4FC6A

Studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
274
structure length
274
Chain Sequence
PPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Studies of human 2,4-dienoyl CoA reductase shed new light on peroxisomal beta-oxidation of unsaturated fatty acids
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Peroxisomal 2,4-dienoyl-CoA reductase
total genus 109
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.34: 2,4-dienoyl-CoA reductase (NADPH).
pdb deposition date 2012-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fc6A00
3JD1A 2LDBA 4C4OA 3EHEA 5AXCA 4DIOA 2EEZA 3GEDA 1ADGA 1JKIA 2PZKA 3ROPA 3TJRA 4KUGA 2CNBA 1PJLA 1PZHA 4HFRA 5G0SA 3E82A 3KUXA 1E5LA 4HY3A 4EBFA 4U7WA 3ENKA 2VZ9A 5KIAA 3VZQA 2HAEA 1UZNA 3TFQA 4J43A 1X14A 4DTIA 3OJLA 3DZJA 4XEHA 3QV1A 3O38A 1NR7A 2YDXA 4DPMA 4Q39A 4E5PA 2ZB4A 4ALIA 4E32A 4AJEA 1DXYA 1YDWA 5LC1A 1VL0A 2GZ3A 4ITUA 2B5WA 3LDHA 4UVGA 4YJGA 4DIFA 5A04A 2CFCA 3ZHBA 4BMVA 4EJ6A 3O8QA 1C14A 5L3ZA 5F21A 1PJ4A 4YT2A 2W2KA 4XDYA 4E5KA 4RLSA 5L4NA 1GUYA 4QECA 5KKAA 2NLOA 1KETA 3TFOA 3ETDA 4IQGA 4CMCA 2B5VA 1UP6A 3VZRA 3B1JA 1TB4A 4P4LA 1HXHA 2YHIA 4XIJA 2CMDA 4RF2A 4PLGA 3GQVA 4ZICA 4F46A 2HLPA 2I3GA 3OJ0A 3GG9A 4MVJA 1SB8A 1DRVA 3OIDA 1HDGO 3DWFA 2VTDA 3SLKA 1WLYA 3DO5A 2P5UA 3FPLA 5EESA 4AICA 4R9SA 5ITWA 1XIVA 4YQZA 4TQGA 3ANMA 4Z0TA 3MJSA 1R6DA 4J2HA 3IMFA 4I8XA 4U0JA 3GNTA 1FF9A 1H9BA 3AI1A 4FQ8A 4NQZA 4CMAA 3GGPA 4N5NA 4A27A 3DR3A 4DMMA 1N7HA 4R01A 3UGKA 1QXSA 4BNIA 3ZZNA 1A4IA 3WB9A 2X9NA 1B15A 3U09A 5JFOA 3VZSA 3MWDB 4CQLB 4BGVA 2DBRA 1U3WA 1NVGA 3K73O 4RL6A 3V2UA 1EFKA 3WYCA 2JFGA 2CF5A 2FMUA 5F5NA 4RPKA 2DC1A 1WDLA 1E7QA 3BMCA 1WVGA 3CUKA 3IJRA 2DBVO 4HBGA 4R69A 5JLAA 3OM9A 4GLOA 1TXGA 3V1YA 1DC4A 1VJ0A 5IG2A 1QMGA 4ALNA 4PZEA 4PLHA 2EF1A 2D2IA 2ZYGA 4WCFA 4XDZA 4J9UE 4P22A 4WLFA 1YONA 3NJ4A 3C8MA 3EVTA 4IBOA 1P0FA 1XKQA 3PTZA 3I9OA 2JD2A 1LU9A 1N9GB 2X5KO 1CQIA 1F8GA 2CUKA 3PZRA 4WOKA 3QVSA 3H8VA 3CIFA 4YAIA 4H16A 4P38A 5GZ1A 4NPCA 2Q1UA 3KBOA 3F46A 1ARZA 3DBRA 1CIVA 1O0SA 3BTSA 5EERA 5TF4A 1DRWA 1QYXA 4I9UA 1OAAA 2H5LA 5ICSA 2VNSA 2EG9A 5FEUA 4DPKA 4BNTA 1P1KA 4XD2A 1P1IA 3ORFA 3JQFC 4TKLA 3W6ZA 1ZBQA 3U5TA 3VPHA 4BO1A 5A5EA 2JFHA 3D5TA 4Q3BA 4WLOA 3AOEA 3LVFO 1P9LA 2PFGA 2W98A 1EEHA 2YHUA 4MVJD 2JJYA 4OGWA 1JVBA 3V8BA 3CXRA 2IZ1A 3I52A 1U2DA 5TQVA 5T5QA 1SCUA 4XQ9A 1LNQA 4LISA 1L1FA 4I9NA 3SVTA 1IYZA 5AQ1A 3AY3A 1W8DA 3KB6A 1Q0QA 3CMMA 4BGIA 4R3WA 5EPOA 1DEHA 3H2SA 2BFMA 4TRJA 4QT0A 4JJFA 3U9LA 4A73A 4RVGA 2VOJA 3QVTA 3RWBA 3DOCA 4U0KA 1KOLA 1ZSNA 4IDCA 3ONDA 1GCOA 4O63O 3GHYA 4KOAA 2ZTVA 1P1HA 2E37A 2PKRA 4HNGA 3PI7A 4IDGA 4J2OA 3T4EA 3WFJA 4PG6A 5GY7A 1R0SA 1GQ2A 4WCFC 4J16A 1PGPA 1F8FA 3K30A 3OSUA 3W1VA 4D3SA 5JS6A 4HWKA 4H3VA 3OMLA 3PQDA 1ZSVA 2XXJA 3H9GA 5FFFA 1DO8A 2NVUA 5I7VA 1M76A 2GN8A 4QO7A 4MIOA 2BFAA 4W99A 3LC7O 4YA6A 5IZCC 1NPDA 4GSKA 3RBVA 4E2XA 1A7KA 1Y8QB 2NSDA 1E3JA 2QYTA 3RAJA 1KVUA 1WMBA 4WNCA 2OZPA 4BNKA 1D1TA 2EJVA 3EDMA 4JP2A 3LT4A 3QIVA 3ZV3A 1I2ZA 5L51A 3R1IA 4FOSA 2OO5A 4W9NC 3A9WA 2P68A 4ZQHA 3B6ZA 3I6IA 3INRA 4AJNA 3ZU4A 4LW8A 4YVFA 3RFTA 2C59A 5ER9A 1U8FO 2OORA 2NTNA 2W2LD 3R6DA 3KYCA 4CM8B 4Z0HO 4CQMA 1FK8A 5KVCA 1BW9A 3PRJA 4ND3A 2D3TA 5BQFA 4HX5A 3LQFA 4GX0A 3NT4A 4WGGA 4YB8A 2FOIA 2HMSA 4CMHA 1I2BA 1SEVA 4KWHA 4ID9A 5L45A 2AEFA 3BMQB 1U7HA 1HE3A 4BNXA 1YB1A 2X58A 4MJLA 2V6MA 4Y9DA 1LRKA 4OM8A 4YJFA 4CM4A 5IZ4A 2OP1A 4H7PA 5EIOA 4WASA 1LC3A 4IQ8A 4KQWA 1CJCA 1Z6ZA 1ZO8A 2I67A 2WYWA 4QO8A 1UDCA 5H83A 4AG3A 3BYZA 4YWJA 2D59A 4GMFA 1OBFO 3ENNA 3FHLA 5ADHA 4EUEA 5COQA 2NQTA 1VI2A 1YB5A 1F0YA 2NNLD 3T7EA 1TT5A 3C24A 1RYDA 1R4MA 1U9JA 2ZB8A 4XGKA 1IZ0A 1K0UA 1DC3A 2VYND 2RH4A 3EZYA 3F1LA 1YH3A 2YYYA 3HDJA 4IGFA 4ROSA 4NBTA 3AM5A 4FBGA 5C37A 4BQRA 3K5PA 4R1NA 2A4KA 3GPIA 1MFZA 1BXGA 2PR2A 3PHJA 1U5CA 3RUCA 2B4RO 5KJ6A 1QYVA 1X7HA 1ZK1A 3BHJA 4I5EA 1EE2A 1A72A 4IM7A 1VE9A 1BMDA 2PD6A 2NVWA 2OFPA 1NWCA 3TRIA 1GQYA 2HJSA 3P5SA 4BO8A 2UYYA 3ANLA 1M66A 1WMAA 4FFRA 5ENDA 5BSEA 1R16A 3JQ9A 1PQUA 1PIWA 3QVWA 1A7AA 4UUPA 3FNHA 3I5MA 1C0KA 3VDQA 4B79A 1PQPA 4CV3A 1Q7CA 2Y93A 4NBRA 1HDXA 4BKQA 2QYSA 2QX7A 2O7QA 2HK9A 4YJGB 3WWYA 2XAAA 2D4AA 4OIMA 1E1KA 3E48A 5L4LA 4Q3DA 2DFVA 3GAFA 5EQDA 3PQEA 4IDFA 4LRSB 1QSGA 1I2CA 1H6DA 1XU9A 3JD4A 3M1LA 2CDCA 2VUSA 2E4AA 3E5RA 1N2SA 3WDSA 2RCYA 3BHIA 5DNAA 1XHLA 1ZZEA 2B35A 3IKVA 4ESOA 3RSHA 3T4XA 3F3SA 1EBUA 3BMOA 2C5EA 1P31A 2VZ8A 2Y1GA 5DBIA 5K6AC 4NG5A 5BNFA 1DB3A 1K5HA 4O0LA 1XELA 5CDYA 1JVSA 4F6CA 1TA4A 2Q1SA 4X54A 3QSGA 1P33A 3FPCA 1M6WA 1LA2A 4LRTB 1N7GA 2X6TA 4JNKA 3TSCA 1PJ3A 2BELA 2DTEA 5IXSA 1FDWA 2HMWA 2J3HA 4IMPA 4RCVA 1ZJZA 4R1UA 4DLBA 2QW8A 2QZZA 3TOXA 2PA3A 4BNNA 3H9EO 1YBAA 1M75A 2BF7A 2NM0A 7ADHA 3WBBA 5G4KB 1G1AA 4JROA 3WG9A 4JBGA 3WGYA 3ZHYA 2RHCA 4YR9A 4CL8A 2IODA 1GZ6A 4XR4A 2R00A 1NAHA 3GDOA 2VYNA 3HJAA 4Y8VA 1ZIDA 2B4QA 1B14A 1DLIA 2VYVA 3ZH2A 3WWZA 4BNFA 1A5ZA 3JQ8A 2ZKLA 1QYWA 3NT5A 3QHAA 3GN1A 3W4IA 3JYLA 1LDBA 2ZJ1A 3ABIA 3Q1LA 3GOHA 4IDEA 1Y9EA 4LCJA 1U2GA 5A3JA 5C5IA 2IYOA 2J5RA 3BMCB 