I04A 3BU1A 2NNQA 4R0BA 4D6AA 1O1VA 3Q6LA 5D4AA 1EPAA 4YKOA 3ZI8A 1KGLA 1B0OA 3FW4A 2WQ9A 4INNA 1D3SA 4NP1A 4YCHA 3ZW0B 5HCDC 4ORWA 1NP1A 1TW4A 4IBAA 5LJDA 4ARHA 2L68A 4GK9A 2NP1A 4AZNA 5EEEA 1EIOA 4NLIA 3CQRA 5FQ7E 5B29A 5D8JA 5L8IA 4M7MA 2ACOA 4I3BA 2A13A 3P02A 2K62A 4MISA 1SXXA 2JU3A 1SY3A 2AT8X 2BLGA 1GXAA 3FIQA 4NLJA 3U0DA 4ODDA 3WJGA 1QY0A 1SXWA 4NNTA 1JIWI 4ORUA 3OE3A 2R56A 2GC9A 2WSJA 2AT5X 4EEJA 1EUOA 5HZQA 3B2KA 3SOTA 2FR3A 1GT5A 1ALBA 2JN3A 3FA7A 3KFFA 4CK4A 2Q2MA 2OFMX 5F7GA 1KZXA 1D2UA 1S7DA 1A57A 3STNA 3VE2A 4OS8A 1U18A 2HZRA 3FEKA 3EM0A 2JU8A 4QZUA 1EIIA 4LZVA 2YMSA 1LKEA 5LJBA 3IFBA 3K3LA 4TJZA 3RWXA 5K06A 1FENA 1ML7A 1EPBA 1JJJA 5EEDA 2AKQA 3HTYA 2RCQA 1MDCA 4ALBA 3UEWA 4LKTA 1T0VA 4KCAA 4BVMA 3F8AA 5BVSA 3FEPA 3FMZA 1OBQA 2W2AA 4M6SA 3NPOA 4ALOA 1QFTA 1PM1X 1I05A 2X8SA 4ZHGA 3OD9A 1SMPI 5CE4A 3P6CA 4KT5A 1IFCA 1OBPA 2ALLX 1SY2A 2OVEA 3ZW1A 1BSOA 2L67A 5HA0A 4NW4A 1I4UA 4YFRA 2QOSC 3B2JA 4WHIA 4YCEA 4QGVA 5F58A 3JQOA 1LIEA 1QWDA 4AZRA 3NADA 5IO6A 3B2LA 4ORSA 5JR8A 3RZYA 1ADLA 3VG3A 3WJCA 2W2FA 4HPDA 1GGLA 3CWKA 4QGXA 4XMGA 3HK1A 4ML7B 1QY1A 1LFOA 3WJDA 2E4JA 3PQSA 4LZUA 2LFOA 1SY0A 3GE2A 4MVEA 4EXZA 4GETA 2WEXA 1MVGA 4N7CA 1X8NA 3MBTA 4GRJA 4TKHA 3VG7A 5L8NA 3P24A 4A1YA 1H91A 1UREA 4TKBA 5EZ2A 4U8UM 2R73A 3P6GA 1OBUA 3LHNA 1VYGA 3ELXA 3OJYC 4U8UO 1ERXA 1BRQA 3ZQ3A 3PH5A 3JSQA 2CBSA 4YMYA 3APWA 5KIDA 1LNMA 4PJ2A 1Y9LA 4YGZA 3C76X 5D45A 1ZNGA 1OPBA 3BX8A 1DV9A 4HWMA 2AT0X 2CZUA 4HPBA 3UEXA 1OEJA 1LICA 5KHPA 3NR3A 3ZUIA 1AELA 2WWPA 3UAQA 1JYDA 4ID2A 2A2GA 1ICMA 4A1HA 1E06A 1PMPA 3TZSA 4I9SA 1BEBA 1T68X 3BX7A 4O3ZA 1BWYA 1NGLA 5H9LA 2RD7C 4MIRA 5H8TA 1TOWA 1U0XA 3WJFA 3STMX 2M4LA 3FR2A 3U03A 4ZGUA 3CBSA 2RN4A 2Q39A 1BRPA 3TGCA 3KFIA 4Y0QA 3HOEA 2X45A 5HBSA 4L1NA 2RQ0A 2GTLN 4U3QA 3WXQA 3CR6A 4I3CA 2OVAA 1N0SA 3H3IA 2N93A 4BOEA 4HPCA 1LPJA 4GNYA 5BVTA 5AQ6A 1IKJA 2LBVA 4FBRA 3EMMA 3UEUA 4ZH6A 1BJ7A 2FR2A 1PBOA 2FTBA 1GM6A 3L4RA 4GU8A 4YKMA 4NNSA 1JV4A 5C0NA 2MJIA 3BSZE 3OBLA 3UEVA 1EXSA 1HMSA 1ZNKA 5DG4A 2BS5A 1KQXA 1VYFA 3FR5A 1B8EA 1YWAA 1G74A 1XKIA 3NBXX 3WJBA 4AZMA 3D97A 3HWFA 4FBOA 1LF7A 1X8UA 2LBAA 4RUNA 5LJKA 4TLJA 3O2YA 4O4OA 4IB6A 3P6FA 2O62A 2Q4NA 3FENA 1VPRA 2W2BA 2CBRA 1FEMA 3VG2A 4AZOA 3NQ3A 4AZPA 1SXYA 4QYPA 4I9RA 1ZNHA 1TOUA 3D95A 3AKMA 2ZAGA 5HWZA 1ICNA 5EDCA 2K23A 1SA8A 2LKKA 4O4UA 3S5VA 5HTEA 5FQ6E 3ZW1B 1JJXA 3S60A 4CV7A 3ELZA 4I6SA 3TGBA 1SXUA 3FA6A 4WBKA 4Y0SA 5DPQA 5BVQA 2LB6A 3CMPA 3FA9A 3F9DA 3U9PC 4MVKA 3SAOA 3QKGA 3EBKA 1HBQA 4WFUA 2ANSA 3RBYA 1IW2A 1S2PA 3KFGA 3FW5A 2RCTA 4YFPA 3I17A 4NYQA 5HA1A 1JYJA 3E3CA 4CSBA 1DC9A 2RA6A 4IB8A 3LV4A 1KT5A 2IFBA 2OVSA 4O4SA 2R74A 2JU7A 3MX7A 1ACDA 2F73A 4XMCA 4O3YA 5LKEA 1ZNDA 4GKCA 3NX2A 3RKGA 5HTDA 4O4XA 1IKEA 2MWHA 3D4RA 1YP7A 5HZ5A 2JW1A 1GKAA 5FENA 4JGLA 3G7XA 4KH8A 4UU2A 3AKNA 1NP4A 1UZ2X 3NQ9A 3B2IA 2QMIA 3APXA 1E00A 2FS6A 1KQWA 1FELA 3EYCA 4N7DA 4ZJ0A 1ERBA 1QFVA 4YDAA 2G7BA 2GTFX 3FLLA 3P6DA 4ZCBA 4YH0A 3APUA 1CJ5A 2QO5A 5LJEA 2OFRX 1BSYA 1BBPA 1AB0A 3PEDA 4OMWA 3VE1A 4D6BA 4IB9A 