4FC7A

Studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
274
structure length
274
Chain Sequence
PPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Studies of human 2,4-dienoyl CoA reductase shed new light on peroxisomal beta-oxidation of unsaturated fatty acids
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Peroxisomal 2,4-dienoyl-CoA reductase
total genus 105
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.34: 2,4-dienoyl-CoA reductase (NADPH).
pdb deposition date 2012-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fc7A00
4MIYA 4DGSA 5JMWA 3GGOA 3C1OA 4IQ0A 3IOYA 2Q1TA 3OECA 3KYDB 4XA8A 1LSUA 1WZIA 3EVTA 3SJUA 4HNHA 4AJPA 4B4VA 4DYDA 3AI2A 4A7PA 1YOVA 2E49A 4XZ3A 4RORA 1ZK2A 3F4BA 3WNQA 2XXBA 1NAIA 4YXFA 4FJ1A 4WUVA 2VWGA 1PZEA 1V35A 3LSYA 3I5MA 4FFRA 4FOOA 3VZPA 5JCJD 1T2FA 1MC4A 2QRKA 1BW9A 1OI7A 1PJCA 1DHTA 3UAGA 1E7WA 3JQFC 3JV7A 4HX5A 1I8TA 2D8AA 1EK5A 1I01A 4CM4A 4ZGWA 1D3AA 4IDAA 4J49A 3RC2A 4DA9A 1KIFA 4NDNE 3MJEA 1X7GA 1AXGA 4NJMA 1E3WB 5C37A 2I3GA 3DEYX 4EYEA 1T4DA 2CF6A 4DRYA 2CVQA 3ON5A 5EQFA 4Q39A 1EQUA 3IP3A 1XWFA 4K9DA 2V6BA 2GLXA 4CODB 1DBVO 4D79A 3C8MA 2FPIA 3UFXA 5C5IA 9LDBA 1DDOA 3WOHA 1BMDA 4II3A 3PLNA 2WSBA 4RF4A 5IF3A 3NAQA 3SLKA 1GTMA 1YDEA 3GN1A 1JTVA 1VSVA 2PV7A 4D45A 4AJEA 4YJGB 2BRUA 3WQQA 2C7GA 5KJFA 3DZKA 3FTNA 4JX8A 4E6PA 1P1KA 2YUTA 4RDHA 4RQTA 1GPDG 5JCXA 2YQ4A 3OP4A 1TI7A 3QWHA 1V3VA 5CEFA 1Y1PA 2I9PA 4WASA 2EJWA 4RV9A 2YDXA 4IM7A 3D4NA 1PL6A 5GZ3A 5G0WA 4HXYA 5JS6A 2EXXA 3ROKA 3PHHA 3QP9A 1K5HA 3GDOA 2Y05A 4E31A 1FDWA 2R00A 1SEPA 1YRLA 2I76A 1DC4A 3X2EA 5F1OA 1JVSA 1XIVA 3MWDB 1YXMA 4WLVA 4BNUA 1N9GB 5COBA 1UH5A 4Q3NA 4WK6A 5HS6A 3G79A 1XHLA 2WYVA 3WGTA 3RUDA 1V8BA 2PGJA 3LC1O 1Z75A 1DO8A 1SCUA 1L7EA 4BHTA 5A3VA 1HRDA 2VUTA 4BV9A 3ZGYA 1N7GA 2Q45A 2NADA 3I83A 1JAYA 2AG5A 2J3KA 3ITDA 4BKRA 3AU9A 4ITUA 1ADBA 1B0AA 3GF4A 1Y5RA 4C7KA 4FGSA 2FHSA 3UF0A 1LLDA 1T2EA 4BNVA 3I23A 3WJ7A 3JD0A 1H2BA 4UVHA 2YW9A 3VDRA 4YB8A 4PLYA 3GMDA 1R4MB 5CP8A 3VKVA 1EVIA 5DOVA 1LQTA 2BI8A 5B12A 4WLFA 1EFLA 2X5OA 4JP3A 2Q1WA 1ONPA 1HTBA 1AE1A 1V3TA 3WLEA 2YYYA 3KBOA 1H9BA 3N74A 4I9NA 3HDYA 4G65A 4MDHA 2VRCD 1U3TA 1CETA 4RPJA 2GD1O 4Z0PA 3E1KA 1NP3A 1I3LA 2AQKA 3OETA 4B4WA 4D42A 5JO9A 2UUOA 1SO8A 5TLSA 4JBGA 4XQEA 1AHIA 1BG6A 2GYYA 2D5CA 4KTVE 3OA0A 4BUCA 4XGNA 1GQYA 3NTRA 1K3TA 4DBZA 3NGLA 2IEDA 4HV4A 1JN0A 3ZWVA 4FSHA 3QV1A 3TL2A 4LVCA 2OBNA 3E5MA 1KVRA 1E3WA 2W8ZA 1R66A 4RJTA 3O38A 1MG0A 1YBAA 2VWPA 2AA3A 4J16A 3L4BC 3N58A 3DAPA 3JQ9C 5A03A 3HG7A 1UZLA 2PZJA 1UZMA 2OP0A 1XGKA 4QUKA 4ALKA 1D1SA 4XYMA 3JQFA 4FOSA 4R9RA 3VPGA 3E9NA 3P5SA 4CR8A 3S2GA 1BXGA 1ZVMA 1T1SA 2BF7A 3OEYA 1NPYA 4BNXA 3IL2A 4ZQFA 3HDHA 1SOVA 4J2OA 4LK3A 4CUKA 5B4TA 2QRJA 3VOSA 4QXMA 4L75A 1KS9A 1DPGA 1X0VA 1Y8RA 1NYTA 2QRLA 2HK7A 2W98A 3DZIA 3FPLA 4EDFA 4J4BA 3ROMA 3TPCA 4CMBA 2EEZA 5CHEA 1IHXA 4EUFA 4BMNA 3W4JA 1E92A 1IULA 2FWMX 1QV6A 4CLRA 5KJ6A 5IFLA 1EBUA 1PQWA 1F14A 1QR6A 2CDAA 2FMUA 2NQTA 2X9GA 2ZB3A 3E82A 3H9QA 4PLWA 3OJEA 2YHIB 5L53A 5JYEA 3JQBC 1E1LA 4M8SA 4QFCA 4GQAA 8ADHA 5AXCA 3LT1A 3S2EA 1I36A 3RCBA 4FC6A 3FF4A 3L9WA 4AJNA 1CF2O 1BGVA 3TNLA 2RBEA 2HMVA 4AJJA 1UDCA 4RPGA 3GNTA 1HDGO 4OGWA 4W7IA 3G1TA 3ANLA 3K92A 2Y1GA 2X0NA 5F1KA 5ILGA 4DQUA 1EQ2A 5ES3A 4LCJA 5A4DA 4O0LA 3D5QA 1LDEA 1WDKA 4RPLA 1PGNA 1I3KA 3INTA 4D3DA 4WE3A 3ZV6A 4CLDA 2GUGA 2H5LA 1R4NB 4RVGA 1FDTA 5IXYA 1UXGA 2EHDA 5I7FA 3GNQA 4CMEA 3ZV4A 4BGIA 4I8XA 3PLRA 4J1TA 3FD8A 3OQBA 3FR8A 4KP7A 5IZCA 1ZXLA 2VHZA 4LRSB 5KCZA 3AFMA 5DDIP 5KVVA 1O89A 2JL1A 3GZNB 4Y98A 3VHRA 1OOEA 3RFTA 2RAFA 4FFMA 1BTOA 5DP1A 4MKRA 2A92A 4R1UA 3NJ8A 2DAPA 4OOEA 1CIVA 3DBRB 1RYEA 3B1FA 1HDXA 3CEAA 3DB2A 3TFQA 4P22A 3UVEA 3F47A 3QVWA 4FQ8A 4Z9YA 3GHHA 3MOIA 2VHXA 3V1UA 3LC2O 4B3JA 3A9WA 5AVOA 1LXCA 2YY7A 4IS3A 4B4OA 3TSCA 3ZU3A 1Z45A 2C29D 4HBGA 4DIBA 4HP8A 1GUFA 1PZGA 1Y9AA 2J3JA 1EDOA 3NEPX 3SBOA 1QV7A 1M66A 3RJ9A 1NWHA 1PL8A 3KSDO 3BMOB 4R1NA 3WS7A 2VWHA 1P9LA 3V2UA 1B7GO 2JD2A 2QW8A 2ZB7A 1PGPA 1ZZEA 3IQDB 2Q1SA 4PG6A 4GI2A 3ROQA 2Z1NA 5F5NA 1OAAA 4CLHA 3JQAA 1ZIDA 1HDYA 5LC1A 1W4ZA 3OJFA 4IS2A 1B14A 4E30A 2JD0A 2WE7A 5C7OO 3GG9A 3HE3A 3ZU2A 2AE1A 4W7HA 4CM5A 4OQYA 4ND4A 9LDTA 2FP4A 4IZHA 3RAJA 3HN2A 4CV2A 1KYQA 1IUKA 5K0ZA 4KZPA 1Q0HA 3PHJA 1MP0A 3H5NA 3HUDA 4MVJE 4FW8A 3H9JA 5IZCC 3WSWA 4FIZA 2VHVA 2NTNA 2ZB8A 3RKUA 2HDHA 2FOIA 4ESOA 3EUWA 3KEOA 3E03A 1UXHA 1PJBA 4E0BA 4AG3A 3RROA 1KVSA 4JK3A 3TOZA 1HL3A 3VPHA 2NU7A 3QSGA 2OUIA 3DBLA 3KYCA 4I9HA 4XRGA 3WGIA 3AUTA 3NX4A 4Z0HO 2EP5A 1M6HA 1SB9A 3BMNB 4YJFA 4DXHA 3JYLA 5JSFA 1A71A 1YOVB 4U7WA 4IGEA 1B26A 3WYCA 2DTDA 4GX2A 4CM3A 4U5QA 3H3FA 5CG1A 4CM6A 2VCYA 1G0NA 1XLTA 1M76A 1BDBA 1KVTA 4FD3A 3COSA 3PQFA 3K31A 4UEKA 1TB4A 2FR0A 4NJOA 4AJ4A 5A3JA 2BFOA 1F8GA 1XKQA 2EGHA 1F0YA 1AXEA 1UXIA 4J7XA 1HF3A 3QWBA 3HDQA 5TX7A 3PHLA 4R3NA 4OQZA 4A73A 1TT5B 5GZ6A 3AUUA 2EKQA 2CVZA 2RHCA 2OXIA 5DN9A 1V6AA 1P74A 1VE9A 2E4AA 1KVQA 1O5IA 2CD9A 3JYPA 3VAZA 4N5NA 1E3JA 2BFMA 2H63A 3OIGA 4IDFA 1F06A 3AY6A 5AXBA 2YFQA 3DMTA 2GSDA 1PGQA 