4A7PA 3F1KA 3ZGYA 3G3EA 4DYDA 3D4NA 4M8SA 1YOVB 4QX6A 1J4AA 1RYEA 4RF4A 4QTZA 4CMIB 5LDHA 1ZSYA 1H2BA 3ZV6A 1QKIA 1D4FA 4AL4A 3PHIA 4WJZA 1LDYA 3HUDA 1XLTA 5AXDA 1I3MA 4RLHA 3JYNA 3AFMA 5DBFA 1BVUA 4UEKA 3MZ0A 4J91A 4IJUA 4J4HA 5AVOA 2ET6A 4UAGA 3HB4X 3DHNA 1BXGB 3AI2A 1WZEA 2EKQA 2PZMA 4XR9A 3ADOA 5CDGA 3IOYA 3QWHA 3JQBA 1H9AA 4DYVA 1B7GO 1LBEA 1PZEA 3FTPA 3PGXA 2C5AA 3WTBA 4RVSA 4ALLA 1I24A 3WQSB 3RC9A 1DAOA 2FP4A 4PG7A 3ROQA 9LDBA 3AOEC 3I9LA 3NT2A 4EUHA 3AJRA 3PVZA 3H6KA 5L95A 4IJWA 1X13A 2NUAA 3CZRA 1KY4A 2J6IA 3GUCA 2X9GA 3C7AA 3NDIA 2Y05A 4J0FA 2WWRA 1V3TA 4WCDA 1EVYA 4WPGA 1H6AA 3MJCA 1T1SA 4AJHA 3A28A 3PK0A 4CLXA 1CDOA 3GVHA 5AXBA 2CDBA 4HXYA 4LK3A 4PIVA 3V5NA 4RZHA 4OXNA 3X2FA 3WGIA 3OA0A 3NDJA 4CV1A 1DFIA 1EBFA 2CSUA 4PVDA 4BV8A 4GI2A 4ZGWA 1I36A 2C54A 4TSKA 3G17A 4J7XA 5MGBA 3OBBA 4ZVVA 2EERA 4E12A 1B2LA 4GL4A 1ISJA 2Q49A 3ZU5A 3WNQA 3ZU3A 1GY8A 5TSDA 5K6AA 1UDBA 3GVIA 4RVHA 4ND5A 1LDNA 1X1TA 3OIFA 2GO1A 4FFLA 3WICA 4OOFA 4CM9A 2O3QA 4CJXA 1HZZA 4UUOA 2GGSA 3WYBA 3ZN2A 4J49A 4W7IA 4OXYA 1U4OA 1AXEA 1E0DA 2E6UX 2Y1CA 5G4LA 1ZJYA 4XRRA 3UCXA 5CEFA 3OQBA 4BO2A 3FI9A 3OIGA 3ZWMA 4NDNE 4FIZA 4OYRA 2OMEA 4PRLA 4J6FA 4Q3NA 1NQAO 2DTDA 2IZ0A 5L7YA 4D45A 1LSOA 2W8ZA 2RAFA 2G17A 3WQRA 1JQBA 5L7TA 4PZDA 2I66A 2HUNA 4BL5A 1FDUA 4Q9NA 3ZWXA 4DQVA 1HKUA 3NTOA 1KVSA 4GLLA 1CERA 4CLOB 2QZ9A 1EE9A 3DZIA 3WGHA 1HL3A 4JXKA 5ILGA 1MG5A 5COBA 4IPTA 1RWBA 2JHGA 3NEPX 1T2CA 1ZW1A 1DBVO 3FCOA 3O9ZA 1GYPA 3FN4A 4A2CA 3D5QA 1XWFA 3ZNPA 4HV4A 4CQMB 1VKOA 2FSVA 3RUHA 2DUWA 2JCVA 4E2WA 4D41A 3VVBA 3OA2A 2DPHA 4D79A 1JTVA 4D43A 4LVUA 1QV7A 4XB2A 2AXQA 4B4VA 3HDHA 4QQRA 1QRRA 1KY5A 4XQEA 3AUUA 1NQOA 3CMCO 1YQDA 3ONEA 3GRPA 3I4CA 1Z45A 3LK7A 4L73A 4AJKA 1PGNA 1TVEA 1Q0HA 4U8GA 3DFZA 3VH2A 4YXFA 4Q3AA 4L4RA 1QV6A 4PLFA 4Z0PA 4PG4A 1PJCA 1YJQA 2C2YA 4E21A 5FI3A 5IZCA 3B1KA 4N7RA 2W4QA 4TMFA 3Q0EA 2NVUB 2FY8A 3OQ6A 4QFCA 1UDAA 2HQ1A 4I1IA 4DLAA 1VJTA 4U6QA 4R9RA 5HBRA 1UAYA 4CM4B 1VL6A 2ZB7A 2FPGA 4GX2A 2O2SA 1PWXA 1XDWA 3CH6A 1BWSA 1ZXLA 5DDIP 3DB2A 4OQYA 1B8VA 5F1OA 1AHHA 1JAYA 1LX6A 4DUPA 2Y67A 4Y67A 3WIDA 2CF6A 4XYLA 4JBHA 4MP8A 1YS4A 1K3TA 4D3DA 4DGSA 2E49A 2Y66A 4M49A 4BKRA 2BI7A 1E3IA 3F6YA 2Z5LA 3L6DA 3KYCB 4DXHA 4FCCA 1XQ1A 3TWOA 3JYOA 4NFSA 2YV1A 4WCFB 4RZIA 4UEOA 4BQPA 1P74A 1PGQA 4NMHA 4UUNA 1GQQA 1CWUA 1I8TA 1F12A 1OOEA 4HNHA 4AJLA 2HMVA 4IS2A 4LGVA 4YT4A 5T57A 3NTRA 3SC6A 3IDSA 4FJ0A 3RKUA 1KVRA 3NTQA 1OC2A 1NQTA 1EDOA 1HE2A 3EMKA 4IIUA 4Y6SA 5T64A 3S55A 1J49A 4ZQFA 3UAGA 5I7EA 5IAAA 4UVDA 1GPDG 3WJAA 4E6PA 1GYQA 3A06A 4ZQBA 1YL5A 5B4TA 1PGJA 2X8LA 1PJ2A 1BVRA 2Z1MA 4M55A 5KVQA 3ZWVA 3F4BA 2VRCA 3GK3A 4Z9FA 4BKPA 4N5MA 1HLDA 5BT9A 1NASA 3JQAB 1MB4A 2Q45A 3I9MA 4BS9A 1GPJA 1MLDA 1FDTA 3ZCXA 3K92A 2UDPA 2YFQA 3DMTA 1I01A 2PZJA 2NU6A 4CMKA 1IULA 2GERA 1E3EA 2J3KA 4RDHA 5DZSA 4PN3A 4S3MA 2BGLA 3GZNB 2Q99A 3ZNQA 2ZIZA 5B12A 2XOXA 3BMOB 1XQ6A 3DXFA 1KBZA 1O8CA 3C1TA 1ISFA 3I9JA 1NYTA 3INTA 3WR5A 2WYUA 2B69A 1T24A 1PU2A 3BHMA 2GPTA 3RD5A 4ALKA 4JQCA 1NXQA 2CVZA 1PL8A 3MJTA 2NU7A 1B3BA 4B3JA 4PZCA 3PIIA 3GEMA 4KDFA 1DAPA 1JWBB 1OMOA 1R37A 1E7SA 1FMCA 1X1EA 2BKAA 4CR6A 1EVJA 3WSWA 1PTJA 4PG5A 3UKOA 5GZ6A 1A9ZA 5MDHA 4BKUA 5F1KA 1EQUA 3EW7A 3DZFA 3WOHA 5KTKA 3KXDA 4ONEA 5DT9A 3HWRA 2LDXA 3ZW8A 3E8XA 2VHVA 3N58A 2P4HX 4MINA 3WFIA 1E77A 4BOYA 3MTGA 3DOJA 4PGFA 1SPXA 5JDCA 5BNIA 1GV0A 1VM6A 2YW9A 4K26A 5L4SA 4KTVE 3SEFA 4CUJA 3OQ1A 3ETEA 3GT0A 3WGZA 4YAGA 3TZKA 1Y9AA 1WDKA 1LQTA 1X7GA 3JD3A 4IY1A 2G0TA 5L53A 4UUMA 3I83A 4XZ3A 5JMPA 3GN2A 1U1IA 1FJHA 4EDFA 4NR0A 2EW2A 3X2EA 4BNJA 5I9MA 1DHTA 4LVCA 1GFSA 3MCVA 2ZCVA 5T6BA 1N5DA 1NX6A 2ZCUA 4M1QA 3GRKA 1I3NA 3MOGA 3GAZA 3GZ4A 4XKJA 4CM5A 2O48X 5IFLA 4CMGA 3KLMX 1MP0A 2PWZA 4K28A 5G0TA 1E3WA 4MKXA 1YJ8A 5L9AA 5A9SB 3P2YA 3KHUA 4EYEA 2VUTA 3DOOA 4O1MA 3VTZA 3F5QA 1EUDA 3H9QA 4FGSA 4TZKA 3O8QB 3VPFA 4J4TA 4CLHA 5I8WA 1LEHA 2FR1A 2PH3A 3AY7A 1AGNA 3RFVA 2YUTA 3DC2A 2WD7A 3NAQA 4UREA 5T8KA 4AFNA 4CQLA 5H81A 3I9NA 4R51A 4EUFA 4BNVA 1GDHA 1K6XA 4ND4A 2CD9A 4AJPA 4JK3A 5IXYA 4L4XA 3D3WA 3UFXA 4BVAA 3WX0A 4IXTA 3CE6A 1ENZA 5AOVA 3GY0A 2PKQO 4BO6A 1NFQA 1ZCJA 2PH5A 1PS0A 3D1LA 4XJTA 4YRBA 5TGDA 1R15A 1ISHA 4CLOA 3JCZA 3S8MA 2O3UA 5CDSA 3GZNA 1I3LA 5CAEA 3E1KA 3JYQA 4PVCA 3JQAA 1ONPA 5DF1A 2VTEA 4MVJI 3TZCA 3I3OA 5EINA 2EWMA 1FDSA 2D0IA 5TRTA 3PWSA 4FC7A 4OMUA 1Q1NA 1M6HA 3U4HA 3ZWYA 2JFFA 1HF3A 4DWVA 2PNFA 2WYVA 1GD1O 1CETA 3RU7A 2X5JO 1A27A 5JY1A 4E0BA 2YY7A 2QHXA 4B4OA 3PYMA 1R66A 3PIDA 2FN7A 3ASVA 3FBGA 1RJWA 4YTEA 4CV2A 2ZJ0A 3WGGA 4S1VA 1GZ4A 1PR3A 5HS6A 3TPCA 1B26A 3UCFA 5ER6A 4Y98A 4PLYA 4BV9A 2XPCA 4PLWA 1G6KA 4HP8A 4FJ2A 1GEGA 4XB1A 2HMTA 1FDVA 1BTOA 4U5QA 4LMRA 2OOSA 2JD0A 2FR8A 1EUCA 1BHSA 3FSRA 1ZK3A 1Q7GA 2GR9A 3JQ8B 3JQ6A 3K31A 1JU9A 1NNUA 2CY0A 2WMDA 3QWBA 2C7GA 4NH4A 2GLXA 3C7DB 1F14A 4EITA 5IN5A 2G76A 3JYPA 1Y81A 3LZ6A 3TL2A 3AU8A 1ULUA 2B36A 1DC5A 2H9IA 1MFPA 2Q50A 1WAMA 2WDZA 4OQZA 3AUTA 3RROA 5IF3A 4MVJE 2HRBA 2NWQA 2O3RA 4L9RA 1HRDA 5HM8A 1ORRA 2PGJA 1HTBA 3V1UA 4PLPA 5I8ZA 3VC7A 4MO2A 3ONFA 