3VU1A 2FS7A 1PEEA 2KTSA 1CBQA 1FDQA 5HAEA 1BM5A 1BLRA 3KZAA 2OZQA 4KC7A 3TGAA 1YWDA 2A0AA 3PH6A 2HLVA 3CBCA 2XKLA 2Z4IA 4ORRA 4OS3A 4O9SA 3BLGA 3VG4A 4ZH9A 4ON1A 2CZTA 1RBPA 3BY0A 4A60A 3P6EA 3PP6A 1HBPA 1MUPA 4O3WA 3I0AA 2GJ5A 1YP6A 3IA8A 4ZFXA 1R0UA 3WVMA 5D47A 4WFVA 2A2UA 5D48A 4GDZA 3P6HA 2WR6A 3PPTA 4PSQA 3C78X 4I95A 3RSWA 1A3YA 5F1EA 1CBIA 2KT4B 1EW3A 1OEEA 5LJGA 4ZHHA 2MM3A 2CM4A 1TXLA 2BT9A 2X8TA 2ZAIA 2MHDA 2NNDA 3C77X 4IABA 5B27A 3F6ZB 1DF3A 4K19A 2L9CA 2JOZA 4XMDA 1QG5A 3JS1A 4QYNA 2G79A 3VG6A 3BDRA 4FGIB 4IMOA 4QQ1A 5LJHA 3S26A 1X71A 1JZUA 4YDBA 1U17A 4EDEA 4MVIA 1L6MA 3O22A 2HYSA 4AZQA 3WOVA 4LQZA 1KZWA 1CRBA 1FTPA 1EQDA 1DZKA 1XCAA 3MVFA 2NNEA 4IAWA 5EDBA 2XSTA 1JBHA 3BU9A 3D96A 1DZPA 3APVA 3T1DA 2G78A 3B2HA 5HZ8A 2L5PA 3TF6A 4OS0A 4HFOA 2AH7X 3KFHA 3HOLA 4XMHA 4I3DA 4U8UN 4ZR2A 5H9AA 1GX9A 2AL0X 2BS6A 2KD2A 4DQ4A 1G5WA 1S44A 3HWEA 4LKPA 1GT4A 4GH7A 4ZHFA 4ORYA 1LIFA 3HWGA 4ZHDA 4TNNA 1IIUA 4ZGFA 1KOIA 2MO5A 1MX7A 2A3FX 2CM9A 3NP1A 1EALA 3ZZVA 1TVQA 3HWDA 1DZJA 2KW1A 3ZW0A 4GNWA 4QAEA 2WEWA 4QNIA 5FFHA 3WBGA 4XMFA 1GKAB 1QQSA 1B56A 2ASNX 3FYFA 1CBSA 4YFQA 4YBPA 2AT6X 4EQAC 1G85A 3CQNA 4NYRA 1O1UA 1E5PA 4OMXA 1HN2A 1E02A 2QO6A 4O3XB 2KTDA 4YGGA 3FA8A 2FRSA 4FQBB 1KT7A 3BS2A 4UU3A 4Y0RA 1KXOA 5LJCA 2Z4HA 4TQ2A 5F6BA 4IAXA 2AMMX 3N91A 5KICA 2ACPX 2WUTA 1B4MA 2BHVA 1EI5A 4TKJA 1GT1A 1YWBA 1X8QA 5LKFA 2P8GA 5HCCC 4GE1A 3PQUA 3VPJE 4A8ZA 2POAA 4FBVA 5FQ8E 1OPAA 3BRNA 4KC8A 2YG2A 1G7NA 1X8PA 3DTQA 5AEOA 2Q2PA 3WJEA 5FAZA 1AQBA 1KT3A 5HZ6A 1YIVA 4RUUA 1KT4A 4AW8A 3DSZA 1AVGI 2GTLM 1BSQA 2HNXA 1ZNEA 2FT9A 2GTLO 4EFGA 1Y9TA 1Z24A 4Y0PA 4L3RA 5H9NA 1KT6A 2AT3X 5EPQA 4GZVA 1MX8A 2QO4A 3KQ0A 1A18A 4AYHA 3PECA 4IB7A 3VG5A 3EBWA 1YUPA 2PY1A 1RLBE 1ZNLA 3ZW2A 5AJBA 3ZWEA 4DQ3A 2DM5A 4MVLA 1OEKA 5BYPA 3FELA 4KIIA 4XMEA 1HMTA 3ZUOA 2FWVA 2FLJA 2Q9SA 3NQKA 5CYBA 3NX1A 4ORXA 2X8FA 3GAQA 1FE3A 2LA7A 4QGWA 4HPAA 5IO7A 1SY1A 4IMNA 1I06A 1T8VA 1IFBA 1LIBA 4BQUA 2OVDA 1QABE 1QY2A 2HMBA 4QRLA 4U9CA 2EU7X 3S5XA 1O8VA 4YGHA 5IO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FBV A;  4GK9 A;  4FBO A;  3S5V A;  2MWH A;  4GU8 A;  3S5X A;  3OBL A;  4FBR A;  3S60 A; 
#chains in the Genus database with same CATH topology
 1LID A;  1P6P A;  1DFV A;  1DZM A;  1GX8 A;  1X89 A;  3AEH A;  5B2A O;  1A2D A;  1YWC A;  1X8O A;  3O19 A;  5K68 A;  2HZQ A;  2WQA E;  4I60 A;  4YBU A;  2IZF B;  3V8U A;  3CKG A;  4COT A;  4ZHC A;  1HMR A;  5HZ9 A;  5HCE C;  1ZRY A;  4QZT A;  2OF9 A;  2F09 A;  4O49 A;  2RTA A;  5AJC A;  5H9K A;  2OY5 O;  1VWJ B;  2QM9 A;  2QOM A;  4ES7 A;  5L8O A;  1JQP A;  3STK A;  2UZ2 A;  2JMB A;  5IXG A;  2X46 A;  1CBR A;  5F6Z A;  1GT3 A;  1HQP A;  3FR4 A;  1I04 A;  2RTE B;  3BU1 A;  2NNQ A;  1VWD B;  4R0B A;  4BGF A;  4D6A A;  1O1V A;  3Q6L A;  5D4A A;  1EPA A;  1N4J A;  4YKO A;  3ZI8 A;  5B5F A;  1B0O A;  3FW4 A;  2WQ9 A;  1KGL A;  4INN A;  1D3S A;  4NP1 A;  4YCH A;  3ZW0 B;  5HCD C;  4ORW A;  1NP1 A;  1TW4 A;  4IBA A;  5LJD A;  4ARH A;  2L68 A;  4GK9 A;  2NP1 A;  4AZN