3KSZO 4CLEA 4QT0A 1B16A 5DBIA 4BO0A 1YONA 2PD6A 3OBBA 2OL4A 3AWDA 1PJLA 2OP1A 3UUWA 2C0CA 2FSSA 3A28A 2NM0A 4ZU3A 2JKVA 1FDSA 1I32A 1HYEA 2HCTA 1T25A 2LDXA 1DAOA 3KTDA 1IOLA 3KVOA 1GADO 4DUPA 1PJQA 2X0RA 1ZKMA 3NRCA 2IZ0A 1LC0A 1SMKA 1ZW1A 4QTZA 1EDZA 2H1SA 1HE5A 4BKOA 3C24A 4EEZA 1WMAA 1W8DA 5TC4A 3TRIA 4PIVA 3Q9NA 5JAQA 4CMAA 1ULSA 3DZGA 3JYQA 3WIDA 3DFZA 1G0OA 1UZNA 3C7CB 2I65A 3GK3A 4GL4A 4PLZA 4JQCA 4I1IA 4PLVA 4BGVA 2NSDA 4NZ9A 3D7LA 5TGDA 1U7HA 4MVJA 4R16A 3RQSA 1C0IA 4E5YA 2QYTA 3KOUA 1K0UA 3BHIA 4TRRA 3ETEA 4IDEA 1AGNA 4EITA 2ILTA 3TQHA 3VPXA 4YPOA 3BZUA 1N8KA 3LQFA 5L7TA 2X22A 1YBMA 3VDQA 1X0XA 3ZW9A 3OF2A 4XQCA 4IDGA 5I7SA 1N1EA 4J4TA 4MKZA 3H2ZA 4ND2A 4MVJG 1F8FA 1KY5A 1LBEA 4YR9A 1DIRA 1TVEA 1DJQA 1XYGA 2VYNA 3CXRA 4DMLA 4N7RA 1NPDA 2VHYA 3I6QA 3ST7A 1T2AA 1WP4A 2HJSA 3F6YA 2ZYDA 1JU9A 3QQPA 3E6AA 2FSVA 3HJAA 1XEAA 4LSMA 4E5MA 2DTXA 3DBLB 3DMTC 3LLVA 3OJOA 1QLJA 4Z3DA 1JWBB 3VH4A 2Y1OA 4RZIA 4PZDA 3GLQA 1N92A 5DCUA 1ZNQO 3A4VA 1EVYA 1LDNA 2UVDA 4DTIA 2G5CA 2HKIA 2V6FA 4LMPA 2X0IA 3FNEA 4OXYA 2Q50A 3AFNA 3VVCA 3TL3A 1WMBA 3ZWOA 3DHNA 1K6XA 1OMOA 1HE4A 2CNBA 1YB4A 1KBZA 4XB2A 4KWHA 3TZ6A 4HUJA 5HA5A 3HDJA 3ENNA 4PVCA 3F1KA 4AJHA 1YS4A 1A4IA 5DOZA 4CM8B 4IINA 3ZN2A 5DULA 2OGUA 4W4TA 2GO1A 4M87A 3FN4A 2FPGA 4E5PA 4IDCA 1QLHA 4E2YA 1PEDA 1PWZA 2PZLA 3MJVA 4UAGA 5A04A 3TWOA 2P9GA 2R6JA 2VZ8A 3AOGA 2AEFA 1K89A 1U9JA 3IC5A 5JMPA 4UVIA 1U1IA 2O50A 1WLYA 3ZHZA 3DZJA 4NU5A 4Q3DA 4DVJA 4F6LA 5ENDA 4TZTA 3JCZA 4WCFB 2NLOA 3NT5A 2O3SA 3VH2A 2EJVA 3PHGA 2EWMA 3PRJA 4YA6A 2VYVD 4DYVA 2GGSA 4K26A 4A2CA 1CQJA 4CM9D 3PGJA 1Q2XA 3PFWO 3WQRA 2PKRA 4BKUA 4PG7A 5F1PA 3BMCA 4W99A 4Y8VA 5J23A 1A4UA 1MGOA 3OEWA 1ZO8A 2VYND 2H6EA 4J91A 5TJHA 4RF5A 4TMFA 1PJ3A 4LW8A 1P0CA 1R15A 2FZWA 3FI9A 5F3RA 2PR2A 4FGWA 1MFZA 3EZLA 4HWKA 2NU9A 4EJMA 2BD0A 3E8XA 1NNUA 2C20A 3HB4X 3RUCA 2IZZA 1CRWG 4G5HA 4D44A 3PP8A 3WGQA 4FN4A 4D3FA 4L74A 2NQ8A 1A72A 2NVWA 1B8VA 4RO0A 1YJQA 3UICA 4FJ0A 3B1JA 4CQLB 5IDWA 4NU6A 4J0EA 3RUHA 2QIOA 2ZK7A 4IPTA 2BGMA 2GF2A 4NFHA 1NXQA 3CE6A 3OA2A 4OJNA 3DBVO 1NR7A 3EC7A 2ET6A 2OORA 1I2BA 1X7DA 4EJ6A 1S7CA 4IGFA 1DC5A 4B7UA 2PD3A 3JD2A 1Z6ZA 4JLWA 4PZCA 1RPNA 2Y68A 4D3SA 2YDYA 3L6EA 2PKQO 4A5OA 4R54A 4CMEC 3GUYA 1Y8QA 4BKQA 2O3TA 1FXSA 5JAIA 3R3JA 1X13A 3KUXA 1JKFA 2P2SA 3H9GA 5JY1A 3WQSB 2W2LA 3QVSA 4LISA 1J49A 1U2DA 3H8VA 1X7HA 3CIFA 3E9QA 1RYDA 3E5RA 4CLXA 4BVAA 4ID9A 5BQFA 1P3DA 1UAYA 1GZ3A 4R4JA 2QX7A 1GR0A 4FFOA 4PLHA 2C5EA 5CEJA 1NTOA 1TEHA 2NU8A 2V65A 3CPSA 3CMMA 4CLRB 4XR4A 1VRWA 3B20A 3JTMA 4L4SA 3G1UA 4XQ9A 4DWVA 2DLDA 1WDMA 3UCFA 5CDTA 2WD7A 4H15A 4YJGA 3OIDA 3SJ7A 5LDGA 4BNZA 3DR3A 4CQMD 1VL6A 3VPFA 2GNAA 2G76A 2ZTUA 1HYHA 2NACA 4DPLA 2CDBA 1R4MA 2NU6A 3QY9A 4JBIA 2POQX 4BGEA 1B2LA 4IMPA 4UVEA 5C7LO 4BNHA 4PLGA 5GMOA 4CM1A 5IN5A 1VPDA 3K8ZA 4GKBA 3PJFA 3BTSA 5JE8A 3BA1A 3TZHA 1P0FA 3H3JA 1FDVA 4TRJA 2CMDA 2VN8A 2JFFA 3D3WA 4GLOA 2VWQA 5I8WA 2Y0CA 3BMNA 1MXFA 1HDZA 2IYPA 1HDCA 3MTGA 1LSJA 3FSRA 4AFNA 1PR3A 4GMFA 3WDSA 5G2OA 4D41A 1E3IA 2DUUA 1QYWA 4RF3A 4O5OA 2WYWA 3U0BA 1AHHA 3U9LA 3GVPA 3K2BA 1LDBA 5A5EA 4KDFA 1TT5A 3RC9A 2PWZA 1BRMA 4CMGA 5ITWA 4Y9DA 1WAMA 3STHA 4PG5A 4B4UA 2J3HA 2NVUA 3K5PA 2AXQA 2IXBA 2WDZA 3BHJA 1U8XX 4YAGA 4NIMA 3QRWA 4BO5A 4GMGA 4JJFA 1LUAA 2NV6A 4RPKA 1E7RA 1IB6A 1XDWA 3RFXA 3TZCA 4GGPA 3RC1A 4ALIA 1VC2A 1I5RA 3EK2A 1XQ6A 1TLTA 4NBUA 1I30A 2I67A 4DLAA 2CY0A 3WYBA 1GZ6A 3RIHA 3INGA 3JQCA 3NGXA 1DIBA 1Y6JA 4FJ2A 3RC7A 3KYCB 1GEEA 5TIIA 3AUAA 1KEUA 1LU9A 1X1EA 5A9RA 4MKXA 1DB3A 3FPCA 3HWRA 4NQZA 4EBFA 3EYWA 2EERA 1YB1A 1P45A 3SXPA 5L9AA 5CAEA 5IAAA 5A06A 5BT9A 4WEQA 1JA9A 1NVGA 2B36A 3PWZA 1LI4A 4IIVA 1WXDA 5CEEA 4M55A 4XIJA 4PCVA 4YAJA 4F46A 3JD1A 4CV0A 1YKFA 1B8PA 2HMUA 3DC2A 4D0RA 1SZJG 3UH1A 3QA9A 3RBZA 1FDUA 3V1YA 2PKQP 3H9EO 5DCWA 2GN9A 4HY3A 4GAEA 3RASA 5CFZA 5TSDA 3DONA 2HMTA 3FNFA 1MUUA 5LDHA 1PS8A 3KXDA 1VSUA 2Z5LA 1NAHA 4ALJA 3EMKA 4XB1A 3OMLA 1V0JA 1VL8A 3ORFA 1C1DB 1UDBA 4JCOA 1H6CA 4UEJA 5DZSA 2B83A 1GU7A 4AICA 3QE3A 3NTOA 2X1HA 3GN2A 5CDUA 5F21A 2P9EA 4XGKA 1E6UA 3R1IA 5FF9A 3ONFA 1QP8A 4M1QA 4WLNA 2NTVA 1V3UA 1IHYA 4Y6RA 4I5DA 4YT2A 4BOYA 2O4CA 1YQGA 1ZMOA 1EUDA 1EE9A 3I9JA 3M2TA 3ZWWA 3WFJA 1LLQA 4BO3A 1XU9A 5JAZA 3VH1A 2FRDA 1I2CA 4ILKA 1O95A 2OBYA 1QKIA 2JD1A 4XR9A 3Q11A 1G1AA 3ZZNA 1QG6A 4MVJP 1C3VA 4WOKA 3IJRA 4R9SA 3O03A 4PRLA 2Z95A 3QVXA 2JFHA 1LLCA 4O6VA 1XA0A 3D64A 1HDOA 2OOSA 2D0IA 3U4IA 3ZV5A 4BMVA 2Y93A 1P77A 1SB8A 2C59A 3BIOA 5TT1A 3VKUA 1U4OA 3PJEA 1PQPA 3EVNA 4WKGA 5KVQA 4QX6A 2F00A 1T26A 3BAZA 3H9UA 3ZNOA 1TXGA 3AM5A 1Z7BA 2JCXA 1NFRA 5JCJA 4NR0A 4TKLA 5MDHA 4PRKA 4I5GA 4BNWA 5JC8A 1ADGA 1Y8QB 4RVHA 1MXHA 3D4OA 2D1YA 1KC3A 3I4FA 4EI2A 4MJLA 3DQPA 3H6KA 5H81A 3ZHYA 5KTKA 4R68A 4F45A 3KV3O 4ND5A 5ADHA 3C1TA 4B8WA 3EDMA 3I3OA 5JFOA 3PEFA 1EUCA 4YJDA 4KUEA 1P31A 2PH5A 4WGGA 1ZSVA 1WVGA 4UVDA 3WMXA 2HK8A 2Y0DA 1D8AA 3GFBA 5BR7A 1QYDA 2AMFA 1JLLA 3ZU5A 1Q7CA 5A9SA 4KWIA 1O0SA 4YAKA 1KEWA 4ZQEA 5IXSA 1YL6A 2Q99A 2C54A 1UJMA 1T24A 2YHIA 4YT4A 3JQDA 1DIHA 1WPQA 3GEMA 5JDIA 