5G0VA 1SO8A 2EKLA 4I9HA 4MVJG 3NV9A 2YFHA 1KC3A 4LSMA 3RC2A 2VT3A 5ILOA 5HWSA 1VSVA 1E7WA 2H6EA 2R6JA 4C7KA 2P91A 5LDGA 2UAGA 4QFDA 1NHGA 1ID1A 3COSA 3NUGA 3C1OA 4ND1A 3I4FA 1LLDA 3Q9UA 1S6YA 4J1QA 3ZDFA 1SOVA 3OHSX 4NBVA 4DQXA 2EV9A 4Z6KA 3M2PA 3INGA 4M89A 4DMLA 4GKVA 4R3NA 3HNPA 4J3FA 3KOUA 1N1EA 1ZVMA 3G0OA 3ADPA 3D4OA 5JAZA 2GSDA 5JDIA 1GTMA 4BMNA 5JO0A 3DZGA 3DMTC 1KEVA 2HJRA 1PJTA 3H3JA 3KYDA 1E3LA 3TN7A 3DZHA 3H3FA 2FZWA 4GWKA 2EJWA 4RVUA 4CLRB 4YJHB 1DJNA 4RPHA 4YRDA 5U1PA 3LC2O 2SCUA 3EC7A 4YJFB 3HN7A 5K0ZA 4IS3A 4E2ZA 3QWIA 3AM4A 1I3KA 3GDFA 1BDBA 4FOOA 3QA9A 5A1TA 2GD1O 1SZJG 3KYDB 3JD0A 1VJ1A 2EKPA 4BO7A 3R0IA 4OH1A 4GVXA 3SX2A 2AG8A 4HADA 3Q2IA 2C07A 4R41A 1ZK0A 3WXBA 3DFUA 4ZU3A 3ZV5A 2IZZA 2X5OA 3UF0A 4FW8A 4A03A 3CKYA 3JD2A 2GZ1A 1C1XA 3NGLA 1P1FA 4YAKA 4KDEA 5KVSA 5IDQA 3NRCA 1ZNQO 3F4LA 1CEQA 1PS8A 3UOGA 3O03A 5DCWA 4Z9YA 1SEPA 3BMNA 3GPDG 3QJ5A 2BLLA 4B8ZA 3BTUA 2YZ7A 1N92A 1GUFA 4XQGA 4BB5A 4FD3A 3TZQA 3JQEA 3LF2A 4BO5A 4MVJF 3BTOA 1D7OA 2DVMA 2VHWA 5BSHA 3I6QA 4OO3A 4RV9A 1ZMOA 5CDTA 4CODB 1RM5A 1HLPA 3VPGA 3H9JA 3RC1A 1U3TA 1YVEI 1UZLA 2A94A 2OBYA 1P45A 2X4GA 1L7DA 4RPGA 1NP3A 4N54A 2B37A 1YGYA 4XYBA 4NIMA 1K2WA 3WGOA 3FBTA 3PQFA 2BI8A 5I7SA 3ZHXA 1J0XO 2GN6A 4E2YA 5F1PA 3STHA 3G49A 4FPXA 3DBHB 5HA5A 5TIIA 3EY4A 3ZI0A 1E3WB 5KOIA 4Z9XA 3VPXA 1UR5A 1UP7A 1Y7TA 1R0KA 5CG2A 3GG2A 2HMUA 2I3AA 2P9GA 4RO0A 4E31A 4JGBA 4D42A 1HZJA 3RASA 2A35A 2I9PA 4KUHA 1PEDA 2AQ8A 3VPSA 4D7AA 1Y8QA 2IDZA 3BXXA 4RQTA 4IINA 3ITDA 3HN2A 4IMRA 3JQDA 3L9WA 2VWGA 2C0CA 1ONOA 4FN4A 4LMPA 5CP8A 4AJIA 2D5CA 3WLFA 4BUCA 3GVPA 4WEQA 4YT8A 3KM0A 5C7LO 2Z1NA 5TJ9A 4AVYA 3Q11A 2X22A 3H65A 1DFGA 3KZVA 5BNTA 4NBWA 3WNVA 2DBZA 5FYDA 3UICA 6ADHA 3EUWA 3VKVA 2IYPA 2G1UA 2PTGA 4W7HA 3QQPA 2W2KB 1H93A 2G82A 3L6OO 2HDHA 3GHHA 3OEYA 3IP3A 8ADHA 4W4TA 3HB5X 4XYEA 1Y6JA 2FHSA 2C29D 1VSUA 3ZWOA 4FFPA 1ISMA 3UW3A 1JKFA 4ZQGA 2NQ8A 4NJMA 3VVCA 1SC6A 2P9EA 2Y68A 4YEDA 3MEQA 4IDDA 1QR6A 1T2DA 1Z7EA 4II3A 3K2BA 4IUYA 1U28A 5JC1A 5TS3A 2JAHA 3KTDA 3FR8A 1E6WA 1UAGA 2DBQA 4E33A 5JAMA 1DIBA 3ZV4A 1DLJA 4XWYA 4ALMA 3W8DA 1AXGA 3BA1A 2PLAA 4WLNA 5KCZA 2W2LA 5A3VA 3FF4A 1VC2A 3JQBC 5ENVA 3U4DA 1TEHA 3GGOA 2NVBA 1LRJA 1EK5A 1JLLA 2IRWA 4OXKA 2J5QA 3NDRA 3U4CA 4CM8A 3IUPA 4PLVA 3ST7A 3ZWCA 3VH1A 5IN4A 2RBEA 1SOWA 1KYQA 2X23A 4NFHA 3RFXA 4K6CA 4B7XA 4XQCA 1J6UA 3OETA 3EZLA 5LCXA 1LXCA 1XEAA 3Q9NA 3GNQA 1NAIA 4FGWA 2ZTUA 5ES3A 3DBLB 3WGTA 4XCVA 1IY8A 1MGOA 1R4NB 4NU6A 4DBZA 2P5YA 1A71A 1RM3A 2UVDA 3PLNA 3QLJA 1XGKA 2UUPA 4MIEA 1LSUA 3JQCA 1Z75A 2X1HA 4TVOA 3AW9A 2JHFA 3L0DA 3R3JA 2AG5A 2J3IA 4A0SA 4P4GA 4PLTA 1IPEA 2CZCA 3E6AA 3ZW9A 3S2FA 1I0ZA 3ZWNA 2YHIB 2E82A 2B83A 2GN4A 1SAYA 3DONA 1V3VA 2ZTMA 1UZMA 3DHEA 5GMOA 1E1NA 3GLQA 2D1YA 3AM3A 3FWZA 4JIGA 4L74A 3WS7A 2BGKA 3JQGA 3PDUA 3ZHZA 4OAQA 3ROKA 3AY6A 4BKOA 1LLCA 2Y1EA 4IDBA 4WKGA 5DCYA 4YRAA 2I6TA 3H5RA 4TVBA 1RM4A 3R3SA 4RQUA 1O94A 3P7MA 1ULSA 3LU1A 3ZWPA 3VHRA 1P1JA 1PZGA 5ICMA 3HDYA 2Y0CA 3E5MA 1QP8A 4OHUA 5DULA 3CSDA 3WSVA 5CPFA 4B3HA 3H5NA 3HHPA 4A26A 5A5FA 4P8RA 3W4KA 2C7VA 1E6UA 2GDZA 2Q1WA 4XYGA 1WNTA 1ZKMA 5FI5A 1ZK4A 2EXXA 2J8ZA 3SJUA 1JA9A 2VNAA 2YV3A 4GX5A 2IEDA 1HWYA 1BDMA 2WJPA 1SMKA 2FSSA 4FS3A 3VH4A 1KEUA 5AYVA 3O4RA 3PZBA 5KVVA 4IJVA 3L4SO 2CDAA 3SLGA 1V35A 1E1MA 1R0LA 1YKFA 4Q3CA 3TL3A 2EHDA 4L0QA 1P1RA 4II2A 3GF4A 3EAGA 4LN1A 1E7RA 3K6JA 4QXMA 3B20A 3GDGA 3VTFA 1E7YA 1WZIA 1GL3A 1NBOA 1JWAB 2C82A 4ZA2A 4BGEA 3KETA 1JDJA 4R5HA 1Y5MA 3U62A 2HSDA 2WM3A 2Y0EA 3RBXA 1C0IA 1W6UA 2X0IA 1ISIA 3L07A 2P2SA 1C1XB 1X0VA 1M67A 1HDRA 2PD4A 3AFNA 1EVIA 5EJ2A 3E18A 2QQ5A 4EW6A 2AE1A 2PZLA 3NX4A 2WSBA 3CTMA 4TWRA 5B1YA 5JMWA 4OKNA 1K6JA 1O89A 4WLUA 4CMIA 2IE0A 2VHYA 2VWQA 3PJDA 3BTVA 4E3ZA 1KERA 3EVNA 4BIIA 3E9MA 3WGQA 1Z82A 4W6ZA 4M86A 1UP4A 4XRGA 2AQIA 2PGDA 3D3WB 5U4QA 2WTBA 1YB4A 2WE7A 5IDYA 2YQ4A 1XSEA 5THKA 4HFMA 2ILTA 1B8UA 4ALJA 3GGGA 3VAZA 4J1SA 1YBMA 2W90A 1PJSA 2OUIA 1LI4A 1DIAA 2DAPA 4IGEA 1WPQA 3GH3A 1EK6A 3JQ7A 4I5GA 1ZFNA 3GMDA 4YJHA 2UUOA 4WEOA 2FRDA 5DP2A 1LDEA 5TJHA 5DN9A 4KUEA 1W4ZA 3WJ7A 3ZNOA 1QYDA 3H7AA 1F06A 1FXSA 4GVLA 4BNGA 3Q2KA 4KWIA 5BSFA 4DL9A 1DC6A 2Z95A 2P4QA 3IC5A 4IZHA 2POQX 4Z3DA 3D4PA 3RUEA 1ML3A 3RCBA 1A4UA 1VLLA 4BO9A 3MJVA 3M6IA 3RBZA 5A03A 3DZBA 4OOEA 4CM9D 1U3VA 3GC6A 3OJOA 3ZNNA 3HDQA 2C20A 4CMBA 2DKNA 5CEJA 4CMEC 1NVTA 3H4VA 3M1AA 1GCUA 4TRMA 1E6EA 3IP1A 3OJEA 3Q6IA 1U4SA 3PWKA 4INAA 3E9QA 1X15A 3RU9A 3U4IA 2GASA 3PPIA 4E5NA 4EEXA 4CLRA 5KJFA 4TKMA 1C3VA 1YOVA 5EMHA 1E5QA 3WTCA 4EJ0A 4QUKA 5F3RA 4YAEA 5JAIA 4NZ9A 5JXWA 2AMFA 1QORA 1CYDA 1MG0A 3U49A 1DPGA 1DIGA 5JAQA 1BRMA 1VPDA 4N18A 5A9SA 5A4DA 4BMSA 1NHWA 5L40A 1CRWG 2IXAA 4WOJA 4YYZA 1DJQA 4JP3A 2YQ5A 1WWKA 3FNFA 5JO9A 3BZUA 2ZK7A 3WQQA 1UXJA 2GRAA 4QEDA 3SC4A 3UN1A 4FJ1A 1HYHA 3KEOA 4RGBA 3U3XA 5JC8A 3G1UA 3RUFA 2CVOA 2Y99A 5TLSA 2JCYA 1Q0LA 3SXPA 1YQXA 3T7CA 1IZ9A 1YE3A 3VDRA 2E48A 1QG6A 2NV6A 4NJOA 2O4CA 1R4NA 3CZMA 5JDCC 1DFHA 1Y8RB 2GN9A 4ZD6A 4O59O 4MVJM 4JLWA 5U9CA 1T1RA 4TRRA 5JCJD 3NKLA 1K6IA 1U8XX 2RHRA 