A;  5EEE A;  1EIO A;  4NLI A;  3CQR A;  5FQ7 E;  4U46 A;  5D8J A;  5B29 A;  5L8I A;  4M7M A;  2ACO A;  1SWE A;  4I3B A;  2A13 A;  3P02 A;  1RXH A;  2K62 A;  4MIS A;  1SXX A;  3RY2 A;  2F01 A;  2JU3 A;  1Y0G A;  2WPU A;  1SY3 A;  1IJ8 A;  2AT8 X;  1GXA A;  2BLG A;  3FIQ A;  4NLJ A;  3U0D A;  3RDX A;  4CPI A;  1KL3 A;  4ODD A;  3WJG A;  1LEL A;  1QY0 A;  1SXW A;  2QCB A;  1JIW I;  4NNT A;  4ORU A;  3OE3 A;  2R56 A;  1VWR B;  2GC9 A;  1SWD A;  1SRH A;  2AT5 X;  1EUO A;  1VWK B;  2IZD B;  2WSJ A;  3B2K A;  1N7Y A;  5HZQ A;  3SOT A;  2FR3 A;  1GT5 A;  1ALB A;  2JN3 A;  3FA7 A;  3KFF A;  4CK4 A;  2Q2M A;  2OFM X;  5F7G A;  4Z2O A;  1KZX A;  1I78 A;  1D2U A;  1S7D A;  1A57 A;  3STN A;  3VE2 A;  1RXJ A;  4OS8 A;  1U18 A;  2HZR A;  3FEK A;  3EM0 A;  1SWT A;  2JU8 A;  4QZU A;  3FDC A;  1EII A;  1W5R A;  4LZV A;  2VDF A;  2YMS A;  1LKE A;  2UYW A;  5LJB A;  3IFB A;  3K3L A;  4TJZ A;  3RWX A;  5K06 A;  1FEN A;  1ML7 A;  1EPB A;  1JJJ A;  5EED A;  2RTN B;  2AKQ A;  3HTY A;  2RCQ A;  1MDC A;  4ALB A;  3UEW A;  1SWF A;  4LKT A;  1T0V A;  4KCA A;  4BVM A;  3F8A A;  5BVS A;  3FEP A;  3SZI A;  3FMZ A;  3RDU A;  2AF5 A;  4BX7 B;  1OBQ A;  2W2A A;  1E2T A;  4M6S A;  3KVN A;  3NPO A;  1QFT A;  4ALO A;  1PM1 X;  1I05 A;  2X8S A;  4ZHG A;  3OD9 A;  3D9W A;  1SMP I;  5CE4 A;  3P6C A;  4KT5 A;  1IFC A;  1OBP A;  2ALL X;  5JD2 A;  1SY2 A;  2HKD A;  2OVE A;  3ZW1 A;  1BSO A;  2L67 A;  1MEP A;  5HA0 A;  4NW4 A;  1I4U A;  1SRE A;  4YFR A;  2C4I A;  2QOS C;  3B2J A;  4WHI A;  1SWA A;  2C1Q A;  4YCE A;  4QGV A;  5F58 A;  3JQO A;  1LIE A;  1QWD A;  1NQM A;  4AZR A;  3NAD A;  4BJ8 A;  5IO6 A;  3B2L A;  4ORS A;  5JR8 A;  3RZY A;  1ADL A;  3VG3 A;  3WJC A;  2W2F A;  1W6F A;  2RTD B;  1STR B;  1K3B A;  4HPD A;  1SWB A;  1GGL A;  3CWK A;  4QGX A;  4XMG A;  3HK1 A;  1VWE B;  4YVB A;  1KFF A;  1SLD B;  1QY1 A;  4ML7 B;  5F2B A;  1LFO A;  3WJD A;  2E4J A;  3PQS A;  3T2W A;  4LZU A;  2LFO A;  1SY0 A;  3GE2 A;  4MVE A;  4EXZ A;  4GET A;  2WEX A;  1MVG A;  4N7C A;  1X8N A;  3MBT A;  4GRJ A;  4TKH A;  5B27 A;  3VG7 A;  3P24 A;  4A1Y A;  1H91 A;  1URE A;  5IRA A;  1NBX A;  4CDD A;  4TKB A;  5L8N A;  5EZ2 A;  4U8U M;  2R73 A;  3P6G A;  1OBU A;  3LHN A;  1VYG A;  3ELX A;  3OJY C;  4U8U O;  4JHQ A;  1ERX A;  1SWR A;  1BRQ A;  3VHM A;  3PH5 A;  3ZQ3 A;  1VYO A;  3FID A;  1MM9 A;  3JSQ A;  2CBS A;  4EEJ A;  3WYP A;  4YMY A;  3APW A;  5KID A;  1LNM A;  4PJ2 A;  2OFA A;  1Y9L A;  4YGZ A;  1NC9 A;  3C76 X;  5D45 A;  1ZNG A;  4CDE A;  1RSU B;  1OPB A;  3BX8 A;  1DV9 A;  4HWM A;  1SWG A;  2AT0 X;  1N9M A;  2CZU A;  2G8C O;  4HPB A;  3UEX A;  1OEJ A;  1LIC A;  1SWK A;  2IZA A;  2PI3 O;  3NR3 A;  5KHP A;  3ZUI A;  1AEL A;  2WWP A;  3UAQ A;  1JYD A;  2OL7 A;  2A2G A;  4ID2 A;  1ICM A;  4A1H A;  1E06 A;  1KL4 A;  1PMP A;  2IZK A;  3TZS A;  4I9S A;  1BEB A;  2A5B A;  1T68 X;  1W4T A;  3BX7 A;  4O3Z A;  1BWY A;  1NGL A;  1LDO A;  5H9L A;  2RD7 C;  4MIR A;  5H8T A;  1TOW A;  1U0X A;  3WJF A;  4CPH A;  1HQQ A;  3STM X;  