2BHLA 5K9ZA 3VZSA 2RHRA 3Q3CA 3M1LA 1ZFNA 1DSSG 4CLOA 4CMIA 3S1LA 4BNNA 1SBYA 5JDIC 4CQLA 3L6OO 4Q3EA 4YJHA 3FCOA 3KB6A 1ZEMA 4BV8A 4E32A 1CWUA 1I33A 3GC6A 3DTTA 4BGUA 2VTDA 3A14A 3RU7A 4DMMA 1GYRA 3P19A 3L77A 4WOJA 4WPGA 4ND3A 2Q4EA 3KM0A 1EMDA 1E3LA 4N54A 4CMCA 3D0OA 4WLUA 4YWJA 1E6WA 4INAA 3WG9A 4EZBA 4ZQHA 1P1RA 2VNAA 2WYUA 1GEGA 2O48X 5ICSA 4E2XA 2YHUA 2J5RA 2QG4A 2V6MA 1BWSA 2OMEA 3GPDG 4MPDA 2VRBA 1QYXA 1FJHA 1YB5A 5HM8A 5ILOA 1BW9B 4IQGA 1B3RA 2DPHA 1YDWA 5JY6A 3G49A 4FFNA 4BO2A 4WCFC 1PR9A 3TFOA 1QYCA 1FMCA 1GV0A 2O2YA 3WXBA 2D3TA 3QLJA 4M86A 1LRKA 5T64A 5T8KA 4BS9A 4HFNA 3BMCB 4BQPA 5EERA 3KLMX 1XU7A 2Q4BA 5HTOA 3B1KA 3MJCA 4XDYA 5K6AA 3GFGA 3NTQA 4QFDA 1HEUA 4CQMA 4U0KA 3LF2A 4ZRMA 4B7CA 4CMIB 3F3SA 4TKMA 4GX1A 2Y99A 3H65A 2GERA 2FPPA 3CINA 4KDEA 2EF1A 4FBGA 5I9MA 5THQA 1YBVA 4DBVO 1JWAB 3GRKA 1I3NA 3CUKA 4UUOA 2B0JA 1HE3A 4BNKA 2QZ9A 2JAHA 3PYMA 1XSEA 2XPCA 4J6FA 4NFSA 3RBVA 3AM3A 1ZMTA 2V6GA 1OBFO 3PI7A 1BHSA 4LCEA 4CUZA 1O9BA 4CMJA 5L51A 3NT2A 1NX6A 2BMAA 2P91A 3AJRA 4UEOA 2A4KA 5IDYA 4CUJA 4WEOA 2DFDA 2JJYA 4JP2A 4XD2A 5B4UA 2Q46A 4JBHA 3RBXA 4XYGA 4ZVVA 5G4KA 4KQWA 3N7UA 1MB4A 1NFFA 3D3WB 1BXZA 3DZHA 5TF4A 3MJTA 2W2KB 1RKXA 3ULKA 4NBWA 1KVUA 4BO9A 1ZK1A 1GL3A 2Y1EA 3B70A 3FHLA 3ICCA 3LT4A 3T7CA 4CPDA 1Q0QA 4BIIA 1HZJA 3RU9A 4NK5A 1A9ZA 2E6UX 3OJLA 4UREA 5AOVA 3L6DA 1KY4A 3ROPA 5KNLA 4AJLA 1OC2A 4XCVA 5L7WA 4U0JA 4KUGA 1NHWA 3PDUA 3GVCA 3ZI0A 3PPIA 1C1DA 1NVTA 2P4HX 2RH8A 5DBGA 3ADPA 3WICA 3LZ6A 3B6ZA 1LDMA 4IBOA 4IJUA 4JJGA 4DREA 4MVJD 2PK3A 1VM6A 3ASVA 3WIEA 5T67A 1OZAA 1E1MA 4BNLA 1DLIA 1HSOA 5A1TA 4YEDA 2C5AA 3SEFA 1SAYA 3H5AA 1HDRA 5G0VA 3OH8A 3ZDFA 4W6ZA 3WGGA 3JYOA 3DAFA 3HFSA 4IY1A 3AY3A 2Y66A 3H4VA 4BO4A 1A7AA 1ZK3A 4HKTA 4Q9NA 1GQ2A 3HADA 3OIFA 1KOLA 1UR5A 1EEHA 5AXDA 3WGYA 2IXAA 1BVUA 5MGBA 3GDGA 2W2LD 4AJ1A 3JQEA 3NV9A 2H9IA 1RJWA 1ZK4A 3LT2A 4TZKA 4R1SA 1WZEA 2IE0A 4YQYA 4GWGA 3ZV3A 1ENOA 3O4RA 5G0UA 4CM4B 4L9RA 1N9GA 3NJ4A 5LCXA 3WR5A 4NJMB 1H6DA 1C0LA 1YO6A 2WEKA 3NDIA 2WD8A 1QRRA 2J3IA 2YZ7A 1E3SA 1PS0A 3VTZA 4D0SA 1P1JA 3DTYA 5L40A 3DDNA 1ISMA 2PH3A 4ZQBA 1H2HA 1UP4A 1YJ8A 5TNXA 3GG2A 3WWYA 4NBRA 1U28A 1N5DA 3HZZA 1P1FA 1PWXA 1JKJA 4CMHA 4OMUA 5A9TA 3D3EA 2FY8A 3WTCA 4PLPA 5H82A 4YAIA 2RH4A 2X0JA 4NMHA 1YQDA 4KUHA 1CJCA 4DPMA 5I9NA 7ADHA 1E1NA 1MV8A 3CZMA 2AW5A 2Y1DA 3RD5A 2DBQA 2PZMA 1ISJA 3QIVA 4FCCA 4LGVA 3PVZA 1A7KA 1R12A 5JAMA 1QYVA 3D1LA 4FB5A 1W73A 1HYGA 4JN6B 4L73A 2ZYGA 1PQUA 1V9LA 2D5AA 2JHFA 3JQ7A 1GV1A 3UGKA 2UUPA 4CM8A 1KC1A 1B3BA 4UUPA 4FR5A 4HFMA 1R0SA 3FR7A 1ZJZA 2G1UA 1FK8A 4IQ8A 2O7QA 4YRDA 4J1SA 3ETDA 1D4FA 2DBRA 4R5HA 4ZICA 1U2GA 3JQ7B 3KEQA 3DXFA 5KIAA 3RVDA 2VT2A 1IY8A 1PJSA 3DFUA 4J1QA 2CZCA 4PFJA 1ONNA 2YFHA 1MC5A 2NTJA 1VJ1A 4RLHA 1CYDA 1EBFA 4PLFA 3WMWA 3INRA 1AN9A 3DOCA 4RLSA 4CMKA 3I9KA 4YT8A 4I5EA 1E5QA 1W6UA 3FNGA 4ZN6A 4WLEA 1T4BA 3L4BA 1IPEA 1LEHA 4FPXA 4Y67A 4D43A 1LLUA 4BNFA 4XRRA 3WNVA 2WE8A 2ZQYA 1Y8RB 2QYSA 2GPTA 2O7SA 2X7HA 1HSZA 1VJ0A 3CSDA 3GMSA 4EJ0A 4J2HA 4PLCA 2O3QA 4J0FA 4H7PA 5A05A 3OJ0A 2P5YA 4MIEA 4ALLA 2XOXA 3GZNA 2WJPA 1EE2A 4JNKA 4RVSA 2JCVA 1ZK0A 3BMQA 5JBIA 4TRMA 2A94A 2X5KO 3MJ4A 1VI2A 2PFGA 4Q3CA 5B37A 2B5VA 1U4SA 2DPGA 3ZHXA 2GRAA 4P4LA 3SC4A 1NQ5A 3I9OA 4S1VA 3U4HA 4Y6SA 1J6UA 4XEHA 5IDQA 2W4QA 2IDZA 5DF1A 2BH9A 4K1LA 4RQUA 3IIEA 1LX6A 3PJDA 5I9LA 1U5CA 1D1TA 1SEVA 4XJSA 1PJ4A 3Q6IA 2SCUA 3GZ4A 4ND1A 3PYXA 4I9UA 4BKPA 2RIRA 4D7AA 4LSWA 4RVDA 4WCFA 3KLPX 4XWYA 2F1KA 3RUIA 4A27A 2ZJ0A 3QVTA 3WLFA 4OXNA 4AVYA 3GT0A 1QXSA 4J43A 2ZIZA 1ZSYA 1H6AA 4CM7A 4ALMA 4L8VA 1Z7EA 3GVIA 4R3WA 3FNHA 4FDAA 1BXGB 2GASA 3GA0A 4R5MA 1ONOA 1I2ZA 1Y7TA 2AE2A 2UAGA 2A35A 2VNSA 4NH4A 2D59A 2DVMA 5L3ZA 3TOXA 3JQAB 3V8BA 3ZNNA 4B79A 1Y9EA 1ZXBA 2XAAA 1B8UA 1A5ZA 3GRPA 2VZ9A 1E77A 2QZZA 1P33A 4A26A 3NT4A 2AG8A 3Q2KA 3T4XA 4CJXA 3RUFA 1DRVA 3RUAA 2Y67A 2C7VA 2X58A 1QMGA 4UVGA 3MZ0A 4PG4A 1SPXA 5IJZA 4NFYA 4IDDA 4OH1A 3HN7A 1M75A 4TWRA 1HETA 1IZ9A 3PQEA 3ICPA 4XIYA 1UUFA 3PYLA 2GR9A 3ZWXA 3A1NA 3PXXA 1L7DA 4RVUA 4M89A 5FFFA 4C4OA 4E33A 4J9UE 3CTMA 3R0IA 3HB5X 4R1TA 4XYLA 1E7MA 1JDJA 4PZEA 3W1VA 3NDRA 5CDGA 3ZWNA 3ANMA 2ZATA 4L76A 4YRBA 1PX0A 4YBZA 4S3MA 1DC3A 2R2GA 5BNTA 2EKLA 5BSEA 2G17A 4HNGA 3K6JA 2YV2A 2VRCA 1A27A 3W6ZA 3NDJA 3ZWCA 4DLBA 4DC0A 1GCUA 2J5QA 1R4NA 2IZ1A 4R41A 4Y6PA 4OKNA 3AOEA 4J4HA 1LDGA 3BMOA 3PIIA 4ONEA 1NQTA 3EY4A 5HWSA 2NWQA 5JNLA 5HRUA 3JD4A 3AUSA 1T2CA 3V5NA 3PJGA 2VOEA 5TS3A 3PZRA 2ZB4A 5GY7A 1ZSNA 2ZTLA 3ITKA 5I7EA 4DL9A 3BMQB 2X86A 1X1TA 1VLLA 5GZ1A 3L0DA 2BGKA 3I9MA 3UCXA 5K6AC 4HFRA 1GQQA 3WBBA 4BNJA 2X9NA 2HRBA 3DHEA 4PG8A 1PSDA 3BTOA 4B7XA 5KVCA 2JFGA 3F5SA 4OSOA 4K6FA 2D2IA 4P38A 4DIFA 3ZCXA 4E5NA 3DHYA 4BNTA 1UP6A 3P2YA 5U9CA 1LRLA 1HE2A 4J3FA 1BSVA 1YL5A 1ENYA 3S2IA 3D5TA 3O26A 1Z73A 3S55A 4B3IA 2ZTVA 2EW8A 4WNCA 2OZPA 1QORA 4D46A 1RM4A 3C7AA 1DIAA 2VUUA 3GOHA 5DT9A 4CR7A 1LSSA 3KYDA 3IJPA 8LDHA 1WWKA 1PIWA 5EL0A 1LQUA 3ENKA 3GEGA 4BB6A 4TROA 1HLDA 2PGDA 1UAGA 3V1TC 2E37A 3ETGA 1VJTA 3I4CA 4BNYA 4ZA2A 3M1AA 1DXYA 3JQGA 4JROA 4C7JA 