4N5LA 2WEKA 1NTOA 4RVFA 2F00A 1IL0A 4TZTA 2TMGA 2YDYA 4MDHA 1LSSA 2FPIA 5KJCA 1O95A 4YPOA 1MUUA 3ROMA 2DQ4A 4R4JA 1ENOA 4FFMA 1RPNA 1O6ZA 4OJNA 4ZHSA 1NQ5A 5C7OO 1SNYA 3V2GA 4CM3A 4BO3A 2NADA 3EK2A 4R1TA 2PK3A 1M2WA 2G5CA 3PGJA 2B4TO 3AK4A 3PFFA 4NI5A 5JYDA 2X7HA 2Q4EA 3LC1O 4G81A 4Z3KA 3S1LA 3QE3A 3HSKA 2B0JA 2HU2A 1ZMTA 1VL8A 2VRCD 1EVZA 2VWHA 2DFDA 1Y1PA 1KVTA 5G4KA 4AJ4A 1J5PA 1HT0A 5C3MA 5IJZA 3QY9A 2DUUA 1W73A 5JPIA 2C2XA 3RJ5A 3VZPA 1DSSG 3G1TA 3OICA 4H15A 4MPDA 1B16A 3C85A 4NU5A 4B7CA 4FR5A 2Q46A 1V9LA 1Y8RA 4CL3A 1HYGA 1LJ8A 2FWMX 3PHGA 3PYXA 2ZYAA 3OF2A 3DBVO 2PGLA 1HDYA 3ANNA 3QRWA 5I9NA 5C7IO 1VKNA 4KMSA 1IHYA 3DAGA 1PGOA 3W8EA 3FRJA 1HSZA 1T26A 3O26A 4YACA 1U3UA 3BIOA 1H94A 3S2EA 4IDAA 3VH3A 2HKIA 1BGVA 2A92A 5B4VA 5KJEA 4NJMB 1YBVA 1BXZA 2I65A 5T8KC 1WW8A 2XXBA 4D44A 4KP7A 4DLLA 1CF2O 4JN6B 1PS9A 1X0XA 3A4VA 3PWZA 4K9DA 1LLUA 2X0NA 4UULA 4O6VA 3IL2A 3P2OA 4HFJA 3D7LA 4GBJA 3PXXA 4MOWA 3NYWA 2JD1A 5DOVA 4BNHA 1ENYA 4ZJUA 1HETA 2AEJA 3GFGA 2J5KA 3PP8A 4A10A 1UXKA 1TI7A 2V7PA 4M54A 3DDNA 4WECA 1KS9A 2IEBA 1ISGA 1GUZA 1MC5A 4BNWA 4GKBA 1HSOA 3L9XA 4K1LA 2QG4A 5KWEA 4WNIA 4U6SA 4ZQEA 4B4UA 3OP4A 4EEZA 1D3AA 4I08A 1WXDA 4KQXA 1ZH8A 3ON5A 3DHYA 1O9BA 2BFPA 2OP0A 2EP5A 3QP9A 4OSOA 3AU9A 4CV0A 1GR0A 3OFSA 5A02A 4WE3A 4FB5A 4ND2A 5HS4A 5JW6A 1HDCA 2VQ3A 3MJEA 4CLEA 4PLCA 4RF5A 1XYGA 2V6BA 1UXIA 2JKVA 5DCUA 3UVEA 4RORA 4BNMA 3ZWWA 1P3DA 3JTMA 1EMDA 2OHXA 4RJTA 3PHLA 5DP1A 1KEPA 2O3JA 3E9NA 4RDIA 1ADBA 1L7EA 2HCTA 1B0AA 3PLRA 3KYBA 3WIEA 3DBHA 4CM6A 4MVJP 4MKRA 2BH9A 2EP7A 3K96A 3F5SA 4E13A 1RM0A 3F9IA 3BMQA 3GEGA 3M2TA 1N9GA 3TOZA 2PV7A 4WK6A 1T4DA 2UV8A 3HE3A 1Q2XA 1HE5A 2X0RA 4J0EA 3HG7A 1YO6A 2O3SA 4PG8A 3E03A 5BR7A 1YL7A 1ADFA 3ZU2A 3KRTA 1JAXA 3FTNA 4BNUA 4XYMA 4CUKA 5JCXA 1T2FA 5ITVA 2OL4A 3S2IA 2WD7B 4A5OA 1CQJA 4DC0A 3H2ZA 1NR1A 4AJ2A 4D3FA 1U7TA 1YXMA 4NBUA 2X9VA 2D5AA 5A06A 1V3UA 3C1AA 1TT5B 3MOIA 3MTJA 4RVDA 5K9ZA 2EGGA 1KIFA 3L4BA 3RUDA 2ZB3A 3RUAA 4XA8A 5TT0A 3HQ4O 3HFSA 1EZ4A 2VOEA 3H5AA 4HUJA 4EGFA 5THQA 3PJEA 3DTYA 1ZK2A 3DAPA 2DPGA 4I5DA 9LDTA 1SB9A 2QRLA 4LCEA 4KZPA 4GSLA 2F1KA 3Q3CA 2GUGA 4L8VA 1ZEJA 5J23A 4J9VA 5H82A 3RVDA 2QRKA 4HFNA 4MKZA 1QLHA 4NHEA 2NU8A 3CINA 4BNLA 1KEWA 2HRZA 1XCBA 1HEUA 2AE2A 3UXYA 1HE4A 2AA3A 3IJPA 3D3EA 3DBRB 4NNJA 1I32A 5IDXA 4M87A 4WLEA 2ZQZA 1O5IA 1T25A 1Y5RA 2TMDA 3U0BA 4GPD1 5G0WA 2GF2A 5COAA 2DLDA 4ZN6A 5JYEA 1AE1A 1IB6A 1KVQA 4GX1A 4Y6RA 1OC4A 4FFNA 3N7UA 1LDGA 4E30A 1H6BA 2Y1OA 4EI2A 1IPFA 1JN0A 2O3TA 4DRYA 3SJ7A 1GU7A 3A14A 1DHRA 4D46A 1LQUA 3TNLA 1D1SA 3KVOA 2PKQP 2VHXA 4GMGA 4RPLA 1F17A 3DZKA 1AN9A 3EYWA 4KTTE 4CPDA 3V2HA 2O50A 3C7CB 4GQAA 2X0JA 4CM7A 4DA9A 5CFZA 4OSPA 1GZ3A 4BNYA 4Q3EA 4L75A 3KEQA 3DMYA 3UHAA 3KSUA 3DL2A 5A9RA 5CHEA 1EUZA 1QYCA 1W0CA 1YRLA 4E5YA 3WMWA 4GWGA 4GGOA 2D8AA 2RIRA 5JSFA 4QSMA 4K6FA 1P44A 1S7CA 1V6AA 4AJOA 2I99A 1N8KA 5HRUA 3IIEA 2Y0DA 2Q1TA 2AEMA 3JQ9C 4L4SA 1G0NA 1K89A 1I5RA 3RIHA 1XU7A 1Q7BA 1HYEA 1NPTO 1OI7A 3AI3A 4BO4A 1I10A 3FD8A 3JQAD 4BNZA 3LLVA 4GGPA 4TROA 4YDRA 1H5QA 1TLTA 4R16A 5FWNA 5EN4A 4YBZA 2YV2A 1HDZA 1ENPA 3SBOA 4UVIA 3WLEA 3B1FA 3ASUA 4ZRNA 4CR7A 3KSZO 5TNXA 1E92A 1Z74A 1AUPA 4Y6PA 4URFA 4PCVA 4YAJA 4CUZA 3GR6A 5CDUA 4JCOA 1VRWA 4R1SA 1LUAA 3I23A 3IAHA 3OECA 2DT5A 2NTJA 2Q2WA 2VRBA 4BGUA 1DDOA 4DREA 3WMXA 3PJFA 2H63A 3NJ8A 5JCJA 1NFFA 1BSVA 1XA0A 3RI3A 4DBVO 4LSWA 3AOGA 1U5AA 1C1DB 2A9FA 1IUKA 1QLJA 2CVQA 1UXGA 4B8WA 3IS3A 2O2YA 1ADCA 6LDHA 3HADA 4J7CA 3RUIA 1H0KA 4PFJA 3W8FA 4CMEA 3HZZA 3JSAA 4O5OA 1UJMA 2O7SA 3I1JA 3LT2A 4G2NA 2VCYA 3FNEA 4I5FA 2VWPA 5HTOA 1EDZA 1PQWA 1YWGO 4OKIA 3W6UA 1MXHA 3LSYA 3FR7A 1DIHA 5JY6A 2DTXA 1N1GA 4JX8A 4FSHA 2GNAA 3AWDA 4ZRMA 1TT7A 4MP6A 2Q2VA 2WE8A 3P19A 1HDOA 2VZ0A 1PL6A 1LTHR 4EZBA 1YL6A 4NK5A 3C3XA 1R4MB 3DTTA 5B37A 4BO0A 3LT1A 2Q3EA 4YQYA 2NTVA 2ZQYA 3QVXA 2I5PO 4XGNA 4L76A 2H1SA 4F45A 4AJ1A 1V8BA 3UH1A 3B70A 5CG1A 1PX0A 3GFBA 3PHHA 1E1LA 2O4UX 2HO5A 3KO8A 5EQFA 2RH8A 3A1NA 1D8AA 5AXAA 4CMJA 1PWZA 3TQHA 3GVCA 4G65A 4DPLA 4NFYA 1KC1A 5TC4A 5JE8A 3UUWA 4RF3A 4YJDA 1UXHA 1I33A 3AUAA 4GAEA 5G2OA 3RJ9A 5JBIA 2OGUA 2VUUA 1GEEA 1GYRA 4D0RA 1LRLA 3K9QO 5A9TA 3IQDB 3ICPA 3JV7A 2IXBA 2VHZA 2YJZA 2AQHA 5KNLA 3TZHA 1BXKA 4CQMD 3ITKA 1C0PA 1E3SA 4R54A 3VKUA 3RQSA 4MVJH 4MIYA 1T2EA 4EJMA 3LF1A 3BMNB 1ZXBA 1IOLA 3H9UA 3FNGA 4UVEA 3NGXA 3OEWA 1JW9B 1B8PA 4NK4A 2PD3A 1DIRA 3MWEB 1XG5A 2QRJA 3TF5A 2AQKA 3ETGA 4W9NA 2X86A 2DM6A 3PYLA 4CLDA 1T2AA 2ZYDA 4G5HA 4IJKA 3WYEA 5JNLA 5KKCA 1LSJA 5IDWA 4R5MA 1YQGA 1C0LA 1LDMA 4R68A 4XGIA 5L7WA 3G79A 3JQ7B 2FR0A 3TDKA 5BSGA 4WLVA 1MX3A 4AJJA 4P4NA 4IQ0A 3CEAA 3GUYA 1P0CA 3TZ6A 8LDHA 4J1NA 3ICCA 3HFGA 3JQFA 1PJQA 3PJGA 4RPJA 3OJFA 1Z73A 4XIYA 1PL7A 1RKXA 1ONNA 3N74A 5TT1A 1NWHA 4B7UA 3ZWBA 2Y1DA 1BW9B 4B3IA 4BHTA 3QVOA 3L77A 1IE3A 3AUSA 4JJGA 2HK8A 1GV1A 4F6LA 4BB6A 3K8ZA 2OBNA 5KJ1A 2GCGA 2Q2QA 2AHRA 1V0JA 2O23A 2VN8A 5JDIC 2Q4BA 2PY6A 3MJ4A 2FPPA 3K2EA 3RKRA 1UH5A 1WP4A 3GVXA 3OH8A 4WUVA 5EL0A 4DQUA 3KV3O 3PDJA 3IUSA 2P9CA 2HK7A 1H6CA 4DIBA 1NVMB 3PFWO 2V6GA 4JJIA 