2M4L A;  1JJU A;  3FR2 A;  3U03 A;  4ZGU A;  3CBS A;  2RN4 A;  2RTQ B;  2Q39 A;  1BRP A;  1RAV A;  4DNE A;  3TGC A;  3KFI A;  4Y0Q A;  3HOE A;  2X45 A;  3Q34 A;  1VWA B;  4L1N A;  2IZC B;  2RQ0 A;  2BSZ A;  2GTL N;  4U3Q A;  5HBS A;  3CR6 A;  2OFB A;  3WXQ A;  4I3C A;  2OVA A;  2IZB A;  1GX3 A;  1N0S A;  1NDJ A;  3H3I A;  2N93 A;  2RTM A;  1VWL B;  4BOE A;  4HPC A;  1LPJ A;  4GNY A;  5BVT A;  5AQ6 A;  1IKJ A;  2LBV A;  4FBR A;  3EMM A;  3UEU A;  4ZH6 A;  5K67 A;  1BJ7 A;  2FR2 A;  1PBO A;  2FTB A;  2OF8 A;  2OY7 A;  1GM6 A;  3L4R A;  4GU8 A;  4YKM A;  3SLO A;  2OL6 O;  1JV4 A;  4NNS A;  2MJI A;  3BSZ E;  3OBL A;  4OEL A;  3UEV A;  1RST B;  1EXS A;  1HMS A;  1ZNK A;  5DG4 A;  1KQX A;  1VYF A;  2BS5 A;  3FR5 A;  1B8E A;  1YWA A;  1G74 A;  1XKI A;  3NBX X;  4GJS A;  3WJB A;  4AZM A;  1N43 A;  3D97 A;  3HWF A;  4FBO A;  1LF7 A;  1X8U A;  2LBA A;  4RUN A;  5LJK A;  1SLF B;  4TLJ A;  4GGR A;  2G5L A;  3O2Y A;  4IRW A;  3AUM O;  4O4O A;  4IB6 A;  3MG5 A;  3P6F A;  1JMX A;  2O62 A;  2Q4N A;  3FEN A;  1VPR A;  2W2B A;  2CBR A;  1FEM A;  3VG2 A;  4AZO A;  3NQ3 A;  4AZP A;  1SXY A;  4QYP A;  4I9R A;  4JNJ A;  2RTG B;  1ZNH A;  1TOU A;  3D95 A;  3AKM A;  2JGS A;  2ZAG A;  5HWZ A;  1ICN A;  3EW1 A;  4GGZ A;  5EDC A;  2K23 A;  1SA8 A;  2LKK A;  4O4U A;  2IZI A;  3S5V A;  2A8G A;  1STS B;  5HTE A;  5FQ6 E;  2RTF B;  5CSE A;  3ZW1 B;  1JJX A;  1STP A;  3S60 A;  3VHH A;  4CV7 A;  3ELZ A;  4I6S A;  2FGS A;  1SRI A;  3TGB A;  2I5Z O;  1SXU A;  3FA6 A;  4WBK A;  4Y0S A;  5DPQ A;  5BVQ A;  2LB6 A;  2RTO B;  3CMP A;  3F9D A;  3FA9 A;  3U9P C;  1UYN X;  4MVK A;  2FKJ A;  3SAO A;  2I5V O;  2RTJ A;  3QKG A;  2IZJ A;  3EBK A;  5B11 O;  1HBQ A;  2BC3 A;  2ANS A;  4GDA A;  4WFU A;  3RBY A;  1IW2 A;  2DJG A;  1S2P A;  3KFG A;  5C0N A;  3FW5 A;  2RCT A;  4YFP A;  3I17 A;  4NYQ A;  5HA1 A;  1JYJ A;  3C77 X;  3E3C A;  4CSB A;  1DC9 A;  2RA6 A;  4IB8 A;  1VWH B;  3LV4 A;  1KT5 A;  2IFB A;  2OVS A;  4O4S A;  2R74 A;  2JU7 A;  1SWS A;  3MX7 A;  4Y5D A;  1SWJ A;  1ACD A;  2F73 A;  4XMC A;  1JMZ A;  2X56 A;  4O3Y A;  5LKE A;  1ZND A;  4GKC A;  3NX2 A;  3T6L A;  3RKG A;  5HTD A;  4O4X A;  1IKE A;  2MWH A;  3D4R A;  2IZH B;  1YP7 A;  5HZ5 A;  2FKG A;  2JW1 A;  4Y59 A;  1GKA A;  5FEN A;  4JGL A;  3G7X A;  4KH8 A;  4UU2 A;  3AKN A;  5IRU A;  1NP4 A;  1UZ2 X;  3NQ9 A;  3B2I A;  1RXK A;  2OY1 O;  2QMI A;  3APX A;  3PDF A;  4DCB A;  1E00 A;  2FS6 A;  1KQW A;  1FEL A;  3EYC A;  4JO6 A;  4N7D A;  4ZJ0 A;  1ERB A;  3QQ2 A;  1PTS A;  2Y32 A;  1SWL A;  1QFV A;  4YDA A;  2G7B A;  2GTF X;  3FLL A;  3P6D A;  4ZCB A;  3WZN A;  3SZJ A;  4YH0 A;  3APU A;  1CJ5 A;  2QO5 A;  3MM0 A;  5LJE A;  1BSY A;  2OFR X;  1BBP A;  3CKF A;  1AB0 A;  3WZQ A;  2IZG B;  1DF8 A;  4BX6 A;  3PED A;  3PK2 A;  4OMW A;  3VE1 A;  4D6B A;  2RTC B;  4Z6J A;  4CPH B;  4IB9 A;  3SZH A;  2FS7 A;  3VU1 A;  1PEE A;  2KTS A;  1CBQ A;  1FDQ A;  5HAE A;  4C5P A;  2RTK A;  1BM5 A;  1BLR A;  1VWN B;  3KZA A;  2OZQ A;  2VFB A;  4KC7 A;  3TGA A;  1YWD