5G4KB 4YT5A 5AQ1A 1T1RA 3OHSX 4MINA 2CSUA 1E1KA 3DZFA 4AJ2A 4RZHA 1P1HA 2X23A 3F5QA 5CDYA 2HQ1A 2FN7A 4GKVA 2DQ4A 3GUCA 1EK6A 3MJSA 4P8RA 5A5FA 3T4EA 3GGGA 2GN6A 4FC7A 4ZRNA 3PHIA 2Q2WA 2DTEA 4BMSA 2AHRA 6LDHA 3AOEC 1RWBA 3FWNA 4MVJM 5JW6A 3C85A 4E5KA 2A9FA 5T5QA 5ENVA 2OFPA 4BNIA 3AW9A 4UULA 4E21A 1ID1A 4GBJA 4A0SA 2AEMA 2BLLA 3NUGA 1F12A 1HKUA 1R0LA 1RM5A 2C2YA 1I24A 1PJ2A 1ULUA 3O8QB 7MDHA 3U4CA 5JO0A 3UCEA 4GWKA 4K6CA 4OSPA 2ZYAA 2J6IA 2C82A 1CERA 3E9MA 1HT0A 2YV1A 2GZ1A 1DLJA 3LYLA 4UUMA 3QHAA 5F5LA 4DIOA 2HAEA 1PL7A 2X6TA 3FBGA 4LN1A 3DZBA 1ISIA 2Q1UA 1IE3A 5TQVA 1GAEO 1LA2A 4Z6KA 3VPSA 1C0PA 2VHWA 2ZJ1A 1I3MA 2PGLA 3I9LA 2QQ5A 1Q0LA 2IYOA 3MOGA 3F4LA 2FR1A 4GPD1 1U7TA 4KMSA 4BO8A 3KRTA 3AM4A 2DBVO 4CR6A 1ZH8A 4AJIA 3OQ1A 5KWEA 1YE3A 5DBFA 1EZ4A 3K96A 1GYQA 2O3UA 3HFGA 1ISGA 5L4NA 4MVJF 3JQBA 3PWKA 3PWSA 2BGLA 2E82A 5KOIA 1ML3A 1HLPA 1NM5A 4YACA 1K6IA 3WTBA 1LC3A 3WYEA 1LTHR 2Q49A 1XG5A 3CMCO 2YJZA 4H3VA 5FWNA 1I10A 1KEVA 4OIMA 5C7IO 1R6DA 1YGYA 3PDJA 3KZVA 4EW6A 1X14A 2CF5A 4TVBA 3L4SO 3FBTA 4MIOA 1UP7A 4IJKA 1O6ZA 4TSKA 4XKJA 2HMSA 3IKVA 1MLDA 3WGHA 2JCYA 4WNIA 1DEHA 4LMRA 2DU8A 4RF2A 3LDHA 3TF5A 3DBRA 3V2HA 3GPIA 4IJVA 3T7EA 3GVHA 4TVOA 2JAPA 3I1JA 4H16A 4Z9XA 5JC1A 2I66A 2WWRA 5U4QA 4PVDA 4E2WA 3EZYA 3QJ5A 3LT0A 1XCBA 2B4QA 3FWZA 1T2DA 3KO8A 5A02A 1M2WA 5IZ4A 1P44A 1X15A 4YTEA 3G3EA 4B3HA 3M6IA 4FFPA 3EGOA 1ENZA 3A06A 3L07A 1L1FA 1DC6A 4X54A 2OO5A 1HXHA 3ZNPA 3IDSA 1DRWA 4A10A 1UXKA 4L4RA 3BHMA 3EAGA 3UHAA 5COQA 1PJTA 3IS3A 1E5LA 2XF8A 3QW2A 5G0TA 4OOFA 1NASA 4RCVA 1PZHA 4K28A 3BTVA 1GZ4A 4XYBA 4GGOA 2I3AA 3M2PA 4KOAA 4O59O 1EVJA 2TMGA 2VZ0A 3OFSA 2O4UX 1GYPA 1PTJA 3DO5A 4NBVA 2BKAA 1JVBA 4JGBA 4E12A 3G17A 5JDCA 5KJEA 2YV3A 4J7UA 5BSHA 3E18A 3Q9UA 4OYRA 4ZD6A 3SC6A 4EUEA 3WGOA 1JW9B 3OM9A 3PZBA 3O9ZA 1N2SA 3F9IA 2G82A 5C3MA 3UXYA 1MG5A 1NWCA 3TN7A 2DC1A 2DM6A 2VT3A 4J7CA 3HHPA 2DBZA 5I8ZA 2P9CA 1CQIA 4A03A 1E7SA 4MP3A 5KJCA 2EIHA 2PA3A 3QVOA 2G0TA 2XXJA 5EIOA 3HQ4O 3IAHA 5THKA 4G81A 4TRNA 4GVLA 4QEDA 2Y1FA 1NR1A 2GZ3A 3W8DA 3ONEA 4YJHB 2Y0EA 3GR6A 3D4PA 2HU2A 2X5JO 2I99A 5DNAA 3GY0A 5ER6A 1LNQA 1U5AA 3MWEB 4RVFA 5BNIA 2HLPA 3WJAA 1K2WA 4XDZA 4J9VA 4ZJUA 4Q3AA 1Q1NA 1YQXA 5I7VA 4GX0A 3HNPA 1PS9A 2I6TA 5IN4A 3C1AA 4XX0A 1ZJYA 3VZQA 4RPHA 4URFA 2B35A 1M6WA 2IEBA 1CDOA 4E2ZA 5AYVA 3VH3A 4XGIA 2PNFA 3GNSA 1J5PA 4F6CA 1R37A 2W90A 3PQDA 4LVUA 5EJ2A 5EPOA 4GLLA 5U1PA 3RWBA 2ZKLA 1MA0A 3DBHA 5IG2A 4DPKA 1BVRA 3DWFA 1UDAA 2BFAA 2WTBA 3Q1LA 4UUNA 1DIGA 1MX3A 3EHEA 3VVBA 3Q2IA 4J90A 3DMYA 4EGFA 3ASUA 4BB5A 1U3WA 4E3ZA 2EW2A 1MFPA 3MEQA 1KEPA 2NNLD 3ONDA 5TRTA 4NK4A 4Q3BA 1PGJA 3NKLA 4BO6A 1WNTA 2AQIA 3DL2A 3LLSA 4ZQGA 5L95A 2GDZA 1LRJA 3BXXA 3RKRA 4PN3A 3NYWA 1GDHA 4OL9A 5KKAA 1H0KA 4BO1A 2E48A 4OHUA 3RFVA 4CV1A 2ZCUA 3W6UA 2DT5A 5BSGA 2GCGA 5BNFA 5L4SA 3L9XA 4GSKA 1LSOA 1C1XA 3F1LA 4HADA 1G6KA 5ER9A 3H5RA 1IZ0A 1NBOA 4WLOA 3PK0A 1N7HA 2WMDA 4IIUA 3W4KA 4Z3KA 5AXAA 3PTZA 2NUAA 2DUWA 3RJ5A 4W82A 4E4YA 3JQ8B 2WM3A 2ZCVA 2DKNA 1O94A 1XELA 1E7QA 3BYZA 2BI7A 3BTUA 3QWIA 2IRWA 1QSGA 3VC7A 1M67A 3WGZA 1VKOA 3IMFA 3W8EA 3ZWAA 4W9NC 1GCOA 2HO5A 4QO7A 2CFCA 2PD4A 4GH5A 1FF9A 3F46A 4JJIA 4YJFB 3UW3A 1UXJA 3JQGB 3AI1A 5T8KC 3I6IA 3DAGA 3JSAA 3GVXA 4ROSA 3UOGA 1NQAO 3JD3A 4KTTE 1GUYA 3ABIA 4IMRA 3LF1A 4ZHSA 2I5PO 5B4VA 4YQZA 5COAA 1NPTO 2P68A 3JQ9A 1ARZA 1C0KA 2AEJA 4MP8A 3EW7A 2CDCA 4RDIA 2IODA 3SX2A 2BELA 3C3XA 3TZQA 3VTFA 1JQBA 3WX0A 4FS3A 3RI3A 2WD7B 4PGFA 4QSMA 1F17A 4IUYA 4ALNA 1VL0A 5TJ9A 1R16A 2FZEA 3LU1A 3SLGA 3PFFA 1P1IA 2VUSA 1O8CA 1EUZA 3C7DB 4I08A 2NVUB 3FRJA 3UN1A 2V7PA 4E13A 3KETA 2YQ5A 4NNJA 4CL3A 2CVOA 2UV8A 1J0XO 5L45A 1E6EA 4IDBA 2QHXA 3GGPA 2C07A 4F3YA 1ORRA 3JQ8A 5KVSA 1IPFA 1OC4A 1DRUA 3Q0EA 1ISHA 1H5QA 4XYEA 4BNMA 3WB9A 1DJNA 3O8QA 1WW8A 1Q7GA 4L0QA 2GN4A 1ADCA 2X4GA 4YCAA 1JAXA 4U8GA 1Y5MA 3CH6A 1ENPA 3K2EA 4DLLA 4LRTB 1NQOA 3CZRA 4QO8A 5FEUA 3RSHA 2AQ8A 3OICA 2PTGA 3ADOA 3GAFA 1HZZA 2DFVA 3DBHB 3KSUA 1Y81A 1Z74A 2Q2VA 4NG5A 3ZNQA 2VTEA 5CPBA 2W2KA 5T6BA 5G4LA 3GH3A 5FYDA 4HFJA 1GD1O 4BNGA 1K6JA 1ZEJA 3TZKA 3X2FA 2HMWA 4RL6A 3KYBA 2R00C 4KQXA 3WWZA 2LDBA 3IUSA 4AJKA 4R01A 4YDRA 1GY8A 4EUHA 3MTJA 2VQ3A 4YRAA 2ZQZA 1NFQA 1Z82A 2O3JA 3ZU4A 5JPIA 1SNYA 4YYZA 4QECA 2GZ2A 1C1XB 3ZHBA 1E0DA 2FR8A 5H83A 2PLAA 4CL8A 3P2OA 4NBTA 4J1NA 1RM3A 3AY7A 4DQVA 1VKNA 4GX5A 1DFHA 3WBFA 3G0OA 3TDKA 1ZBQA 3K9QO 3U49A 1SC6A 3ZWPA 3R6DA 4YVFA 1EFKA 3SVTA 3UKOA 4N18A 3MCVA 2BFPA 3ZWMA 4WECA 3GQVA 3I9NA 5JXWA 2EG9A 3OSUA 3R3SA 1WDLA 4IXWA 4N5MA 4JXKA 5CPFA 5JDCC 3TJRA 5CDSA 1LJ8A 1YVEI 1DOHA 1TT7A 1OFGA 5EQDA 1E7YA 1BXKA 3FTPA 4MOWA 4N5LA 5T57A 1D7OA 5EMHA 4IZIA 3JQAD 4XJTA 3P7MA 3U62A 4YAEA 3RUEA 5ICMA 4P4NA 5B1YA 5KJ1A 4BQRA 3LK7A 5FI3A 3LC7O 2HUNA 2X8LA 1ZUD1 3I52A 1IYZA 2CUKA 4R69A 4TQGA 1HWYA 2B4TO 4NHEA 4CM9A 3V2GA 5ITVA 3S8MA 3QWFA 3JYNA 2B37A 4CQMB 1LDYA 2Q2QA 1PZFA 2JHGA 3PGXA 4O1MA 3WSVA 5DCYA 3S2FA 1H93A 5L7YA 1RM0A 4GVXA 4RGBA 3GHYA 5EN4A 4XQGA 4BL5A 1PGOA 5JYDA 2VOJA 1YH3A 2B69A 5FI5A 3K30A 4MVJH 5EESA 1Q7BA 2UDPA 3DOJA 1CEQA 3W8FA 