4CM1A 2BMAA 1ZUD1 5FF9A 5CEEA 2BGMA 4IZIA 4PLZA 2DU8A 4E5MA 2I76A 2JAPA 3ULKA 1R12A 4FFOA 4DVJA 4C7JA 2WD8A 2NACA 3V1TC 1IHXA 3L6EA 3CPSA 3EGOA 4FDAA 5B4UA 1A9YA 1GAEO 2JCXA 1DRUA 5DOZA 4XX0A 2ZTLA 1EFLA 2ZATA 4J7UA 3GNSA 3DQPA 3LLSA 4HKTA 1BG6A 1G0OA 1DOHA 1E7MA 4TRNA 3FWNA 1GADO 3DBLA 3S2GA 2XF8A 1PSDA 2J3JA 3KSDO 5DBGA 2EIHA 3LT0A 4YT5A 3D0OA 5A05A 3GMSA 3I9KA 3QW2A 4E4YA 1NM5A 2VT2A 3W4JA 1NPYA 3PEFA 2BHLA 4D0SA 5GZ3A 3KLPX 2R2GA 1XR3A 4J4BA 4J90A 1JKJA 4UEJA 2BFOA 1LLQA 1P77A 1YDEA 2AW5A 2QIOA 1T4BA 1C1DA 1SBYA 3JQGB 1PZFA 1PJBA 1MA0A 1Z7BA 2EGHA 2NU9A 3BAZA 3DEYX 2OXIA 4DC1A 1H2HA 3D64A 1MC4A 2V65A 1LC0A 4J1TA 1I30A 1B3RA 1WDMA 4F3YA 3UCEA 4PRKA 3QWFA 2BRUA 4B4WA 3ZWAA 1OZAA 5CPBA 1AHIA 1NFRA 2GZ2A 1MXFA 3WBFA 4XJSA 4YCAA 2FZEA 3RC7A 3LYLA 3F47A 5I9LA 2BD0A 2EW8A 2R00C 1ZEMA 4CR8A 2JL1A 4OL9A 4IXWA 5T67A 3VOSA 5G0UA 7MDHA 5F5LA 2VYVD 3GA0A 4UVHA 3L4BC 5I7FA 5TX7A 3DAFA 4JBIA 4MP3A 2Y1FA 4ILKA 1MV8A 4IIVA 2V6FA 1OFGA 3IKTA 1PR9A 4GH5A 4FC6A 1EQ2A 4W82A 1UUFA 3QWAA 1X7DA 2GYYA
chains in the Genus database with same CATH superfamily
1BMFD 4ZEWA 3CNOA 2QRVA 3JD1A 2FOLA 2ZWVA 3M34A 4LTNA 5DU2A 4I4TA 3DEIA 3WL5A 1GGKA 1H2ZA 3LFTA 1CUFA 2NP6A 1CB0A 3KTFA 3N2IA 1YR3A 4N47A 5LMUB 1QZUA 1R9JA 4ZPJA 1NXXA 1KAHA 3VDNB 4FLMA 4UFNA 3K70B 3R75A 2OD7A 4HFRA 2QRPA 5CT4A 1FNCA 1XZLA 4LDZA 2VZ9A 3BSSA 4C01A 4HDSA 3UA4A 2ZBPA 5BSVA 3RSFA 2QSYA 4HAYA 1ORHA 3DZJA 3EJ6A 4XD7A 1PV4A 3QLVA 1XPRA 2B8TA 4E32A 4ETNA 2VDPB 4WK4B 4X6XA 5T4HA 4A8TA 3HKCB 5TE9A 2H9YA 3O75A 4M0EA 2I0FA 2GZ3A 4EF5A 1TEZA 3LDHA 3HYLA 1XTSA 4MMXB 5DGDA 3ZE9A 1AKQA 4ARVA 3MCWA 1V8DA 4ZEVA 4MAAA 1TFRA 2R8BA 3ITEA 5L3ZA 3QXSA 2PVCA 1NR5A 2Z5VA 1ECGA 1EP2B 1T1JA 2IVFA 3IO3A 4J0DA 4NS4A 4RLSA 2NO9A 3JQRA 4TN5A 4ZCMA 3FPJA 2AG6A 1R5BA 5KKAA 1L3IA 4PHFA 4QARA 3UANA 2VJAA 2PT9A 5FAXA 4GE0A 2A5LA 4IQGA 1Q95A 5CH8A 1IPHA 1UP6A 4P4LA 4C21A 1QAOA 2BEWA 3O9MA 2YHIA 5H9VA 4XWTA 4TTTS 5FUYA 3K9CA 3OVMA 4HLCA 1QVVA 4B3GA 4RD4A 3ZQ6A 3IUNA 4F46A 2IEZA 1WO8A 2I3GA 3OJ0A 3GG9A 4OGKA 3RTEA 3T99A 1XCOA 5D3MB 1ZCBA 1A9XB 1SB8A 5DNWA 1E1DA 3LP5A 3ZE6A 2PMBA 4JI0B 2ZSBA 1HDGO 1YVRA 2CJPA 2EFYA 1DV1A 1WLYA 3SLKA 3ESQA 4BJ1A 3DO5A 2GWRA 3DV0A 5EWJB 4MW7A 5ITWA 3H11A 1JEYB 5IH3A 1JDTA 1ULTA 4YJ3F 3OPYI 3MJSA 4UTOA 1R6DA 1T3SA 4J2HA 3WZMA 1DQYA 3AEUB 3KG2A 3FOFC 3OD5A 2P3QA 1Y1LA 2WJ4A 4FQ8A 4HGRA 2RGUA 3GGPA 4G09A 4NQZA 4N5NA 2W9XA 4D26A 2IKSA 4R2HA 3RS3A 4UTPA 3UGKA 2NSJA 5IHXA 3ZZNA 1Q1QA 1NE7A 4K9SA 3QI7A 3S40A 1F8UA 2AXPA 4ENRA 2JI7A 2FVXA 2X9NA 3AUKA 3JAWA 3NKFA 5JFOA 3ZI4A 2ZE7A 2J9RA 4AC9A 3VR2A 3I6BA 4R83A 1SC4A 3EQ6A 1DRJA 1LJUA 3CURA 3Q6NA 5DSZA 3V2UA 4KR9A 3G2PA 5IT0A 3O3CA 1WVGA 3CUKA 3RM3A 4EHBA 1D4OA 2DBYA 3CUVA 2IHZA 2GD6A 2UXDB 5JLAA 3D8HA 3ZZ0A 3GOQA 1EXNA 2G09A 1WU8A 2RGWA 4NJEA 1VJ0A 1V1RA 4PLHA 2EF1A 4MQEA 3WA6A 2FPIB 2R97A 3EG9B 3IAXA 4MUHA 5EE1A 1Q0TA 1C9YA 2AS0A 2RHBA 4WCFA 1U2EA 2DYKA 1DG9A 2PBRA 2QZPA 2WF6A 1YONA 3F2IA 4P22A 5H8WA 2PYDA 4ZMBA 3A6DA 1XCLA 2GO7A 3I9OA 3SXUB 3LI2A 1N9GB 3W1WA 1VBNA 1JQLB 1CQIA 5CNIA 1THTA 2CUKA 1R9GA 2ENUA 2F90A 1XLWA 3OUUA 1T9KA 4UBKA 3CIFA 1JG6A 3BREA 3GLSA 1ODSA 4BZWA 1QE3A 3IRUA 1E58A 4NPCA 4P38A 4E08A 3R3ZA 4F56A 1T4GA 5GZ1A 2EBWA 1KZ7B 3IQGX 4LJYA 1ARZA 3DBRA 4ZVLA 1APBA 1CIVA 2P2DA 1BX0A 1NZJA 3DFKA 4G1EB 1G3RA 4RJKA 3ZUPA 3ELBA 1QYXA 3GA7A 4DJDC 2H5LA 5ICSA 3M6LA 5K05A 1XVLA 3VR5H 5FO0A 2VHQA 3LFHA 2C9BA 1RXSA 1R7RA 3W9YA 2QMUA 3M4ZA 1XKXA 1WF6A 4XD2A 4CEJA 3ORFA 4KODA 5I9BA 3T3PB 4M22A 3JQFC 3W6ZA 4EGSA 5F2EA 1RP7A 4KW7A 4DS3A 1DKQA 1Q3HA 3ZXXA 1D2GA 3D5TA 3T5BA 1Q1ZA 1QIDA 4D74A 3SIWA 1VPTA 4WLOA 3AOEA 2W98A 2PFGA 2YWHA 3U4AA 2YHUA 2V0GA 1TUEA 2E87A 2XWJI 4M1EA 2JJYA 4F1WA 4OGWA 1JVBA 3FGOA 4RYDA 1G59A 2UU9B 3I52A 4KQIA 3T54A 4YWHA 1WXQA 5TQVA 1ZD8A 1SCUA 2VJDA 4XQ9A 4DADA 1EWTA 2J41A 1B0PA 2YZMA 1TTQB 3CW8X 4HOYA 4HTAA 4BMZA 3E53A 3PPYA 5ALTA 3CMMA 4BGIA 4R3WA 3HUTA 5EPOA 4BATA 1RRVA 2D62A 3AKZA 3SGLA 3T5GA 1DWUA 3EARA 4TRJA 1EK1A 4GRDA 3F97A 4GM4A 5DYGA 3DOCA 3EXAA 2PUEA 4U0KA 1ZSNA 3ONDA 2UZIR 4B40A 4CE6A 3NB0A 4ZZ3A 4EPYA 3PCRB 4LZOA 4Y6OA 4O63O 4A4DA 2BCGY 3CLHA 4C4ZA 4V1CB 2OCDA 4IV5A 4JYBA 4JXJA 3EQ7A 2HA0A 1AK1A 1PV1A 3Q10A 2N75A 4XM0A 3T4EA 1JIIA 2B2NA 2GNOA 2L42A 3ISJA 4DA8A 4N0EA 4QVGA 2PFSA 2QE6A 4OYLA 4FYMA 1GQ2A 2IX9A 2WD9A 3A6EA 4DA6A 2ZBGA 1A76A 5ALEA 3ZY5A 4OIFA 4D3SA 1U5BA 5CVDA 1AKMA 1GGJA 4H3KB 1P4SA 4JELA 1ICEA 1C7RA 4OI4A 3BE8A 1ZSVA 1BFUA 1N6HA 1Z4PX 2CXXA 2SBTA 3FJ1A 1PRYA 3IUEA 3MTBA 4HN2A 1DU4A 4M9RA 3VR6H 5I7VA 2DWOA 3BE6A 3TIFA 4YA6A 2PX3A 1U80A 2REQB 2V59A 4JVMA 1A7KA 3DKRA 2M98A 3PGA1 2VA9A 4WZBA 2QYTA 3RAJA 5KTNA 5FIUA 4BNKA 2OZPA 2EJVA 3U17A 4DCUA 2IU4A 3A3OA 5AI0A 5JRZA 1JHMA 3I8SA 3QIVA 1ZHFA 2DOKA 5L51A 3DS8A 2Z83A 6CHYA 3SFZA 4YJ2F 3O31A 3MOSA 5CVCA 1XA3A 3CZ4A 3AHDA 1ZH4A 2ZRQA 4ZQHA 4AJNA 2G06A 3ZU4A 2AX4A 4NMXB 5JHGB 3G7SA 3JU3A 4F6RB 4DJEC 1AZTA 3W6PA 4Z0HO 3T5CA 4YUYA 3I0ZA 2C2ZA 4IZOA 4CQMA 5BVGA 2CT8A 3P9IA 4EB6A 4Q19A 2XE7A 4EATA 3EMDA 4HX5A 5ETJA 3LYAA 2O2JA 1PBTA 1TL7C 2ZYTX 4LHWA 3NT4A 3PEEA 