A;  2A0A A;  1MOY A;  2HLV A;  3CBC A;  2XKL A;  2Z4I A;  2ZSC A;  3PH6 A;  4ORR A;  4OS3 A;  3WZP A;  3WZO A;  4O9S A;  3BLG A;  3VG4 A;  1WUB A;  4ZH9 A;  4ON1 A;  2CZT A;  4GGT A;  1RBP A;  3BY0 A;  2VFC A;  4A60 A;  3P6E A;  3PP6 A;  1HBP A;  1MUP A;  4O3W A;  3HPE A;  2GJ5 A;  3I0A A;  1YP6 A;  3IA8 A;  5B10 O;  4ZFX A;  1R0U A;  2OYB O;  3WVM A;  5D47 A;  1KL5 A;  2GH7 A;  4WFV A;  3RDQ A;  2A2U A;  5D48 A;  4GDZ A;  3P6H A;  2WR6 A;  3PPT A;  3T2X A;  4PSQ A;  3C78 X;  4I95 A;  2OY8 A;  2RTI B;  3RSW A;  1A3Y A;  5L3Y A;  5F1E A;  1CBI A;  2KT4 B;  1EW3 A;  1OEE A;  5LJG A;  4ZHH A;  2MM3 A;  2CM4 A;  1TXL A;  2BT9 A;  2IZL B;  1SWP A;  2MHD A;  2NND A;  2RTR B;  2X8T A;  2ZAI A;  3EC5 A;  1MK5 A;  1SRJ A;  3F6Z B;  4IAB A;  1DF3 A;  4K19 A;  1Y52 X;  2L9C A;  2JOZ A;  4XMD A;  1QG5 A;  3JS1 A;  4QYN A;  2G79 A;  1N9Y A;  3VG6 A;  3BDR A;  4FGI B;  2DJF A;  4OKA A;  4IMO A;  1NQN A;  4QQ1 A;  5LJH A;  3S26 A;  1X71 A;  1LDQ A;  4YDB A;  4EKV A;  1JZU A;  1U17 A;  3LTW A;  4EDE A;  4MVI A;  1L6M A;  3O22 A;  2HYS A;  1VWC B;  4AZQ A;  3WOV A;  4LQZ A;  1KZW A;  1CRB A;  1FTP A;  1EQD A;  1DZK A;  1LCV A;  1XCA A;  4BX5 A;  3MVF A;  2NNE A;  4IAW A;  5EDB A;  2XST A;  2AVI A;  4OEM A;  1JBH A;  3BU9 A;  3D96 A;  1DZP A;  1FJ1 E;  1AVE A;  3APV A;  3T1D A;  1Y55 X;  2G78 A;  3B2H A;  5HZ8 A;  2RTH B;  2L5P A;  2A5C A;  3TF6 A;  4OS0 A;  4HFO A;  2AH7 X;  3KFH A;  3HOL A;  5B3M O;  4XMH A;  4I3D A;  4U8U N;  4ZR2 A;  5H9A A;  1GX9 A;  2AL0 X;  1HXZ A;  2BS6 A;  2KD2 A;  4DQ4 A;  1G5W A;  1S44 A;  3HWE A;  1SLG B;  3RDO A;  4LKP A;  1GT4 A;  4GH7 A;  4ZHF A;  2FHL A;  1LIF A;  4ORY A;  3HWG A;  4ZHD A;  2Y3E A;  4TNN A;  1IIU A;  4ZGF A;  1KOI A;  2MO5 A;  3VHI A;  1MX7 A;  2A3F X;  3T6F A;  1VWM B;  2CM9 A;  4CPE A;  3NP1 A;  1EAL A;  3ZZV A;  1TVQ A;  3HWD A;  3SLJ A;  5CHK A;  3WYQ A;  1DZJ A;  2KW1 A;  1UYO X;  3ZW0 A;  1PBY A;  4GNW A;  2WEW A;  4QAE A;  4QNI A;  5FFH A;  3WBG A;  4XMF A;  4GD9 A;  1GKA B;  1SWQ A;  1QQS A;  1B56 A;  1SWO A;  2ASN X;  1CBS A;  3FYF A;  4YFQ A;  4YBP A;  2AT6 X;  4EQA C;  3RY1 A;  1G85 A;  3CQN A;  4NYR A;  2X4M A;  1O1U A;  1E5P A;  4OMX A;  1HN2 A;  1E02 A;  2QO6 A;  4O3X B;  2KTD A;  1SWU A;  1VWG B;  4YGG A;  3FA8 A;  2FRS A;  2RTP B;  1KT7 A;  4FQB B;  3BS2 A;  4UU3 A;  4Y0R A;  1KXO A;  5LJC A;  2Z4H A;  4TQ2 A;  5F6B A;  4IAX A;  3RE6 A;  2AMM X;  2CAM A;  2Y3F A;  4Z27 A;  3N91 A;  5KIC A;  3RDM A;  1VWI B;  2ACP X;  2WUT A;  4GJV A;  1LCZ A;  1B4M A;  1VWB B;  2BHV A;  1HY2 A;  4MEE A;  1EI5 A;  4TKJ A;  4CDF A;  1GT1 A;  1YWB A;  1X8Q A;  5LKF A;  2P8G A;  5HCC C;  1K24 A;  3PQU A;  4GE1 A;  3VPJ E;  4A8Z A;  4BX6 B;  2POA A;  4FBV A;  2RTB B;  5FQ8 E;  1OPA A;  3SLT A;  3BRN A;  4KC8 A;  4CDC A;  2YG2 A;  1G7N A;  1X8P A;  1AVD A;  3DTQ A;  5AEO A;  2Q2P A;  2X32 A;  3WJE A;  1SWC A;  4NV7 A;  1AQB A;  1KT3 A;  5FAZ A;  3X00 A;  1VWP B;  5HZ6 A;  1YIV A;  4RUU A;  1KT4 A;  4NV8 A;  3DSZ A;  1VWQ B;  4AW8 A;  3EW2 