4M54A 1U3VA 2O3RA 5KKCA 1KERA 1JKIA 2NVBA 4OKIA 1I0ZA 5JLAA 5G0SA 1DFGA 3HSKA 2ZTMA 4OO3A 4QQRA 1ADFA 2TMDA 1SOWA 2OHXA 1EVZA 3K73O 4L4XA 1H94A 2Y1CA 3W4IA 2O23A 3ZW8A 2HK9A 2HSDA 4I5FA 3OQ6A 1B15A 5DP2A 4BO7A 2PZKA 3U5TA 4DC1A 3GDFA 1J4AA 3QWAA 4OAQA 1GPJA 2EGGA 1YWGO 3GAZA 4Z0TA 2Z1MA 1NHGA 4MP6A 4NPCA 5EINA 1GFSA 1U8FO 3ANNA 1U3UA 4DQXA 3IKTA 3IUPA 3PIDA 2C2XA 1DHRA 2B5WA 2P5UA 4JIGA 4P4GA 3VZRA 1XR3A 3ZH2A 4CV3A 4CLOB 4MO2A 1S6YA 4U6SA 1ISFA 1ZCJA 3AK4A 1A9YA 1AUPA 4M49A 3ZWYA 2RCYA 5HBRA 4EEXA 4B8ZA 2HJRA 4G2NA 1KETA 4PLTA 1H6BA 4MVJI 5L4LA 1GUZA 3WFIA 4AL4A 1W0CA 1YL7A 2X9VA 3AU8A 3JQ6A 1C14A 4OM8A 5HS4A 2P4QA 5BSFA 4Z9FA 2EV9A 3U3XA 4W9NA 4FFLA 2GN8A 3ZWBA 5IDXA 4WCDA 1BDMA 3U09A 5CG2A 2J8ZA 2Q3EA 2UYYA 1NVMB 3GEDA 1IL0A 3H7AA 4AJOA 4O63O 3IP1A 3AI3A 1XQ1A 3LVFO 4IJWA 5TT0A 4OXKA 4IXTA 3CKYA 5A9SB 1TA4A 6ADHA 2B4RO 3DOOA 1R0KA 2O2SA 1PU2A 2D4AA 1N1GA 4WJZA 2EP7A 1H9AA 2J5KA 3U4DA 4R51A 1DAPA 1E3EA 2AQHA 4U6QA 3E48A 2EKPA 4NI5A 2HRZA 4II2A 1DFIA 3H2SA 4GSLA 2PY6A 2VYVA 3KHUA
chains in the Genus database with same CATH superfamily
4M9XA 4TXHA 2ILVA 1FRVA 4MIYA 1QF7A 3GGOA 1I7LA 4IICA 1OXXK 4ZCLA 3C1OA 1GLGA 1CPYA 1QAQA 2EEPA 2Q1TA 3EZ9A 1RQLA 2B8WA 1Z7YA 3IH5A 3OECA 1UBRS 1WZIA 4LHYA 5DH9A 5KCMA 3SJUA 3MPOA 3UWSA 2ORED 5JATA 3SHFA 5A4JA 2IHNA 3E27A 4QKQA 5LQNA 3PTAA 2ETVA 4XZ3A 5JIBA 1BJRE 1OKKA 2FZLA 4RORA 5GPBA 5B2ZA 2QLNA 2O7RA 3WNQA 2XRMA 3BJZA 4R0VA 1NAIA 3SEQA 4PNPA 3HXQA 3SHOA 4BKMA 1GGVA 2A9OA 3FOAA 3FHJA 3ZLJA 1T2FA 2VSYA 4IQ4A 3L8FA 1MC4A 4C4PA 3NPMA 4BRUA 1QHHB 1IVSA 3G0CA 3WSTA 4C6SA 2EP8A 1AKYA 1I4LD 1GTJ1 2UYQA 4EPRA 2CVPA 1KKUA 4GRAA 4OU4A 3FCEA 2R8OA 4B46A 2XTAA 2L2QA 4ZGWA 1X6VA 2IF0A 4J49A 4TKUB 4BP3A 1USIA 2R6HA 3TS1A 1V5WA 1E3WB 3E23A 4MZDA 4C2TA 1N2CA 3DEYX 3LCUA 1SD2A 3U48A 2YV4A 4DRYA 1RZVA 1SCJA 1NVWQ 4Q39A 3V1NA 1EQUA 2PRYA 2V6BA 1OZHA 1T1EA 3S27A 1RRFA 4QIHA 4D79A 1CUEA 1DDOA 1BMDA 3KJXA 3WOHA 3A27A 2J0VA 1NV9A 4DRXB 4TLAA 1Z4OA 1SUSA 1T8PA 3GN1A 1YDEA 4WXYB 3TLBA 4C6RA 4ENSA 3CNLA 3O21A 5KJFA 2OGSA 2GO7A 2R87A 2PTHA 1G60A 1P1KA 4LGMA 4P36A 3L7OA 5DM1A 4RDHA 4OYYA 1QV9A 1GPDG 2G4LA 5L3QB 2WD9A 1NNI1 2NSHA 4NJEB 5JD4A 3PPXA 3QWHA 2Z9BA 2ONJA 2JJ8A 1DS6A 3QKRB 1CY1A 1OFTA 3UH0A 4RV9A 5EI5A 2IU4A 1W1WA 4FXPA 1KAGA 4DUYB 1O54A 5LZ5A 3BE6A 2RC6A 2EXXA 3ES9A 3KT3A 1E9EA 1G8SA 2IC5A 5JS6A 1WKVA 3GDOA 2VSFA 1N8NA 2R48A 3I6MA 4JWTA 4Q02A 3T35A 2R00A 3A9SA 4E31A 3WK9A 1YRLA 1AQJA 4O4IA 5B1SA 1VG0B 3MWDB 3NALA 2OBBA 1Y6RA 8GPBA 1YXMA 4D8TA 3T3GA 2XYPA 4K9LA 4KN9S 1PVDA 1UH5A 4Q3NA 4WK6A 5HS6A 2WYVA 1U7UA 2PGJA 1ID8A 5EKXA 1CHNA 2I3DA 1N6PA 1DO8A 3R0ZA 4JCCA 4XIIA 4BV3A 1L7EA 3RT7A 3BICA 3DD1A 4QDTA 2G67A 4IOJA 3WLRA 4DA0A 3D6AA 1XTKA 4X7MA 2AG5A 1GOTA 4DNQA 4ITUA 1Y33E 4HVLA 3IGFA 1Y5RA 3FUCA 1R3DA 1GTZA 1OVMA 4IIEA 4ZO7A 5K20A 5KX5F 1H2BA 2N75A 2ZSEA 4ZI7A 5FUMA 3A7DA 2XBUA 2IZ6A 1ZKDA 3ZE1B 4ETNA 4PLYA 2JLRA 1JNXX 2I8AA 1R4MB 2A9PA 2VP3A 5CP8A 4JEIA 3V4ZA 3W6NA 1MDFA 1Q57A 4C4SA 5B12A 4C4XA 1EFLA 2X5OA 1K5DA 2JEOA 2HSWA 3JALB 4JBNA 1QGDA 2GEVA 3AEZA 2HHHB 4H1TA 2YYYA 1WO8A 2IYQA 5AMXA 5A6SB 3H0CA 1QYIA 1CUFA 1LGYA 1VP9A 4G65A 4Q4DA 4MDHA 4WFIA 3AYXB 5H1YA 1DO0A 3G68A 1FYDA 2Z9CA 2WSSD 1U3TA 4RPJA 4NARA 2GD1O 2QD5A 1NBMD 2Z6UA 1I3LA 3G8DA 5H3CA 4B4WA 4RD2A 4D42A 1KY2A 2FGJA 1A9OA 1P19A 3FGPA 2UUOA 3PQCA 5JO9A 5BUQA 5TLSA 2WJ3A 2A84A 5AJUA 4NAHA 1EUQA 3ZKWB 5A1JA 4JBGA 1LZKA 3LKDA 1Z6PA 2D5CA 2GYYA 3M6AA 3WL4A 2B94A 3OA0A 3UTCA 4AP5A 4EIWA 3CSSA 3HDVA 4XGNA 2PEYA 2UYOA 3BD9A 1H1DA 4DBZA 2VHEA 1JQEA 1PEKE 4MCJA 3DFFA 1TYAE 4HV4A 3O3MB 4ZVUA 1A50B 4YS6A 4B0PA 7MHTA 2AW3A 5FEMA 1JR4A 3DP7A 4LVCA 3O4FA 4FSXA 3PGMA 5CLLA 4A0RA 2ERYA 3RG8A 1PX2A 2W8ZA 4DLVA 2PXXA 3HSSA 1QFMA 3I30X 1J56A 4PAWA 4JA2A 4RK4A 3HZRA 2IHVA 1G9TA 1U8YA 4M37A 1YBAA 1JH9A 3FVRA 5AW9A 4DR6B 5BURA 4OV6B 3EGCA 1I2AA 5A03A 1UZMA 1VE1A 2DQKA 2OP0A 3KQWA 4GXRA 4KQ1A 2PX5A 4KDCA 4AQDA 4F97A 3IAXA 3IVAA 4LWQA 1E3MA 3LY9A 5I7OA 4D9JA 1P2TA 4OQPA 5C1DA 3VPGA 5BV8A 2IY7A 2VNIA 1UBUS 3C3YA 3E9NA 3K5WA 4UM9D 1GTVA 1N75A 1AM4D 1GXSB 521PA 5CIWA 1NKVA 1T1SA 2QS9A 3PC7A 1N0HA 4RSMA 4DSUA 1X8KA 5EP3A 5EE0A 5FUWA 4TTVA 4B48A 1JEEA 1RHJA 2FZKA 3DE1X 3HDHA 3M82A 3N2NA 4LK3A 3DDCA 4CUKA 4LPSA 2IEZA 1CVRA 5DNWA 3VPCA 5SICE 2AMVA 4OHFA 4XWTA 5GAJA 3HKBA 1SUPA 2ATXA 3OCYA 4J4BA 3RVPA 2NUBA 1MX1A 3X1DA 1IHXA 2BBTA 2O8BA 5BYAA 3INYA 1UINA 4QUBA 4BMNA 1Z0DA 1J90A 2WJVA 1QV6A 2XOKA 1F3LA 2DOKA 3EPRA 4MW7A 4L78A 3WK5A 5E6SB 3E82A 2NQTA 1DCMA 1GNVA 2ZB3A 1KYWA 1YZGA 4ZAXA 1GG8A 2XDAA 1ZICA 4RNDB 4JKOA 3FYCA 3JQBC 2QTWB 3D2LA 8ADHA 1SBIA 4ARZB 2C3MA 3HCBA 2WQ7A 3S2EA 5A2GA 4RXUA 3L01A 3SKVA 3N0VA 2REBA 5TDHA 5CD9A 5L3SB 4YO7A 3FHCB 3W5IA 2VEOA 1CUXA 3BULA 4QHSA 1WBDA 1E1RA 1VBFA 3LHIA 1HL7A 2HWUA 4RPGA 4BWVA 4JJEA 3ZZ0A 4I1YA 4AECA 1E94E 3NJRA 1K7SN 3BZBA 3M9XA 2HXYA 5DYNA 5ILGA 1QBKC 3PNVA 1EQ2A 3MWYW 3QK7A 4Y2QA 3T5DA 5DTIA 4Y1RA 4B40A 4EA8A 4M36A 2DSNA 1ZA2A 2VH5R 3D5QA 1LDEA 1WDKA 2VPWA 3HXTA 3IBCA 3JARB 4RPLA 4FDVA 1I3KA 1SQFA 2N9UA 3BE4A 4G5XA 1AZLA 1QJCA 2ATCA 3VKWA 