4WGGA 3D6JA 4ASUD 1XK7A 4BV2A 2FOIA 4KYVA 1FBNA 4XWGA 1TZBA 3NR2A 1G5IA 3OEHD 3WK6A 1A4RA 3H9BA 3WY9A 4CMHA 4ZKDA 1AY0A 2FN4A 1QKKA 2AGVA 2YWEA 4FWIB 5L45A 1DL5A 4B6PA 4D98A 5KOJA 1QR2A 4MJLA 4YMSA 4A2QA 2QLJA 2PKXA 4JLAA 5AW0A 3UW1A 3CX3A 5LYJF 4H7PA 1M1NB 1EVLA 1ZONA 3K5WA 3D7MA 3AONB 3GUHA 1RYYA 1Z6ZA 2GT1A 3IUBA 4C22A 5JU6A 1ZO8A 1QRTA 5BSTA 5F3DA 1ZGCA 4N8SA 421PA 4AQDA 4Z3OA 1UC8A 4WT7A 1G64A 3ZVLA 4WOBA 3FHLA 5ADHA 1SCJA 2AJ8A 4E03A 3EXHC 1GZSA 4LX0A 5A2GA 3AR2A 5DWDA 3QYPA 2X15A 4UMVA 1LKZA 3R5FA 5HP4A 1TT5A 1EKXA 2JI8A 3QEMB 1R4MA 1QGED 4MPPA 4G5SA 3A1FA 1IZ0A 1Y7PA 2QF7A 3HBLA 3MT7A 2VLBA 4LVOA 2YYYA 1GNSA 3SJCA 1CV2A 1TC2A 1CR6A 3NP9A 5CB4F 5KNCH 4ROSA 5AW9A 2H2IA 1KYXA 4ATNA 3KR0A 5C37A 4MCHA 4WBSA 2W48A 4BQRA 1EGVB 1M2FA 5IAKA 3DD1A 5ERXA 5DGTA 5KYWA 3GPIA 1MFZA 3RODA 4HDMA 1YB2A 3PHJA 1QHEA 3RR2A 3WISA 4BJ6A 2WINI 1WSWA 3VYUB 4IM7A 4IUDS 2BPOA 1E94E 2PD6A 3MCUA 4UFPA 3IUQA 3E3AA 2OFPA 3I28A 3TRIA 3RYFA 4AZ0A 1D4ZA 1AA9A 4CIVA 1B23P 3D02A 2UYYA 2F67A 3HY6A 3NBYC 4M0PA 4KCGA 1W46A 3LE8A 1R16A 4JZKA 5F33A 2O5CA 1GL6A 1PIWA 1RRGA 1AS2A 1II9A 2EKZA 2B20A 4B79A 1NNSA 3QYFA 3C3EA 3DE0X 1SVIA 3EGIA 4NCHA 4NC9A 4AMYA 4CV3A 4BRSA 2WF5A 1XLTC 2O7QA 3GRRA 4AS1A 3HLTA 4WBNB 1MT3A 4YJGB 1Q7RA 4C0KA 2D4AA 4O4IB 4OM7A 5ED4A 4RUKA 5AWFC 2DFVA 3OSZA 5P8WA 2FDCA 3GUZA 2ABWA 3SVZA 1I2CA 3OAAA 4C1BA 3TTUA 3CF6R 3JD4A 1RC1A 3GP8A 1YU9A 1AMOA 1N6OA 2QTVA 3QLUA 2E4AA 3E5RA 1N2SA 3Q85A 2LGJA 4QXRA 3T7IA 3WDSA 3OM1A 5LN1A 2C5FA 5LKAA 5HIIA 4L16A 3IKVA 3A05A 5JVDF 1VZ2A 5JZSA 3NWJA 3LKDA 1EBUA 2YXNA 2ZIAA 5ALHA 1H3NA 4LRYA 5CNKA 2XCLA 1Q6ZA 4I4TF 1VMIA 3AV0B 4YDHB 5DBIA 3UMBA 4OQEA 1POWA 1CUYA 1UK8A 3FDXA 4A1OA 5K6AC 5AI6A 5IEJA 2M1XA 5BYJA 3NNSA 3SK0A 4HQ0A 5CDYA 5KJFA 2AC2A 2NU6B 1H2EA 1JVSA 3AESA 3NTLA 4H31A 1IXRC 3F9CA 4O4HB 3FPCA 1U8AA 1M6WA 3WRXC 1VKZA 3NC4A 2NZYA 4NNPA 1LI5A 1UDWA 5HXAA 3EXFB 2BELA 1ZY2A 1FDWA 2PA0A 4IMPA 2M32A 2QM3A 4HAXA 2JEZA 2H4YA 2AYYA 2PMDA 2R86A 4IFIA 5KMGB 3SU8A 2EQ5A 4OMCA 3S1AA 2WQZA 5JRDS 3T1QA 3VO8A 1Z2EA 3WGYA 5CT6A 1O08A 3ZHYA 5DGXA 1IWBB 3WK9A 3KCNA 4YR9A 3U4QB 3R3YA 5EP1A 2X4LA 1Z5UA 3GU3A 4NU0A 2Q0XA 3AHCA 2R00A 4IXMA 4XR4A 2QJTA 3N0XA 5BRAA 1WCIA 4I6GA 5EMNA 1KMCA 3JAKB 4BJHB 4EA8A 2MYUA 1XC7A 2OVFA 4Y8VA 5EJAA 4NMLA 4ZT5A 2B4QA 2JA2A 1B14A 3O8LA 2VYVA 3WWZA 1ATZA 1I7DA 4MLCA 4ED9A 3JQ8A 1QYWA 1TU3A 4BZZA 4G4SP 4P1ZA 2PAAA 1G8FA 1NW4A 3QHAA 4KAJA 3W4IA 1IZYA 1XQ9A 4IDEA 1LDBA 4X3PA 4AZWA 1I4WA 3GOHA 4KNYA 2LW7A 3K9NA 3SZLA 3U13A 1NLYA 4A5SA 4G8BA 1XEWX 1P4RA 3KQPA 2C2KA 4GZLA 4A7PA 3ZD7A 3F1KA 3ZGYA 1NF9A 3FA2A 3PB3A 3D4NA 4H0FA 4OQNA 1MRZA 1KI2A 4IHJB 2PSFA 4M8SA 4QX6A 2GK4A 3WVNA 1J4AA 2VPQA 3M5DA 4NZYA 4PNHA 4RF4A 2AJBA 4GOLD 3QBEA 4DNOA 1H2BA 4AL4A 3PHIA 4WJZA 1DEOA 1KBQA 3HUDA 2AZ4A 1JB9A 5E2AA 2IW3A 1KO8A 2XYPA 1JHYA 1I3MA 2DQSA 4OL0A 5IJAA 1G3QA 3EDRA 4Q1EA 1C3EA 1XEFA 5CH5A 4IJ6A 2JJQA 4HQRA 5DBFA 1Z8FA 2R60A 1BVUA 4UEKA 3EDOA 2BYTA 2IT1A 1K5PA 2D3WA 4J4HA 5HVNA 1Z29A 4UAGA 3HB4X 3E58A 3LY9A 4MRRA 2P0AA 2EKQA 2PZMA 1M5UA 5LYYA 4MV3A 5CDGA 2EEPA 3IOYA 2NAFA 5IC5A 4IDPA 3TMAA 1LBEA 3FTPA 1HDEA 2DFTA 3PGXA 3WTBA 1JQDA 3S8YA 3CJTA 3E7FA 4C76A 1M8FA 5AJXA 1QF9A 2IDKA 1DAOA 4ID3A 3TEMA 2OO7A 4LQDA 1U2QA 3TEJA 9LDBA 4BVGA 3D4IA 3GFPA 3I9LA 3OWXA 3UEOA 2RGXA 3Q98A 4EUHA 3H6KA 1Z5NA 4IJWA 2WAYA 4N1AA 4R0MA 2ACWA 5L95A 1V1JA 2HBRA 4X7MA 3CZRA 1TOAA 4D9EA 5D1NA 4V0LA 4E15A 4CDGA 3VI3B 4DQDA 2MHCA 3HH8A 1PVVA 5ARDA 3GUCA 1X86B 4QSHA 4QUGA 3CZAA 1GITA 2H2AA 3C7AA 2WA1A 2Z8YM 3GBPA 5E0OA 3KVYA 1Z22A 2GX6A 4GR9A 1O96A 3UQZA 4WCDA 4WPGA 3MJCA 1GPYA 3FE2A 1M2GA 3AXTA 1A88A 2OD2A 4PIVA 1WCV1 1L7XA 1K5DA 4WZAB 2ZITA 3NDJA 4UBJA 5AVRA 2EWVA 2OVBA 4PVDA 5EFZA 4BV8A 1ACMA 4MS3B 5H68A 2YVQA 4ZGWA 4ZTZB 1OFUX 3CO5A 3OBBA 4W8OA 1B2LA 3ADDA 1RXVA 1YOBA 3M1YA 1E2NA 1Y3FE 2Q49A 3ZU5A 2GYUA 4G2TA 1T2NA 2CNWA 3G23A 1GY8A 3ZU3A 3K9FC 2OWEA 4C7VA 4LFCB 4R1OA 2CL5A 3W05A 3NHPA 4HTFA 3JASB 4ZI2A 5LIPA 4AX4A 4W5TA 2ZUFA 4LXYA 5KNDH 1Y9JA 5CVJA 1HZZA 2J08A 4RKQA 2JHAA 2XZTA 3WYBA 2C58A 5EP2A 3ZN2A 4CT4B 4DNQA 4J49A 3CR8A 4CQJA 5HDBB 4G26A 4HDOB 2UKDA 4YDQA 1U4OA 1E0DA 4CKCB 4V2IA 3G85A 4B6RA 1RCFA 1SA0B 2QMHA 1NOIA 2PRJA 2JLUA 3O8OA 1N0IA 5CEFA 3VTAA 1YZNA 2X5XA 5C31A 3FI9A 3ZWMA 3H7IA 4NDNE 1TIBA 4TS3A 2OMEA 2ZUUA 3QOXA 3G9TA 1B2RA 5FUVA 3FPAA 3WNZA 4AKTA 4F92B 2ZRHA 4E22A 2GVDC 4PRLA 4XUCA 3KAPA 4A92A 4KNVA 4ES6A 3WWDA 4JQZA 3IEKA 2DTDA 4JL6A 3UJ8A 3LPAA 5CX4A 2L18A 2W8ZA 2J9FA 1JQBA 2QUZA 5L7TA 2I66A 4BL5A 1RXEA 2NO4A 2W58A 1OBVA 4NESA 3ZWXA 4KN5A 1V3QE 2HOQA 3FDFA 3IB6A 1F6WA 1W75A 1KVSA 3ACBA 1XRSB 5AUOB 3AF0A 2FFHA 4C89A 1EE9A 2Q21A 1NN0A 1HL3A 4BFYA 4AQYB 1MG5A 2HGSA 2QZ4A 2WABA 5COBA 4ZAFA 4AZ3B 4DSNA 5CLJA 2RC5A 3NEPX 1H8EA 4GEKA 3FCOA 1L4LA 3LWZA 1ANKA 1SCIA 4KQ2A 4XVQA 4QUIA 5EVJA 4A2CA 4G0WA 2VI5A 4TVSA 3ZKWA 4OK3A 1PT5A 2RBGA 5M7EA 4DG9A 1CE8A 5PGMA 3KU4A 3BH0A 2FSVA 2XB8A 2HYIC 2JCVA 1OZHA 3RRJA 1IOZA 3VVBA 3ASYA 4FMDB 2BSXA 3OA2A 3PGKA 1JTVA 2FEWB 3OZFA 4G1BA 4XB2A 2A8YA 4CG1A 4D43A 3I2KA 4B4VA 4U9UA 5LQKA 2V1XA 