A;  4CPF A;  1AVG I;  1SRG A;  1SLE B;  4BBO A;  2GTL M;  1BSQ A;  1SRF A;  2HNX A;  1ZNE A;  2FT9 A;  2GTL O;  4EFG A;  1Y9T A;  1Z24 A;  4Y0P A;  4L3R A;  5H9N A;  1KT6 A;  2AT3 X;  5EPQ A;  4B55 A;  1OSP O;  1Y53 X;  4GZV A;  1HXL A;  4BX7 A;  1MX8 A;  2QO4 A;  1VWO B;  3KQ0 A;  1A18 A;  1SWH A;  3RE5 A;  4AYH A;  5IRW A;  3PEC A;  4IB7 A;  4Z2P A;  2X34 A;  2IZE B;  3VG5 A;  3EBW A;  1YUP A;  4BCS A;  1LUQ A;  2PY1 A;  4GUZ A;  2X55 A;  1RLB E;  1VWF B;  1ZNL A;  3VGW A;  3ZW2 A;  5AJB A;  3ZWE A;  4DQ3 A;  2DM5 A;  3RDS A;  4MVL A;  1OEK A;  5BYP A;  3FEL A;  4KII A;  2FHN X;  1HMT A;  2OL8 O;  2C1S A;  2FWV A;  4XME A;  3ZUO A;  2FLJ A;  2Q9S A;  3NQK A;  5CYB A;  4Z28 A;  3NX1 A;  4ORX A;  2X8F A;  1SWN A;  3GAQ A;  1FE3 A;  2LA7 A;  4QGW A;  4HPA A;  5B5G A;  1SY1 A;  4IMN A;  5IO7 A;  1I06 A;  4BX5 B;  1T8V A;  1IFB A;  1LIB A;  4BQU A;  2OVD A;  1QAB E;  4Z2V A;  1QY2 A;  2HMB A;  4QRL A;  2RTL A;  4U9C A;  2EU7 X;  3S5X A;  1LCW A;  2MF6 A;  1I9H A;  1WBI A;  1O8V A;  4YGH A;  5IO5 A; 
#chains in the Genus database with same CATH homology
 1LID A;  1P6P A;  1DFV A;  1DZM A;  1GX8 A;  1X89 A;  1A2D A;  1YWC A;  1X8O A;  3O19 A;  2HZQ A;  2WQA E;  4YBU A;  3V8U A;  4ZHC A;  4COT A;  1HMR A;  5HZ9 A;  5HCE C;  1ZRY A;  4QZT A;  2F09 A;  4O49 A;  5H9K A;  5AJC A;  5L8O A;  2QM9 A;  4ES7 A;  3STK A;  2JMB A;  2X46 A;  1CBR A;  5F6Z A;  1GT3 A;  1HQP A;  3FR4 A;  1I04 A;  3BU1 A;  2NNQ A;  4R0B A;  4D6A A;  1O1V A;  3Q6L A;  5D4A A;  1EPA A;  4YKO A;  3ZI8 A;  1KGL A;  1B0O A;  3FW4 A;  2WQ9 A;  4INN A;  1D3S A;  4NP1 A;  4YCH A;  3ZW0 B;  5HCD C;  4ORW A;  1NP1 A;  1TW4 A;  4IBA A;  5LJD A;  4ARH A;  2L68 A;  4GK9 A;  2NP1 A;  4AZN A;  5EEE A;  1EIO A;  4NLI A;  3CQR A;  5FQ7 E;  5B29 A;  5D8J A;  5L8I A;  4M7M A;  2ACO A;  4I3B A;  2A13 A;  3P02 A;  2K62 A;  4MIS A;  1SXX A;  2JU3 A;  1SY3 A;  2AT8 X;  2BLG A;  1GXA A;  3FIQ A;  4NLJ A;  3U0D A;  4ODD A;  3WJG A;  1QY0 A;  1SXW A;  4NNT A;  1JIW I;  4ORU A;  3OE3 A;  2R56 A;  2GC9 A;  2WSJ A;  2AT5 X;  4EEJ A;  1EUO A;  5HZQ A;  3B2K A;  3SOT A;  2FR3 A;  1GT5 A;  1ALB A;  2JN3 A;  3FA7 A;  3KFF A;  4CK4 A;  2Q2M A;  2OFM X;  5F7G A;  1KZX A;  1D2U A;  1S7D A;  1A57 A;  3STN A;  3VE2 A;  4OS8 A;  1U18 A;  2HZR A;  3FEK A;  3EM0 A;  2JU8 A;  4QZU A;  1EII A;  4LZV A;  2YMS A;  1LKE A;  5LJB A;  3IFB A;  3K3L A;  4TJZ A;  3RWX A;  5K06 A;  1FEN A;  1ML7 A;  1EPB A;  1JJJ A;  5EED A;  2AKQ A;  3HTY A;  2RCQ A;  1MDC A;  4ALB A;  3UEW A;  4LKT A;  1T0V A;  4KCA A;  4BVM A;  3F8A A;  5BVS A;  3FEP A;  3FMZ A;  1OBQ A;  2W2A A;  4M6S A;  3NPO A;  4ALO A;  1QFT A;  1PM1 X;  1I05 A;  2X8S A;  4ZHG A;  3OD9 A;  1SMP I;  5CE4 A;  3P6C A;  4KT5 A;  1IFC A;  1OBP A;  2ALL X;  1SY2 A;  2OVE A;  3ZW1 A;  1BSO A;  2L67 A;  5HA0 A;  4NW4 A;  1I4U A;  4YFR A;  2QOS C;  3B2J A;  4WHI A;  4YCE A;  4QGV A;  5F58 A;  3JQO A;  1LIE A;  1QWD A;  4AZR A;  3NAD A;  5IO6 A;  3B2L A;  4ORS A;  5JR8 A;  3RZY A;  1ADL A;  3VG3 A;  