2BYTA 4KMOA 4D3DA 4WE3A 4CLDA 4WRRA 1KAMA 1IDOA 3I92A 3ZDXB 2EARA 5LXTA 2C00A 2HFKA 2EHDA 3ZXUB 3GNQA 4CMEA 4XVCA 4BGIA 4K9KA 2PT9A 4I8XA 3PLRA 4OTZA 4J1TA 3IVGA 3U3ZA 3FR8A 5AHXA 2E4YA 4NENB 4MQLA 2ZRJA 3GJ3A 1ZXLA 2P7HA 1S1MA 2VHZA 4BVGA 3DTVA 3ILVA 4JENA 2OGWA 4G0UA 2JL1A 4TV9A 1E61A 2R7AA 1OOEA 2Y0PA 3FIJA 2QZ4A 4Y98A 2OLKA 4YREA 2PMEA 1EHIA 2OCYC 5DP1A 4N12A 3PXUA 4Q3KA 1T0UA 1RYEA 1MC1A 2PSSA 3NHZA 5ERXA 1KJIA 1A2OA 3CEAA 3DB2A 1TIPA 2C4MA 4PSDA 1D2NA 5AH0A 1JMKC 4P22A 4MCAA 5AHRA 5HIJA 3UVEA 2WIAA 2J33A 3ZHOA 2JFZA 3V1UA 4RELA 3D7SA 3A9WA 5AVOA 1N3BA 1LXCA 1AGYA 1LFAA 3ETCA 2M98A 3WJ1A 2PX8A 3COZA 3CPEA 3WIOA 2I91A 5GOTA 4BYGA 3G5TA 4HBGA 3RHZA 2BRUC 4DIBA 2ZIWB 4GXQA 5FUXA 5HKAA 2J6BA 1PZGA 1XRPA 4FMCF 5AHOA 2BEUA 2H2AA 2JW5A 3HBFA 1EDOA 3O5AA 1RD4A 3VQTA 5FOQA 2E55A 4UMEA 4P4SB 3IULA 3Q5EA 3KJZA 2ZBQA 3O74A 2ID4A 3WAJA 1P2GA 3BMOB 3WS7A 5E4TA 2IYZA 3BGSA 2VWHA 1BA3A 3L06A 1P3Y1 1B7GO 2FQYA 4OB7A 4TQAA 4Y2RA 3V8EA 1YRHA 4M7PA 4DSAA 1ECJA 3NNNA 4X45A 1CY2A 1L5KA 3V4RA 3JQAA 4TXLA 1HDYA 4D92A 2ZSJA 2XYVA 1IK6A 3DM5A 4Z86A 5LQUA 3IAS6 3N75A 4E30A 1FC0A 3GLRA 1NURA 3C5HA 4QICA 2RJNA 3FVTA 2WE7A 1XRQA 2BUBA 1PG2A 3HM2A 4EHDA 1RYFA 1OFVA 3BEDA 4E70A 2MR6A 2A0KA 1QHGA 3ESRA 1PR5A 4M0DA 4RUKA 3RAJA 3BQMB 5M2QA 3KQTA 5E4FA 4KIJA 2PHZA 3PL5A 2R65A 1IUKA 2VNKA 3PKIA 3MJRA 2OCBA 3PDIB 3PHJA 3HLTA 4KZPA 4LHWA 4QUAA 4D98A 5IZCC 4EYGA 2ZB8A 1T9GS 4JLJA 2FOIA 1ND5A 5LYYA 4AZ0A 4ESOA 1TAGA 3KEOA 5FUYA 3E03A 3LWDA 1W36D 4ZYXA 4TVSA 3GA7A 4TL8A 5H7XA 3U40A 5IS2A 1E2JA 1OFUX 3RROA 3VJLA 4MR8B 1AXRA 5ITSA 1VLHA 3PXBA 4JK3A 3DNMA 4HZUA 5K8JB 1EFPB 2PJRA 2HUPA 5J2TF 1M8PA 4EDHA 2HV9A 3QVGB 1FOEB 4M2LA 3FPFA 3T5BA 1W2WB 2QOEA 1LCIA 3AUTA 3TSZA 4DMCA 4EATA 3WGIA 4ZRDA 2ZRCA 2EP5A 1SY7A 2ANBA 3BMNB 3I5UA 3KOOA 3Q87B 4BTVA 9GPBA 4ZYUA 1TO1E 4UW9A 1SJ9A 1YOVB 2FFJA 1L4GA 5EVJA 3WYCA 3IEXA 3AV0B 3U2QA 3KKNA 1E64A 2AFIB 2G7MC 3ER6A 3QBJA 4U7FA 2ZRDA 1Z5ZA 1M76A 4U2BA 5KDOA 1UWKA 3BWYA 3AZPA 5ISMA 4KXQA 1W29A 2WVJA 3COSA 2LRHA 1SXHA 4TTAA 1G38A 1BU5A 1TB4A 2FR0A 4UEKA 5SZKB 4B1FA 3LOQA 4NJOA 3SNKA 2YC2C 3QF7A 4AJ4A 5A3JA 2VP6A 1KFCB 3VR4D 3G9ZA 3F2VA 4J7XA 4RV5A 1CC1S 1QTQA 3P0IA 4MAMA 4OHMA 2C2BA 4OQZA 5DK4A 1A97A 3WIBA 4ZTBA 4YYEA 1TT5B 2ZIXB 4OREX 3GJ5A 4X60A 5C1PA 5M7EA 4JI4B 3LT5A 1V6AA 4RY8A 5CH5A 3CLHA 3UTDA 1SG9A 3HNOA 4PBSA 2QGZA 2QT0A 2WMYA 4JC8A 3BWXA 3C3PA 4N5NA 2WUEA 2BFMA 3OIGA 4O4JB 1KAQA 2D2VA 2R6AA 4U5XA 1LNZA 3EG9B 4OQQA 5ILQA 4B5LA 1XRLA 1Z47A 2CK3A 1EWVA 2BSXA 3COYA 3ELBA 3F3MA 1PGQA 1QMPA 1SIOA 3KSZO 3L49A 4DIEA 4BO0A 3CWZA 4FN5A 2PD6A 1UBLS 5B2EA 1T6YA 1ZYUA 1QIIA 3R23A 4YAUA 2BHSA 1T8YA 4B34A 5DHFA 2F43B 2QRPA 4IIJA 5IC4A 2C0CA 1L5YA 3A28A 4UMDA 5GVSA 2YMMA 3W6PA 1NNLA 1Q1EA 5E0KB 1I32A 2HCTA 2HTEA 1T25A 1M2VA 2J5BA 4KW7A 3NRCA 2Q0HA 2GZDA 4QTZA 1EDZA 4X1IB 3UYLA 2H1SA 3HBJA 1HE5A 1V4NA 4J76A 3HC7A 5TC4A 5SZHB 1JHRA 2DQZA 5HYVA 1PKEA 2ATVA 4DMHA 3GJ8A 2ECQA 3HY4A 3NIDB 3VYRB 3WIDA 1XALA 2DJIA 1G0OA 3RE1A 1GM5A 2X41A 3C7CB 3EIWA 3W9SA 3MYRA 1PFGA 5CLGA 1XKTA 2KS6A 2FMTA 5DRTA 1NLFA 1WHSA 2NV2B 4E5YA 2Q9BA 4I66A 4TTTS 5B1IA 4EYQA 1K0UA 4CEIA 2PMWB 1ACMA 1KSFX 4I4TA 1AGNA 1PZMA 4EITA 2ILTA 4JNCA 4ZCPA 3O1IC 2HOQA 5TGTA 4YCMA 3BZUA 4KODA 4FUTA 1RJGA 3BOSA 1EVLA 1JMYA 3UT6A 2AJLI 4NHOA 5L7TA 2X22A 3BB3A 1YBMA 3IOMA 2GS9A 2EWVA 1LVGA 5AKIA 4Z8XA 1MNQA 2ZSBA 1QHIA 4WA8A 4DW8A 4MKZA 5KWJA 1AKEA 1KSHA 3DLAA 5EXDA 1OI3A 2HGSA 3G0GA 4HEQA 4ND2A 4MVJG 4BWYA 3VYTB 1LBEA 3KJFA 4US1R 3NHFA 4ZT5A 2EFDB 4Y2HA 4N7RA 3OM8A 3CRMA 2B8JA 2QP9X 2X2PA 3PKZA 2HJSA 2A33A 3B3JA 4WFJA 4MUAA 1J8VA 4A8JA 1KBOA 3HJAA 1G2PA 4A6DA 2WLSA 5DN6D 2DTXA 1KK1A 3DBLB 1ISSA 3DMTC 4LRYA 3I2FA 4TT3D 1KGDA 4UNNA 1URPA 4WKNA 3PX3A 4FW9A 5UKDA 3RVRA 1OXVA 2GETA 3TI9A 3VH4A 4B3FX 1N2ZA 1V5EA 3EWSA 5FRDA 5CVTA 1N92A 3HR7A 3UV6A 5CD1A 2GKGA 1NI4B 4J2TA 1N4DA 1R88A 3ISJA 2V6FA 3DDOA 3OZ7A 5F7JA 3REQA 1IEXA 1UBJS 4HC4A 4TLDA 4DDWA 4PN7A 2HJHA 2P9JA 3FH0A 2WPDD 3FB4A 3FPKA 5B3JA 4DCVA 1K6XA 1OMOA 2YYZA 2UZ1A 4AURA 3PFGA 4FFBA 4COKA 2IYFA 4HNQA 3V8QA 2IUFA 2IIQA 2GHQA 2I71A 2XDWA 2KSQA 2VF8A 3FAKA 3M6WA 3F1KA 3GEHA 4YI3A 3P9IA 3AUKA 4CM8B 1JR3D 1R50A 2WP8J 4W4TA 5F7OA 3GPLA 5L6MB 4NEHB 4YFVA 5BMOA 5MN6A 4F3CA 2WSIA 2XYQA 2PZLA 5AW6A 3Q8KA 2NP6A 1RHUA 2FXVA 3KLNA 2FW8A 4X1OA 4X7PA 3AG5A 4P58A 2PVSA 4M1MA 5JMPA 2VK1A 4ND8B 4ZCTA 5JLJA 1U1IA 1XVAA 1TM3E 3MWLA 3OFVA 1WLYA 3ZHZA 4NU5A 2R1VB 1O4WA 4F6LA 2WJ6A 3BRWD 4C3UA 2TSYB 5ENDA 4EFNA 3FPSA 3VO2A 2R7NA 1UBOS 3VH2A 2XKKA 1YZUA 4WV3A 1N0WA 1CS4C 1ODCA 2WWFA 4A2CA 1LY1A 1YQWA 3KQYA 1CQJA 3KJGA 4Y1GA 4TPKA 4R8RA 2XMGA 1ECLA 4DLYA 4F5EA 4BKUA 5A4IS 5TF0A 2QUIA 4D8WA 1CR1A 3BMCA 6REQB 2W2VA 3FVQA 3OEWA 2ZJZA 3PE6A 1C3JA 1HOTA 3ZI4A 3ZGOA 3C3KA 3IO5A 1HNXB 1KXZA 5BW5A 4HTFA 4KFTA 4UATA 4BJ5A 4LW8A 1P0CA 4URVR 4LQ4A 1XF9A 2GN2A 4MEBA 3V3TA 4ZTUB 4JYPA 1N3LA 4FLEA 4HWKA 2NU9A 3VU9A 2FJPA 4P2BA 2BD0A 2UZ1B 4JLKA 4Q9DA 1E0SA 3WGVA 2IZZA 2YMLA 1CRWG 1MTOA 1EPUA 3PFCA 4MQ5A 5CX4A 4INZA 3SNHA 3RIEA 1B74A 4WKOA 3WGQA 4NOKA 1A72A 1LLFA 1B8VA 1N2IA 