3FDZA 2JI6A 4HUQB 3LLMA 2W42A 3A9SA 5LJIA 3GROA 4RA6A 1M3SA 2MU1A 2W2VA 2UYCA 1JXOA 1HYQA 5DGHA 2IHNA 1G5PA 3T6KA 3DFZA 2NSHA 4H08A 4KACA 4HYTA 3U5ZB 5JS1A 3AVPA 1LPPA 3H5LA 4ZMSA 1QV6A 1S96A 3VR4D 4HGZA 3B53X 4CDNA 3FFBA 2QDXA 4PG4A 1YJQA 2C2YA 5FI3A 2DXIA 5DX1A 4N7RA 2PRZA 2NVUB 5L6LB 3GUUA 1L4KA 2VDRB 3OQ6A 1XPUA 2O20A 3R6TA 4U6QA 2CNWD 1KAGA 3LXUX 4FZVA 4OAOA 4CM4B 1KSGA 1B4DA 4U7GA 4LJLA 2FPGA 2G25A 3GIDA 3L5KA 3ICOA 2WF9A 3BBPA 3IP6A 1N6RA 2I3BA 4JWTA 3U3OA 3H5IA 1PWXA 2BRUC 2R1TB 3FYHA 4RE5A 2EFJA 3EPPA 1RACA 1FLVA 2QP3A 3AUXA 3CH6A 5DDIP 3ZLUA 4B6EA 4CI0B 4CHTA 2BHRA 3PUJA 4ZYXA 5C7YA 2PUBA 2SHKA 5HIAA 1HURA 1HQDA 1NC1A 1TW2A 1JAYA 2XGMA 3N59A 2R4UA 2Y67A 3WIDA 5SY4A 1V2HE 1TK9A 3RTCA 4Q4LA 5L3QA 1X1CA 4XYLA 3PNBA 5DYWA 3EX7C 1K3TA 2EGUA 3EA4A 2E49A 4DGSA 1RAHA 1F4VA 4P58A 3SSMA 4M49A 3CFYA 1EUQA 1TF7A 1E3IA 3F6YA 3L6DA 3KKNA 3QPVA 2WMYA 3LVQE 2PS1A 5AI4A 5KHLB 3I3SR 4FCCA 4K05A 1XQ1A 2KBFA 3TWOA 3NTUA 2YV1A 5CNMA 4FB4A 3J80A 2PUCA 2P5SA 1P74A 1G6Q1 4WZZA 4BQPA 4DSUA 5JANA 5K8VA 1GQQA 1I8TA 1JHOA 1OOEA 3IQWA 2BFDA 1CSEE 2A1TR 4ZOCA 2A14A 1E2FA 1PFUA 1QGDA 3NTRA 1B93A 1GCIA 2HGZA 3SC6A 2BHTA 2V9PA 4EHLA 5LBUA 5CXUA 4D0GA 4DMUB 2WWGA 4X1OA 1EDOA 4P36A 4IIUA 2C0QA 4UBMA 4CU5A 1J49A 4ZQFA 2ZJFA 3ND9A 5IAAA 2MYPA 4MX8A 5M5BA 4R81A 2BR5A 4UVDA 1GPDG 2QXUA 3P0FA 4FOLA 3PXEA 5ESDA 1JMKC 1G8SA 2IYVA 2I7TA 3DHWC 4WADA 4OHWA 3WJ2A 3AH8A 2ZUEA 1C80A 5KVQA 3PITA 1E59A 1MB2A 2RG7A 5AVXA 4LWOA 1YI8A 3F4BA 1RVV1 2VATA 3STWA 3D3KA 3EEQA 1SG9A 1NI4A 2FRVA 1EINA 2SKDA 4QD3A 3TNFA 4BS9A 3L41A 1ZA1A 1GPJA 2ACVA 5J47A 1IM2A 3MMXA 2HBZA 2BZ1A 2YFQA 1TYZA 3OY2A 3EQZA 3F98A 4I6EA 3SNKA 4CRWB 2Y4NA 1YIOA 1I2DA 3JWPA 3PUKA 4WN9B 3EPHA 4OQDA 1IULA 1JHPA 3T0IA 3A0UA 1E3EA 2J3KA 3DM5A 3UJBA 2MCFA 2BGLA 3B1VA 4ZEXA 4INZA 2GS9A 2ZIZA 4LHXA 4LHSA 4NAVA 3ZNQA 1T9CA 5B12A 3BMOB 5CITA 5J1TB 3WLQA 4JT4A 3E15A 2VAWA 3VU8A 2MOKA 5EIBD 2JLZA 3DC7A 4BVFA 5DWQA 2FGJA 3RYHB 1NYTA 2D0DA 1V5WA 2F64A 3INTA 3QVKA 2WYUA 2QVLA 2B69A 2W6JA 1Y6RA 3DWEX 3QIAA 2GPTA 5A4KA 2PLNA 4UQLA 1NXQA 2CVZA 2ZSEA 4JUIA 4N5HX 1TM2A 5CA0F 2NU7A 3RWMB 3MWJA 2F3QA 1X8LA 3GEMA 3I39X 3R3WA 4KDFA 2JZNA 1DAPA 1MN6A 4F1JA 1X1EA 1E7SA 2BKAA 3DEAA 4P3YA 2OTCA 3HK2A 4CR6A 2CJWB 2RSLA 4RZ3A 1Z5ZA 1XLVA 3UKOA 1A9ZA 4C2BA 5MDHA 4F38A 1DARA 3ZE7A 3E70C 4QDKA 3EW7A 3DZFA 1QH1A 3OQVA 4EUSA 5F98A 2QY6A 2J3EA 1LZLA 4MICA 4TL7A 3CM0A 5DT9A 3W5AA 3W5UA 2HNAA 3E8XA 3TCNA 3L4JA 1UANA 2AKAB 2XNHA 4BOYA 4S1PA 1PW7A 4JENA 3GJ7A 1ZOOA 5JDCA 1RC8A 1GV0A 3B2EA 3IUJA 4FYKA 4MS1A 3MMZA 3HN6A 4O4LB 3V42A 3SEFA 5L4SA 2PM8A 4C78A 2FFRA 3OQ1A 4CUJA 1N3LA 4K6HA 5LIRA 5FPYA 2XUGA 3T0GA 3U1VA 2W83A 4EYOA 1WDKA 1X7GA 3M5CA 4M6WB 1IY2A 1HGXA 1ZL2A 1JZTA 1ZN7A 2DFKB 4UUMA 4NXMB 3II6X 5JMPA 2OCYC 1DC8A 3LOUA 3F96A 3RIGA 4D97A 1JBKA 1FJHA 3QM1A 3U39A 4NARA 1SXHA 4IIYA 4EDFA 4RVOA 4CEJB 2G28A 4LVCA 3IBYA 3MCVA 4X8LA 3I5UA 3L04A 3X1DA 3ZXYA 4DKXA 1QNLA 1R0XA 3GRKA 4EHFA 1J39A 1S3FA 1SVWA 4WXMA 1H8HA 1ZIPA 3USCS 4A0HA 4C43A 2O48X 5TVKA 2ZSKA 1I0LA 3A32A 3OESA 2XDYA 1MP0A 2PWZA 4K28A 4Y1FA 2GA8A 3O4HA 1E3WA 4XTCS 3V3TA 1E2HA 3KHUA 4AB1A 1AUQA 3DOOA 1X1SA 2HXGA 4TV9B 2FP3A 1M1ZA 4FGSA 4TZKA 2HK6A 2AMLA 2ZJYA 3T3DA 5DCLA 4QATA 4CLHA 1RZRA 1KQ3A 1OSNA 3RFVA 4UREA 1BMFA 2FX2A 5C1IA 4AFNA 5JATA 5EMLA 5H81A 2P6PA 3JR7A 4QTUB 4R51A 1E1CA 4OHFA 1VL5A 3GLHB 1K6XA 2X14A 4ND4A 3A9TA 4RJ2A 1JHDA 5AKGA 3OUZA 3LS2A 4F5YA 2HF7A 5FXMA 2OLKA 1V6SA 4H7FA 1J5EB 1QZXA 4IXTA 1YIDA 2ZR9A 3RT7A 3R6LA 2XNDD 1GNVA 2B99A 2H5JA 1ZCJA 2MJLA 4KQHA 1CQWA 2WJWA 4HL6A 4B6GA 3ZDQA 2WTUA 3M33A 3AYXB 3H4IA 2O3UA 1J07A 1PW5A 3JCZA 5F2KA 4RTJA 2M6LA 3BWXA 4ER7A 4B82A 1KJJA 3GRAA 3JYQA 4JBLA 4UCXA 5M34A 1ONPA 2R65A 4KMOA 2RD2A 4KXFB 3QBTA 4KLNA 2D0IA 2PKYX 2DHRA 3PWSA 4FC7A 4OMUA 1UPAA 3KT3A 5ALMA 4E88A 1M6HA 1QOZA 3E5HA 3SS7X 3U4HA 4KITB 2A9KA 4YJ2B 4CDMA 2VNIA 2MMGA 3CE9A 1VHTA 5I9SA 1OYWA 3JATB 2E5WA 5ISMA 1A27A 4HCJA 5JY1A 3Q1KA 4FM9A 3DT9A 4B4OA 3PYMA 1R66A 3DLHA 4MH0R 2WTMA 3PIDA 5BORA 3SSAA 2GEUA 4OU4A 1SA0A 1XKLA 1ZH0A 3ASVA 2RJOA 2ZRPA 3WGGA 2IBMA 3MWKA 4S1VA 2GNPA 2HEIA 4TWIA 4EMSA 4F71A 4YRIA 3C3JA 3T4PA 5I9IA 2IEAA 1NQWA 4P31A 2GM9A 4PLYA 4PLWA 4Y98A 1G6KA 2AZTA 2RI0A 4FJ2A 4GQBA 1ZP6A 3D2LA 3WGNA 3CX6A 1QHYA 1JDBC 4JD5A 4LMRA 1XCPA 5FKJA 2P2CA 3FSRA 5H4HA 4Y18A 1M1NA 3IEVA 1OVGA 4E07A 2R1VB 2R8EA 4LJ6A 2HHHB 3UWOA 4BVBA 1Y3CE 1JU9A 2CY0A 2OKCA 3VKWA 3K5HA 5LXTF 3T61A 3RPEA 3C7DB 3QFCA 4UCFA 3E22B 5IN5A 1POXA 1ZN9A 1CR0A 1F1BA 5JCZA 1ZD5A 5A0TA 4ISBA 5G53C 4KPUB 2DKFA 1ULUA 2B36A 3NBUA 3STYA 2ZDQA 4DCVA 4R2WA 1DC5A 2H16A 1FX1A 4DANA 2BTOA 4Q15A 2ONZA 1LWNA 3AUTA 1PQ4A 3U19A 1V41E 5B7NA 3K09A 4MVJE 1LBHA 1S0UA 1A50B 2FFBA 1VSBA 3QUQA 4FYJA 1PEAA 2XZPA 4DA4A 2W2NA 5EA2A 1TNDA 1AQYA 1ORRA 4DEYA 5HM8A 5IJWA 3IKLA 1YHZA 1Q57A 5EJ7A 4MO2A 4FX5A 5CT5A 1NBAA 2QVBA 2V45A 5EKTA 3AJ8A 1EH5A 3WRXA 3TTVA 5CFLA 2OGSA 1Y89A 4EB0A 2PUVA 3LKBA 1CZRA 4LSMA 3ENQA 3GXOA 1ZMBA 5ILOA 3I9FA 2H6EA 1E7WA 5HWSA 5GTDA 4X93A 2WG0A 3GJ5A 4O2AB 4OXQA 4Q66C 3RG2A 4C88A 1CQXA 5DYTA 1CW2B 