3WJC A;  2W2F A;  4HPD A;  1GGL A;  3CWK A;  4QGX A;  4XMG A;  3HK1 A;  4ML7 B;  1QY1 A;  1LFO A;  3WJD A;  2E4J A;  3PQS A;  4LZU A;  2LFO A;  1SY0 A;  3GE2 A;  4MVE A;  4EXZ A;  4GET A;  2WEX A;  1MVG A;  4N7C A;  1X8N A;  3MBT A;  4GRJ A;  4TKH A;  3VG7 A;  5L8N A;  3P24 A;  4A1Y A;  1H91 A;  1URE A;  4TKB A;  5EZ2 A;  4U8U M;  2R73 A;  3P6G A;  1OBU A;  3LHN A;  1VYG A;  3ELX A;  3OJY C;  4U8U O;  1ERX A;  1BRQ A;  3ZQ3 A;  3PH5 A;  3JSQ A;  2CBS A;  4YMY A;  3APW A;  5KID A;  1LNM A;  4PJ2 A;  1Y9L A;  4YGZ A;  3C76 X;  5D45 A;  1ZNG A;  1OPB A;  3BX8 A;  1DV9 A;  4HWM A;  2AT0 X;  2CZU A;  4HPB A;  3UEX A;  1OEJ A;  1LIC A;  5KHP A;  3NR3 A;  3ZUI A;  1AEL A;  2WWP A;  3UAQ A;  1JYD A;  4ID2 A;  2A2G A;  1ICM A;  4A1H A;  1E06 A;  1PMP A;  3TZS A;  4I9S A;  1BEB A;  1T68 X;  3BX7 A;  4O3Z A;  1BWY A;  1NGL A;  5H9L A;  2RD7 C;  4MIR A;  5H8T A;  1TOW A;  1U0X A;  3WJF A;  3STM X;  2M4L A;  3FR2 A;  3U03 A;  4ZGU A;  3CBS A;  2RN4 A;  2Q39 A;  1BRP A;  3TGC A;  3KFI A;  4Y0Q A;  3HOE A;  2X45 A;  5HBS A;  4L1N A;  2RQ0 A;  2GTL N;  4U3Q A;  3WXQ A;  3CR6 A;  4I3C A;  2OVA A;  1N0S A;  3H3I A;  2N93 A;  4BOE A;  4HPC A;  1LPJ A;  4GNY A;  5BVT A;  5AQ6 A;  1IKJ A;  2LBV A;  4FBR A;  3EMM A;  3UEU A;  4ZH6 A;  1BJ7 A;  2FR2 A;  1PBO A;  2FTB A;  1GM6 A;  3L4R A;  4GU8 A;  4YKM A;  4NNS A;  1JV4 A;  5C0N A;  2MJI A;  3BSZ E;  3OBL A;  3UEV A;  1EXS A;  1HMS A;  1ZNK A;  5DG4 A;  2BS5 A;  1KQX A;  1VYF A;  3FR5 A;  1B8E A;  1YWA A;  1G74 A;  1XKI A;  3NBX X;  3WJB A;  4AZM A;  3D97 A;  3HWF A;  4FBO A;  1LF7 A;  1X8U A;  2LBA A;  4RUN A;  5LJK A;  4TLJ A;  3O2Y A;  4O4O A;  4IB6 A;  3P6F A;  2O62 A;  2Q4N A;  3FEN A;  1VPR A;  2W2B A;  2CBR A;  1FEM A;  3VG2 A;  4AZO A;  3NQ3 A;  4AZP A;  1SXY A;  4QYP A;  4I9R A;  1ZNH A;  1TOU A;  3D95 A;  3AKM A;  2ZAG A;  5HWZ A;  1ICN A;  5EDC A;  2K23 A;  1SA8 A;  2LKK A;  4O4U A;  3S5V A;  5HTE A;  5FQ6 E;  3ZW1 B;  1JJX A;  3S60 A;  4CV7 A;  3ELZ A;  4I6S A;  3TGB A;  1SXU A;  3FA6 A;  4WBK A;  4Y0S A;  5DPQ A;  5BVQ A;  2LB6 A;  3CMP A;  3FA9 A;  3F9D A;  3U9P C;  4MVK A;  3SAO A;  3QKG A;  3EBK A;  1HBQ A;  4WFU A;  2ANS A;  3RBY A;  1IW2 A;  1S2P A;  3KFG A;  3FW5 A;  2RCT A;  4YFP A;  3I17 A;  4NYQ A;  5HA1 A;  1JYJ A;  3E3C A;  4CSB A;  1DC9 A;  2RA6 A;  4IB8 A;  3LV4 A;  1KT5 A;  2IFB A;  2OVS A;  4O4S A;  2R74 A;  2JU7 A;  3MX7 A;  1ACD A;  2F73 A;  4XMC A;  4O3Y A;  5LKE A;  1ZND A;  4GKC A;  3NX2 A;  3RKG A;  5HTD A;  4O4X A;  1IKE A;  2MWH A;  3D4R A;  1YP7 A;  5HZ5 A;  2JW1 A;  1GKA A;  5FEN A;  4JGL A;  3G7X A;  4KH8 A;  4UU2 A;  3AKN A;  1NP4 A;  1UZ2 X;  3NQ9 A;  3B2I A;  2QMI A;  3APX A;  1E00 A;  2FS6 A;  1KQW A;  1FEL A;  3EYC A;  4N7D A;  4ZJ0 A;  1ERB A;  1QFV A;  4YDA A;  2G7B A;  2GTF X;  3FLL A;  3P6D A;  4ZCB A;  4YH0 A;  3APU A;  1CJ5 A;  2QO5 A;  5LJE A;  2OFR X;  1BSY A;  1BBP A;  1AB0 A;  3PED A;  4OMW A;  3VE1 A;  4D6B A;  4IB9 A;  3VU1 A;  2FS7 A;  1PEE A;  2KTS A;  1CBQ A;  1FDQ A;  5HAE A;  