1NMQA 3ORQA 4RO0A 4N01A 1Z3IX 4RLQA 3B1JA 3ASZA 3ROFA 2ZWMA 5E2IA 1XWWA 1OCEA 3ZK9A 4BN5A 1XCOA 1NXQA 4CEHA 9ABPA 1NR7A 3IXLA 1CUDA 3KXKA 5DM70 4L8YA 1S5PA 4EJ6A 1IIBA 1SVIA 3B78A 1IHPA 3FZGA 3GAMA 3E61A 3JWJA 4OHXA 3W9YA 4C87A 1RLIA 2KBEA 2QR5A 4CKBA 2H9YA 4PZCA 1ACLA 3FRHA 4Z7OB 2FPRA 3P26A 4EKGA 3TPFA 2YDYA 3B53X 4CIVA 1ZN7A 5B6JA 3I09A 1K66A 3OE4A 2OXFA 2AOWA 1VRVA 3NXSA 2WQ6A 3THXB 4R81A 2K4MA 1JSRA 4FNOA 3LUKA 4IDNA 3WNDA 3GUYA 5K01A 4AQ7A 1Y8QA 2AIRA 2O3TA 3OZXA 1FXSA 1T1JA 4RVCA 2SHKA 2LWIA 4NCHA 4RKYA 4UCFA 4V0QA 4YP5A 4XWKA 3ZBUA 1JKFA 4FR0A 2P2SA 5JVDA 1Q19A 3H9GA 4JQYA 2VLIA 3CH4B 4BVHA 2FZ5A 3N7AA 4DNFA 2VLBA 1M6YA 1YR1A 2VT6A 3DQZA 3H8VA 3GI1A 2GJ8A 2OAEA 1IB0A 3KTAB 4Z9BA 3TX2A 5CT6A 3VISA 3GP5A 3WAGA 1RYDA 2HA0A 1D8TA 3DQQA 3O3NB 2IHBA 2MINA 4DHWA 3WWDA 1P3DA 2DJ5A 2PGNA 2QX7A 4PLHA 5CEJA 4Z4HA 3ZTWA 2DUMA 1TEHA 1W5TA 3NLLA 1ZWLA 1CNFA 1KZYC 4KQ9A 2QGFA 1JBKA 5FOTA 3F7NA 4L4SA 4DWVA 1CVIA 1Z06A 1DWQA 2R8PA 2JFXA 4R6WA 1T9HA 4OL0A 4YJGA 2QAIA 5F2EA 4OXIA 1KOFA 2I4LA 4N47A 3OZTA 4I7EA 4BNZA 4S1TA 3I39X 4YMLA 4UOZA 1CR0A 4JJ4A 2WWYA 4NU0A 2GNAA 3N28A 4KI7A 4KPUB 3KD2A 5CNKA 4C0AC 2G76A 2ZTUA 4DPLA 1U80A 4JS0A 2CDBA 1VZ3A 1IJFA 3QY9A 4JT9A 2POQX 1B2LA 4PPYA 1RIFA 2FMKA 1C7IA 3AESA 5G1PA 4RK5A 1VPDA 1LI5A 4OHCA 1V7PC 5JXHA 3QX9A 2FTKE 2WWWA 3O4VA 4GKBA 3BTSA 5GONB 5JD5A 2NIPA 1PJAA 4WUTA 3BA1A 1XZIA 1B6TA 4UD2A 2ACVA 4RNCA 4RETA 3ZY4A 4LF7B 4AMYA 1RI5A 2H65A 3Q3JB 4TRJA 2NMVA 1N2OA 4MRAA 4ZIRB 3KJHA 4JYMA 1W25A 3A4MA 2IYPA 3MTGA 3PNKA 1LSJA 5LA6A 4AFNA 4GMFA 2JLVA 2XMRA 3X1MA 4KX5A 1U0TA 2QA5A 4WW0A 3TLAA 3TM5A 3C48A 4C20A 4M9RA 3ZDQA 2BM9A 3BB4A 1BFUA 5E8JA 4EAQA 2JVJA 1TT5A 4M0CA 4YJKA 4Z3OA 3MCWA 3MCAA 4I46A 4MUNA 4C3OB 3G7UA 4G5SA 4MQEA 4CMGA 1RABA 2ZBUA 1MB9A 3E2MA 1PW5A 4CF5A 4LF4B 4AQYB 5C1BA 4GOKA 3STHA 2HQSA 4C1BA 1QCYA 3R0JA 2PWPA 4PG5A 2R1TB 1LFDB 4QJIA 2J3HA 2XE7A 3DMNA 4BQOA 4CTOA 5E6UA 3TBHA 1IZ8A 4LTDA 3MF4A 4MX8A 4NIMA 4BO5A 4GMGA 1ZI9A 4JC0A 5B58T 2IXFA 4K81B 1E7RA 1OXUA 2G88A 4XVHA 2QENA 4ZVOA 4DA4A 4DV5B 2QV0A 2F8SA 2PZAA 3SIRA 2DR3A 4C2BA 2F55A 2W6MA 1T4CB 1TLTA 4RVOA 5FPPA 1OB2A 1PD0A 3B1WA 1EUCB 3WB2A 2C4NA 1TM7E 5AW3A 4CXMA 4C3ZA 4D9BA 2ECFA 2P2ZA 1JIIA 2A14A 1RT9A 2YQZA 1ZONA 2RK6A 1Z88A 3QPDA 1DIBA 2C84A 3KYCB 5TIIA 2J09A 3AUAA 1KEUA 4MPTA 3ROTA 2W58A 4DB4A 1FFXB 1CJBA 1SXJD 2E3JA 3BGVA 3GRYA 4H0FA 4A3SA 2BDUA 4QOIA 1E20A 2EERA 1NVFA 4CCWA 4QSHA 2CHEA 2Q8PA 2K7ZA 4QPDA 3SXPA 5L9AA 5A06A 3FDZB 4G5OA 4GLFA 1G59A 4GMDA 1JA9A 4LX0A 2XGGA 4M0KA 1LI4A 3GUUA 3PCTA 4M55A 3T1NA 4PCVA 1JMVA 3LHDA 3JD1A 2YHBA 1OA0A 4LOKA 1OWPA 2FN3A 1ABBA 1B8PA 1GAXA 4D0RA 2VDMB 4HBZA 1I4DD 4I14A 3UH1A 2EBFX 3QA9A 3RBZA 5IYZA 2CE7A 2VHJA 2GN9A 1S2OA 2F2TA 3L6UA 2ZETA 1G4AE 1JB9A 2ACKA 3OO0A 3VUFA 2A5FA 5F3WB 1XNJA 1IBRA 2YINC 3O8NA 2QRZA 3L05A 2X9LA 3Q2OA 3KXDA 1SZDA 3TLMA 1I1OA 2QI9F 2RFLA 2Z5LA 2AS0A 2M32A 4XB1A 3D8SA 4X84A 3PRKE 1JKJB 2CUNA 1VL8A 2QLMA 4LDJA 1QZTA 2JNWA 3HVIA 3STUA 2QUAA 3OIWA 3X1JA 2FPUA 4JCOA 3AONB 1H6CA 4RMJA 3RF6A 1EM8B 5DZSA 1IAVA 1GDDA 3NTXA 4PX5A 1CIJA 4I4IA 3I64A 5A6SA 2ZIVB 3QV2A 2CEKA 3AW8A 3EGVA 5BO5A 2RHDA 3GQBA 3II6X 2VJNA 4P31A 5FF9A 4B83A 3WK7A 4PZAA 4EY4A 3ONFA 1ULTA 3PJRA 2IW1A 4JZKA 4AKSA 1OH5A 1C4XA 3BN3A 4P33A 5DWQA 3OM1A 1X42A 5BOVA 4YT2A 3IAUA 5EEHA 3ZDZB 4B81A 3L7AA 1TZBA 1H8HD 1YQTA 2J0UB 4P1ZA 1ZMOA 5B53A 4EB0A 3DOHA 1UADA 1XD8A 2EKDA 2EX4A 4K8RB 5TQ0A 3EEOA 3FYSA 5IT4A 1K3UB 4OB6A 2FRDA 1V5IA 3UKDA 2F9FA 3CLTD 4JYAB 4MGIR 1G1AA 4OI2A 3C3BA 4I19A 1EUDB 5CXUA 4Z7QB 2PRJA 1ZLYA 5DHPA 3QUAA 2OK8A 4QBKA 5ALZA 1GKLA 4ZI7F 4OHPA 2Z95A 1PWEA 5AI8A 3L7KA 4R0MA 2O19A 4FLFA 2A4MA 4O6VA 4D44A 4F92B 3I8OA 2Y93A 5G3YA 1AG9A 1SCUB 1Q7TA 1XJ0A 4F91B 4FE4A 1UANA 2WHPB 5FPKA 5TQ2A 4L8WB 1PQPA 3MK31 4I6EA 4IUDS 1L5LA 1ADJA 5LNK6 4BPBA 2VXBA 3O0TA 1WTAA 2F00A 3G85A 1IXZA 1NBME 4Y6LA 3ZJYA 1MQ8B 3EXEB 3S29A 5JNSA 3SKXA 4HDAA 4NC9A 1RMYA 2QJOA 2IYAA 2NVOA 4I5GA 4R31A 1PSZA 5JC8A 2ASEA 4RVHA 1MXHA 2HWKA 1I0IA 3BBLA 3D4OA 3I4FA 4C4AA 1BAPA 2HPZA 3D7MA 3DQPA 1NF8A 4AJ9A 3ZHYA 5D2CA 1K86A 4HDQB 1XZAA 4Q05A 3K9CA 2Y6VA 3PEFA 2FSPA 4WZBA 3T5AA 1G21B 2KJQA 4PGAA 1ZSVA 1ODLA 4MR9B 2HK8A 3V46A 3FFTA 1G3IA 2EYQA 2I8CA 3TQTA 3FKJA 1P72A 1JLLA 1PT7A 3FUTA 4W9RA 4RTQA 4DR3B 4WZBE 2V1UA 4HEA6 5KPDA 1O0SA 1ZI8A 4FHZA 1JT9A 1AX9A 4X3PA 2JEYA 3V4SA 5KTNA 5AKJA 3TXYA 3KUUA 4YRTA 1YL6A 3WLLA 2C54A 2OSVA 3GYGA 3ZWKA 4DJEC 4YT4A 4ZODA 4HATA 4UE6A 5AVWA 3TVTA 2RHRA 3TCXB 3O90A 2WWIA 2X5NA 2PUHA 4CLOA 1LX7A 5KAPA 3S1LA 2AI3A 1QGOA 4JFRA 4M53A 3ZUGA 4DUZB 3NBQA 1FSFA 3GLVA 2YWDA 4QG7A 3IPYA 2JIPA 1JIKA 5AD1A 2PUGA 3IAM1 2Z2YA 1ZEMA 2QTZA 4NG4A 4GKJB 2QL6A 1GYRA 1ZUNB 3L77A 4WOJA 4CFZA 3B9PA 5BW4A 1X8JA 4N54A 2GF9A 4R84A 3G23A 4WLUA 3HB1A 4YP6A 4YY3B 1M74A 1X19A 1NBEA 4G8DA 1KJWA 4YWJA 2L19A 3F49S 2JDID 3UGJA 4EZBA 3KD3A 5HM6A 1EA7A 1P1RA 2WYUA 2YHUA 1F2UB 1BWSA 3KVYA 4X63A 3NBKA 1XE3A 1Z6GA 2IOFK 2ZKIA 2ZE5A 1MVLA 4O02B 4RH0A 4YO8A 1QYXA 1FJHA 2WFLA 3JVUA 1L5WA 3V4LA 5JQWA 1HM5A 2X6QA 5AM4A 1S9DA 2PSHA 2V4MA 2WWXA 2FUEA 