1ZOLA 3C1OA 4K9NA 2C61A 2YNMD 4KLCA 1XAIA 3TJZA 1ICIA 1S6YA 3CVWA 3I8OA 3OHSX 1TECE 1O8BA 3KXPA 3V7NA 4X84A 2RAUA 2VEOA 3INGA 3L7NA 2HB6A 4HRYA 1N1MA 4PX9A 5JAUA 4N49A 5CDFE 5HQ3B 4M3NA 1XMXA 2RHJA 4FBMA 2WJAA 3QNWA 1ZVMA 4FYXA 5CJJA 4LPKA 5KQGA 3ZCUA 2GSDA 4NOMA 3DZGA 3O6VA 1WKCA 1H5NA 1PJTA 5B1SA 1E3LA 2ESRA 2V58A 4M8LA 3HJHA 4GWKA 2FZWA 2Z8ZA 4EFNA 2C9OA 1I9CA 1K0FA 4K87A 4BV3A 3CR7A 5K8JB 3GEEA 4K9RA 5FULA 2O7VA 2LR0A 3LC2O 2SCUA 3O1LA 4YJFB 1KPHA 2QTZA 3EGEA 3GEIA 1Y8AA 4LF5B 4BX3A 1TX4B 2QT0A 2QTWB 3QWIA 1ZMRA 2VJMA 1FUIA 2IP1A 3B9QA 4FOOA 4KH0A 4A0QA 1QIIA 2WKPA 2ZRIA 3TD2A 5EQJB 4UDOA 5ICFA 2EKPA 4BO7A 1HG1A 2KE5A 4GVXA 1A95A 4MW0A 4PZZA 4HT3B 3PICA 1OWNA 2PXAA 3VX3A 2P1RA 2WTAA 4AZ3A 4DWOA 3D6HA 4G1MB 1G5QA 1ODTC 4R41A 4D9MA 1RC0A 1RTTA 4GP7A 4ZU3A 3DKKA 3WLTA 2C5GA 1GNLA 4TMZA 2F43B 2X5OA 1DNPA 2QUAA 1J90A 3REQA 3U48A 4U2DA 3BXPA 4ZVUA 3FTFA 3UMGA 1JH9A 1YCFA 4E4TA 1BDIA 3LY5A 4KDEA 4UM9B 3KWMA 4U9HS 4JJEA 4JGGA 2NZVG 1KQOA 1ZNQO 2C5LA 1X8XA 1DI0A 3OZBA 5H9WA 3EXG2 3TTTA 3NHMA 3L7KA 3VDXA 3O03A 5KX5A 3FTCA 2JEYA 1FY2A 5DCWA 5F52A 1RBZA 1WUHS 1KI1A 3BMNA 1GKLA 3GPDG 4NENA 4QOEA 4FWTA 2BLLA 3ZLJA 1ZUIA 2GSWA 2AB0A 2JFOA 1N92A 3BTUA 2PYZA 3GFFA 3Q7RA 2I4RA 2XUPA 4FD3A 4NYIQ 3FLMA 4IOJA 4RAOA 4MSUA 3TZQA 1JIKA 4B45A 2XCSB 2AUMA 2APJA 3G2QA 5AP9A 3UJCA 4HAOA 1D7OA 1Q44A 3ADCA 1A8SA 2BFCA 2WNSA 3C6YA 3GMIA 4CODB 1RM5A 3IEUA 1KAQA 3DJYA 3QU4A 3VPGA 5C4GB 1YVEI 1QIMA 1SZDA 4TLAA 3CNBA 1DXQA 1RQNA 1QVRA 3UZUA 4ICIA 1JFTA 4BFLA 5JAOA 2QVXX 2F62A 2X7XA 5F73A 2P2YA 4D4JA 3IUSA 4QVKA 3FBTA 3HDGA 3KU1A 1N57A 3CZCA 4D02A 3H9CA 2GF0A 1J0XO 1PYGA 1XALA 2AVDA 5EGNA 4M60A 3KFXA 5IKOA 2D4HA 4KMMA 3G0HA 2ADFA 3HXOA 1DZIA 2ZYSA 4BQQA 1M1XB 4D3XA 3VNUA 3SKVA 5HA5A 2FGKA 1JZQA 1SVUA 2WG2A 4G8JA 2VPZA 3RRXA 3VPXA 4WBNF 2PKCA 1UP7A 1Y7TA 1HDIA 2QLNA 3L84A 3GG2A 1CR1A 2HMUA 3SX0A 5I4KA 4I14A 4YY3B 4HS9A 3OHPA 4RO0A 4E31A 2BONA 1EK2A 4M1ZA 2FYTA 3L40A 3HCAA 3AC0A 4WQMA 3RASA 3LPMA 4KHZA 3TGWA 4M2LA 5AM4A 5B64A 4YO8A 1KI6A 2FJUA 2HNKA 1PEDA 3OZDA 1GR1A 4D7AA 1GKIA 1Y8QA 4NBKA 3VKGA 3C3MA 4IFBA 1QDLB 4BYGA 3LX8A 2IE8A 3ITDA 2Q62A 2QN7A 1E1YA 4YREA 4OQFA 3D0RA 3OEHA 2BHNA 2JVKA 1NKTA 4L72A 3MTIA 1LF0A 4IILA 4TS4A 1KAMA 3U26A 2AI3A 1OCEA 4A8JA 1D6NA 1B6TA 3CGWA 3H65A 3F6BX 4KXVA 5ARCA 4B7ZA 2FZ4A 4QQKA 1PNRA 3BD7A 3P9ZA 5FYDA 5FWXA 4LJSA 3LQ1A 3MJDA 3QU9A 1IN7A 1JQ3A 2IYPA 1JT9A 1Y6ZA 3ESXA 4JEUA 3TXAA 3DH0A 3S8EA 4YMHA 5LWHA 4LBZA 4ZTBA 3UMSA 2EFEB 3PD0A 3THYA 4M21A 5EJ5A 3OQIA 4QGFA 2G82A 3WLMA 2VJBA 5B3AA 4WY5A 4IIXA 2O0MA 3IE1A 3ESYA 4HMQA 8ADHA 2BJWA 4U9IS 2FHSA 1EX9A 2QLMA 4QDTA 2VHUA 2OG2A 1V2GA 1OPXA 2BDUA 4G9BA 3VJMA 3ZWOA 4C7XA 2Z4SA 4ZFNA 1JKFA 1ETHA 1E4OA 5LP1A 4LQLA 1HEIA 3SG0A 2Y68A 3VVCA 1QONA 3JZIA 4IDDA 4QG3A 5KDLA 5LYJB 3R77A 1BQ3A 1NP7A 1T2DA 1XTQA 3ODGA 4HPXB 4LUCA 3UA3A 5JXIA 1Z2PX 1RFLA 5JC1A 5AM3A 1IM5A 2O19A 4DM4A 3VUEA 4FDMA 1UAGA 3DV9A 2WVGA 2CVPA 4HATA 4PFQA 1TW3A 3ZV4A 4TLBA 4MEJA 4DDVA 2YJGA 1AXGA 3D3QA 3NHUA 1OJLA 2J3DA 4L5AA 2PPVA 4F04A 3FHTA 4XVHA 3U4DA 1UMBB 1QTIA 1BH2A 1E3DA 2A67A 1LRJA 2QL6A 4NNOA 1JLLA 4X1YB 1E66A 2J5QA 5SYMA 3SP1A 2QYOA 4B6OA 4DMGA 5LNK1 1F7UA 2DERA 5IN4A 2ZIXA 1OFTA 3O1IC 2X23A 4OGGA 3SYTA 5D2CA 5LCXA 4B7XA 3HXLA 3G2JA 4PANA 4BQIA 1NAIA 2VJQA 4K6OA 1X6VA 2C78A 4XCVA 1R4NB 1P8AA 1P61B 3O84A 1U0BB 4DBZA 5TDHA 1TVKB 1RLUA 3AESB 4NZPA 4R2XA 3CF4G 4RFSB 1AQIA 3IBCA 4B35A 1CXZA 5LWQA 1OIXA 3OWOA 5T6MA 1ZYUA 2ZETA 3FTEA 3IFSA 3B6KA 2HSEA 2Z04A 1YBFA 4PCUA 1BS1A 2A1TS 3N6VA 4PLTA 1IPEA 3QKUA 3E6AA 1QNFA 3NBKA 3ZW9A 4QYMA 3S2FA 4M0FA 4DNPA 1I0ZA 5LJLA 2Y2VA 5LYJA 3ZWNA 4UBNA 2XHZA 2B8JA 3CY6A 1W85A 2B83A 2GN4A 1SQGA 3L49A 4LXXA 4ACBA 1V3VA 4A6DA 1MJGM 1L9KA 2F9MA 2R6ZA 5CTJA 1LZKA 1GRVA 5GPBA 1E1NA 1YJ5A 5FADA 1VYVA 3J7TA 5LQCA 5J3JA 3AM3A 5LU9A 3C8ZA 2QUBA 5D3QA 5JRJA 1CZKA 2F17A 4WKNA 3ZHZA 4OAQA 2YUIA 1CQJB 1SURA 1ZU4A 3SE0A 1KAEA 3UMVA 1YF3A 2BEVB 2PG3A 4WKGA 5GM1A 3GQBA 3JXEA 3FYUA 4YQFA 3R3SA 1OXXK 2BUBA 2YJ6A 3G0IA 1O94A 3FAZA 3HJRA 4RQUA 1FVHA 1M34A 3EIXA 3SIPA 4I4IA 2P5TB 2WU4A 3IMKA 3BJMA 4Y7CA 3NG1A 3DFIA 3VHRA 5ICMA 2ADOA 4WH0A 1G3MA 4GLFA 4OLHA 1CP2A 3GFRA 3KJNA 3WSVA 1DQPA 1SOMA 2AD5A 2QRGA 3CISA 3N2KA 3E23A 4R71A 2RHGB 3H5NA 5F2OA 3DAOA 4C4SA 2PGOA 3TSWA 2BTEA 4D1YA 4I99A 2Q2NA 2FZ5A 2WLSA 5IPFA 1E62A 4DV1B 4Q1VA 1MVNA 1U0LA 2OXTA 5LOVF 2HZ7A 1JA9A 4NZMA 2BFCB 4HO1X 4GX5A 2X3YA 4I3FA 1HWYA 4L4ZA 4UM8B 4IO1A 1RD4A 3HWX1 3X1MA 5HR5A 3VH4A 4X0EA 1KEUA 2FPSA 3U7QA 3OFND 2GTHA 1U2TA 3O4RA 4X3OA 5KPJA 1G8YA 4RKWA 1JA0A 4PSAA 1RT9A 4F9TA 2A7XA 3TL3A 2EHDA 4L0QA 4MI6A 3NVAA 1WJGA 3KJEA 4II2A 1OI2A 1JXQA 1Z35A 5EHNA 1E7RA 1MOZA 4QXMA 1K8XB 3QMVA 5INTA 1Y8CA 3KDAA 4R8VA 1GL3A 3K32A 1JWAB 5DLYA 1S8AA 4A8HA 4YCBA 2N0SA 3KKLA 1U0JA 1E2IA 3RBXA 1C0IA 1IEXA 4YRKA 1ISIA 4CF7A 4XDGA 1X0VA 3LDUA 2GBLC 4XFJA 3ZD8A 1HDRA 1WQ4A 2PD4A 2ZIWB 3AFNA 4MV6A 6PFKA 1C9DB 3KQLA 3R5KA 1BE6A 1QRDA 1BGWA 1YMVA 3E18A 4BTLA 2BBSA 3KNZA 4JI4B 4LMAA 1M74A 2FCRA 3CTMA 3LIPA 4LXQA 4PBTA 4TYWA 3L0BA 1NYRA 4WLUA 3PU6A 4CMIA 4RY9A