1BM5 A;  1BLR A;  3KZA A;  2OZQ A;  4KC7 A;  3TGA A;  1YWD A;  2A0A A;  3PH6 A;  2HLV A;  3CBC A;  2XKL A;  2Z4I A;  4ORR A;  4OS3 A;  4O9S A;  3BLG A;  3VG4 A;  4ZH9 A;  4ON1 A;  2CZT A;  1RBP A;  3BY0 A;  4A60 A;  3P6E A;  3PP6 A;  1HBP A;  1MUP A;  4O3W A;  3I0A A;  2GJ5 A;  1YP6 A;  3IA8 A;  4ZFX A;  1R0U A;  3WVM A;  5D47 A;  4WFV A;  2A2U A;  5D48 A;  4GDZ A;  3P6H A;  2WR6 A;  3PPT A;  4PSQ A;  3C78 X;  4I95 A;  3RSW A;  1A3Y A;  5F1E A;  1CBI A;  2KT4 B;  1EW3 A;  1OEE A;  5LJG A;  4ZHH A;  2MM3 A;  2CM4 A;  1TXL A;  2BT9 A;  2X8T A;  2ZAI A;  2MHD A;  2NND A;  3C77 X;  4IAB A;  5B27 A;  3F6Z B;  1DF3 A;  4K19 A;  2L9C A;  2JOZ A;  4XMD A;  1QG5 A;  3JS1 A;  4QYN A;  2G79 A;  3VG6 A;  3BDR A;  4FGI B;  4IMO A;  4QQ1 A;  5LJH A;  3S26 A;  1X71 A;  1JZU A;  4YDB A;  1U17 A;  4EDE A;  4MVI A;  1L6M A;  3O22 A;  2HYS A;  4AZQ A;  3WOV A;  4LQZ A;  1KZW A;  1CRB A;  1FTP A;  1EQD A;  1DZK A;  1XCA A;  3MVF A;  2NNE A;  4IAW A;  5EDB A;  2XST A;  1JBH A;  3BU9 A;  3D96 A;  1DZP A;  3APV A;  3T1D A;  2G78 A;  3B2H A;  5HZ8 A;  2L5P A;  3TF6 A;  4OS0 A;  4HFO A;  2AH7 X;  3KFH A;  3HOL A;  4XMH A;  4I3D A;  4U8U N;  4ZR2 A;  5H9A A;  1GX9 A;  2AL0 X;  2BS6 A;  2KD2 A;  4DQ4 A;  1G5W A;  1S44 A;  3HWE A;  4LKP A;  1GT4 A;  4GH7 A;  4ZHF A;  4ORY A;  1LIF A;  3HWG A;  4ZHD A;  4TNN A;  1IIU A;  4ZGF A;  1KOI A;  2MO5 A;  1MX7 A;  2A3F X;  2CM9 A;  3NP1 A;  1EAL A;  3ZZV A;  1TVQ A;  3HWD A;  1DZJ A;  2KW1 A;  3ZW0 A;  4GNW A;  4QAE A;  2WEW A;  4QNI A;  5FFH A;  3WBG A;  4XMF A;  1GKA B;  1QQS A;  1B56 A;  2ASN X;  3FYF A;  1CBS A;  4YFQ A;  4YBP A;  2AT6 X;  4EQA C;  1G85 A;  3CQN A;  4NYR A;  1O1U A;  1E5P A;  4OMX A;  1HN2 A;  1E02 A;  2QO6 A;  4O3X B;  2KTD A;  4YGG A;  3FA8 A;  2FRS A;  4FQB B;  1KT7 A;  3BS2 A;  4UU3 A;  4Y0R A;  1KXO A;  5LJC A;  2Z4H A;  4TQ2 A;  5F6B A;  4IAX A;  2AMM X;  3N91 A;  5KIC A;  2ACP X;  2WUT A;  1B4M A;  2BHV A;  1EI5 A;  4TKJ A;  1GT1 A;  1YWB A;  1X8Q A;  5LKF A;  2P8G A;  5HCC C;  4GE1 A;  3PQU A;  3VPJ E;  4A8Z A;  2POA A;  4FBV A;  5FQ8 E;  1OPA A;  3BRN A;  4KC8 A;  2YG2 A;  1G7N A;  1X8P A;  3DTQ A;  5AEO A;  2Q2P A;  3WJE A;  5FAZ A;  1AQB A;  1KT3 A;  5HZ6 A;  1YIV A;  4RUU A;  1KT4 A;  4AW8 A;  3DSZ A;  1AVG I;  2GTL M;  1BSQ A;  2HNX A;  1ZNE A;  2FT9 A;  2GTL O;  4EFG A;  1Y9T A;  1Z24 A;  4Y0P A;  4L3R A;  5H9N A;  1KT6 A;  2AT3 X;  5EPQ A;  4GZV A;  1MX8 A;  2QO4 A;  3KQ0 A;  1A18 A;  4AYH A;  3PEC A;  4IB7 A;  3VG5 A;  3EBW A;  1YUP A;  2PY1 A;  1RLB E;  1ZNL A;  3ZW2 A;  5AJB A;  3ZWE A;  4DQ3 A;  2DM5 A;  4MVL A;  1OEK A;  5BYP A;  3FEL A;  4KII A;  4XME A;  1HMT A;  3ZUO A;  2FWV A;  2FLJ A;  2Q9S A;  3NQK A;  5CYB A;  3NX1 A;  4ORX A;  2X8F A;  3GAQ A;  1FE3 A;  2LA7 A;  4QGW A;  4HPA A;  5IO7 A;  1SY1 A;  4IMN A;  1I06 A;  1T8V A;  1IFB A;  1LIB A;  4BQU A;  2OVD A;  1QAB E;  1QY2 A;  2HMB A;  4QRL A;  4U9C A;  2EU7 X;  3S5X A;  1O8V A;  4YGH A;  5IO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...