1W49A 2ZPUA 3FMPB 4WCFC 1JFFB 4HLUC 1T9BA 1VSBA 2O2YA 4OBWA 2WNSA 3QLJA 3SJBA 4M86A 2YVUA 1Q74A 5T8KA 4BS9A 2KM1A 3JU3A 4KR3A 4BJ3A 4BQPA 2Q5LA 5JWHA 2FKAA 2GK6A 3FNRA 5D3QA 2HYIC 2J87A 4EPWA 4EMTA 3FGNA 4RHXA 4LJRA 2LKCA 1SHLA 4X20B 3LF2A 4IFEA 4XFJA 4ZRMA 3B1ZA 2ZOSA 2HPAA 1NRIA 2CNKA 1DAEA 2C0PA 2J7KA 3PQ5A 3RS7A 2Y99A 4JBXA 2GCPA 2QTMA 3H65A 1QG4A 2FPPA 3C6YA 2V1XA 4I1SA 5I9MA 1YBVA 4QPZA 2FWPA 2W83A 2DYKA 4XCQA 4YI5A 1A77A 2B0JA 2JAUA 4LZZA 3R7WA 1EZ1A 2YXDA 1XSEA 2XPCA 4NFSA 4L0DA 4Y9SA 3ZHCA 2V6GA 4DQKA 4I55A 3PI7A 1BHSA 4N9WA 4TMVA 4ZQIA 3MTQA 2FSFA 4CUZA 4B44A 1OR8A 2P6MA 1QS0B 4MRNA 3D8NA 1Z83A 3ZHSA 1NX6A 2P91A 3QW4B 4UEOA 4DDUA 1AQ6A 5E6RA 4EGSA 3STVA 2VDPB 4WEOA 2JJYA 4JP2A 2BTQB 4U9HS 1Y3HA 4MLDA 4XD2A 4ZIRA 4NBKA 3SR0A 2HWYA 2JGMA 3WDLA 2XH8A 4IVNA 2G0AA 4DNOA 5A3QA 3Q7QA 4KQWA 3M81A 1PYGA 3N7UA 1CFZA 1MB4A 1SR8A 5KTOA 1UMCB 3DZHA 2BKXA 4PXSA 2NXCA 1ZL2A 4FE3A 3UAVA 3URMA 4AU1A 4PO3X 2AFHB 2W2KB 2DGDA 2PUFA 1V1RB 3SM3A 4NBWA 3UO8B 5BMVB 2B1IA 4AO8A 5I3ZA 3L43A 4BX2A 4UAVA 4ETWA 2MMGA 2Y1EA 4NYIQ 1Y48E 3E1GA 3FHLA 4CPDA 4YQEA 4QNMA 3LG2A 3RRXA 4EZIA 1FRFS 1Q0QA 1WCXA 3NKVA 3TTWA 1YI1A 3DCNA 1L5MA 3C14C 1T2UA 3RU9A 1A9ZA 1IY0A 3A10A 3D8HA 1MJNA 4UASA 2RAVA 4AJLA 4DM3A 4DY4A 1CR2A 5JNRA 5L7WA 4G5RA 2QPTA 3TUIC 1NHWA 3GBPA 1VGQA 2VA8A 3HPQA 4GNKA 1W4AA 4M1KA 2CLFB 2FWJA 3FKQA 4KGXA 2H1OA 1X70A 2RH8A 3ADPA 1OBCA 2K2WA 10MHA 2FK7A 3YASA 3CKMA 2V54A 3QF4A 5ADWA 5GGXA 1QKJA 4IBOA 4EVQA 4HDSA 5F35A 4H1WA 3T4PA 3I04M 4G4SP 4FIDA 1F38A 4OXRA 3ASVA 4TWJA 3SHTA 3BC1A 2QNRA 4TYQA 3QJYA 5B6IA 1DLIA 1WUTA 4UXIA 4EO9A 5EYPB 2H1RA 3KB2A 3WGKA 3BL5A 3H5AA 1HDRA 1I4WA 1N6OA 4AS2A 4EI7A 4X7BA 4ZJZA 3WGGA 3DGFC 3KB8A 4MUIA 4Q00A 4NE2A 5FTMA 4ASUA 3DAFA 2UYHA 2IOFA 1CUVA 2XLCA 1U8EA 3H1GA 4FX2A 4G84A 4IY1A 2QG9A 1FDIA 5JBNA 2F1JA 3THXA 1IOWA 2KHZA 4CYMA 1I7DA 1Z2AA 2WWGA 3HADA 2INGX 3IDQA 5HJ5A 1UR5A 1EEHA 3DE2X 5AXDA 5EUMA 2ORVA 1BVUA 3I6YA 5FAXA 1EFVA 1D2HA 1VZ2A 1A8PA 4IWYA 3UGQA 4HVTA 2YL2A 5HUQA 1VL1A 1RJWA 2WJIA 3NZEA 1UBNA 4LF9B 1GPUA 1WZEA 4R1SA 5SYNA 1XQWA 4C2AA 3FKSA 3DFIA 3A7EA 4ZAZA 1ZXXA 3O4RA 3AF5A 4XUEA 4BMDA 2FKNA 1ZHOA 2WOJA 2IP4A 1LW6E 1QGAA 1Q7RA 2JIZD 2G4CA 3MXTA 3CQ9A 1H6DA 5K0SA 4B6SA 3HWWA 4UPDA 4AKIA 2EJCA 2RGCA 2HBQA 4DJAA 3BBPA 2J3IA 2R79A 4NMLA 1WMFA 1E3SA 1W19A 3BXHA 1ADYA 4GBMA 2B1JA 5HCUA 4UU7A 4B47A 3V55A 1JG1A 4LFAB 4ZQCB 3DTYA 1OLXA 1Z13A 4HVCA 2CKMA 3HBAA 1WUHS 4KN5A 5IH7A 4KSYA 2R8EA 1MOZA 2RGDA 4ZQBA 1N5JA 1UP4A 5H59A 2JLYA 4LOAA 3A6DA 5TNXA 2DCMA 4BNDB 2R66A 2I2CA 2XCLA 3WWYA 4NBRA 1J70A 1V7QA 1F0KA 3HZZA 4D8XA 5CR9A 3V1KA 3ZXSA 5JYBA 1IFXA 2OUKA 2WHEA 3D8TA 3EFBA 3FSGA 4KQMA 5MN4A 4CMHA 2QVZX 4OMUA 1CVLA 2DPMA 5KKNB 2E5LB 4YAIA 1RBZA 3QPWA 4RZ2A 2G8NA 4V02A 3RLIA 3W2HA 1U3FA 5K3FA 1GA6A 3PNPA 4DPMA 3L0CA 3ML1A 4EHJA 1EDEA 3V97A 2RI1A 1E1NA 2VNHA 1K6EA 4FDLA 4FGJA 4EEKA 2DBQA 2PZMA 3QUTA 1ISJA 1FJXA 3ZJUA 3AGQA 5FO1A 2E4XA 4IOMA 1TQ8A 4MJ7A 1D4AA 1WULS 4NH0A 4Q3OA 2IHUA 3D1LA 3DP9A 2MMCA 4LXTA 2AJTA 4IHJF 1M0WA 3IB3A 4MGHA 5AI9A 3RK4A 2J0UA 2QSYA 3GJ4A 5DTMA 3RVOA 2ZYGA 3SC2A 5B7PA 5EJ5A 3IILA 2YN4A 3LX6A 3R5TA 2IZ7A 1A69A 3PQ8A 1MQSA 2ZCJA 3R5SA 2X0KA 4RK7A 3ILSA 1KC1A 3QE9Y 4UUPA 3LOPA 1QCZA 2YJTD 3EVEA 1R0SA 2IXTA 1TDJA 2J3MA 5AOAA 3ZXXA 1SXQA 3OFND 1WRBA 1CJUC 2DHQA 4J1SA 2PMFA 1GDTA 3UG7A 1U7DA 2IHTA 3C8DA 3UV7A 2B4YA 4G97A 2L0XA 3SE7A 1RC1A 2VHUA 3GRVA 3OPYI 1RE1A 2VT2A 3QMPA 3G88A 1PJSA 3DFUA 3GJ6A 3QLEA 5LQJA 4G67A 1OLSA 5K0JA 2WHYA 2BFEA 4GP9A 1U9IC 2B6NA 1TEZA 1QWOA 2I7TA 3PHCA 4PY2A 1MC5A 4PYLA 1VJ1A 1CYDA 1QH8B 1KQPA 3WMWA 4J8PA 3FVVA 3AILA 4YT8A 1ZGAA 1E5QA 3T61A 1QO0D 3KYIB 2HGZA 3C3DA 1CE8B 2CEAA 4ZN6A 5CB4B 2B21A 2UXCB 2LIPA 3GOQA 4XTRA 3L4BA 1I94B 1IPEA 1T3TA 1RJ9B 1R8JA 2PJDA 4D9KA 4DZRA 1T8SA 3MS7A 1LEHA 1K8XB 2BFBA 2TS1A 3I1IA 4HRVA 1P4JA 2F1IA 2JJMA 4BNFA 4XRRA 3KYJB 2IGBA 2WE8A 5DI9A 2CCGA 1K8QA 2QYSA 2D7CA 2GPTA 2O7SA 1K8RA 1HSZA 4CHGA 4EJ0A 2G9ZA 4LRUA 4J0FA 4PLCA 1YK0A 1FFXA 1ZUWA 4HYTA 3MT0A 1QDEA 3TAHA 2FPKA 2QAGC 1T9GR 2A5JA 2ZJOA 3ZEAA 3GZNA 1EE2A 1E69A 4RVSA 1QAOA 1AJEA 3VSBA 2JCVA 2A1TR 2A94A 4KV9A 2JLAA 5GP1A 1KDRA 2G7ZA 2HQBA 3ERCA 4GMKA 2G9QA 2FOLA 1RRKA 1MVOA 1IM8A 2AJDA 2G08A 1FMJA 3GV0A 1ZH2A 4ZO4A 4F86A 4ZZ1A 2DPGA 3ZHXA 2GRAA 2AWOA 3KQOA 1FNSA 2EIXA 2QX4A 4JJ6A 4NNOA 4HMQA 4HXEB 3VHQA 1J6UA 2H2GA 3FZEA 4IRXA 1C7ZA 5DF1A 2I2DA 3L0ZA 3BFPA 2ETXA 1HEIA 2PSJA 3LUHA 4KXUA 1J42A 4H59A 1Q1AA 2Z09A 3B12A 3O91A 2C7BA 2SCUA 1DWPA 3GZ4A 4Q93A 2CNNA 5CDFA 3PUYA 1XRNA 4B6QA 4F3KA 4HDRB 3M6FA 3EC1A 4QBHA 1UAAA 1L4FA 3NYRA 4NCNA 2F1KA 5C1IA 4A27A 1JF8A 2ZJ0A 4ZV4A 1PR4A 3WLFA 1BFDA 1XFAA 2J3QA 4KC0A 4OXNA 5HMLA 3NBYC 2HHAA 4IFIA 3LPNA 1UKZA 4RLFA 5FBLB 1U31A 1WQ4A 4WA7A 1YS6A 2CDRA 2R4UA 5HIMA 3GUVA 1KDTA 2XGOA 4RE6A 5IYZF 4ALMA 1Z7EA 1DWOA 4R3WA 2XJ4A 4E88A 5KQRA 2F1HA 4FDAA 3PKJA 3U16A 2AI1A 2GASA 4GT1A 2QD4A 2AT1A 1I2ZA 5EJ7A 1Z0IA 3GJ7A 4QJ4A 2XVYA 4NH4A 3V4VB 5I5EA 1HNZB 2P9YA 3V8BA 4F04A 2C3PA 2I1QA 2W7TA 3QVUA 1ZXBA 3RANA 2PRSA 4E4RA 1B8UA 5K0GA 4MLCA 1E77A 1JDZA 2E4ZA