4FC7A

Studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
274
structure length
274
Chain Sequence
PPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxisomal 2,4-dienoyl-CoA reductase
publication title Studies of human 2,4-dienoyl CoA reductase shed new light on peroxisomal beta-oxidation of unsaturated fatty acids
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 105
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.34: 2,4-dienoyl-CoA reductase (NADPH).
pdb deposition date 2012-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fc7A00
3PJFA 4NBRA 2PZLA 1MLDA 5TC4A 2JCVA 3RBZA 4BNMA 4E5NA 3GMDA 3X2EA 1KY4A 2VT3A 2G17A 4DC1A 5KNLA 4AG3A 4O5OA 2BI7A 4OAQA 4N5MA 3E9QA 3UCXA 5LDGA 3B20A 4Q3AA 5IN4A 4QFDA 1BXKA 1QV7A 5TQVA 4CMHA 2PD6A 1C1DA 1H2HA 5KJFA 1PR3A 1YBMA 1EE9A 3Q1LA 4HFNA 3Q6IA 3VC7A 1B26A 2I99A 3MJ4A 4CR8A 5IG2A 5ITWA 2WD8A 3U09A 4CMEA 3DEYX 4JIGA 5JYEA 4BO6A 5ENDA 2EXXA 4M1QA 1TT5A 3FSRA 2X5JO 3BMQA 5CDYA 1CIVA 3JV7A 2FSVA 2VZ8A 4ZVVA 4YR9A 3Q0EA 2PZMA 3ITKA 1I32A 4FB5A 3NDIA 3F5QA 2HMUA 4UUOA 1EQ2A 3WQQA 3DQPA 4IQGA 3GAFA 4BGIA 2ZYDA 3TZKA 4EUHA 1PTJA 4G81A 2PH5A 1C1DB 5IXSA 4AJNA 4W9NC 4D7AA 2YV2A 2RH8A 1JAXA 1E5QA 4E0BA 1JAYA 5A5EA 4WCDA 3HUDA 4MOWA 4YJGA 4MVJD 5A1TA 1MV8A 1Q7BA 4MKZA 1N5DA 4DMMA 2ZQZA 1EVYA 5I7FA 1LRJA 4I9UA 1TT5B 1YB1A 2PGDA 1C0IA 3BMQB 2ZB4A 1QG6A 2GN4A 3QVTA 1F06A 3JTMA 3LC7O 5CEFA 1LLCA 1T2DA 1SEVA 2VUSA 3C24A 4EDFA 4UREA 3QHAA 5JE8A 1E7YA 3H65A 3JQFA 3L9WA 5L3ZA 3RKUA 3CKYA 3PHHA 4RF2A 1Z73A 1GV0A 2OMEA 4BO4A 1MX3A 2DBRA 1I3NA 1M76A 5THQA 1U1IA 1X15A 3G1UA 1LLUA 4QO7A 2IRWA 4UEOA 5ILGA 4YJGB 4EBFA 4GKBA 4XYGA 1CWUA 3PK0A 2HK8A 3RJ5A 5U4QA 2H1SA 4XR4A 4AJLA 2JCXA 1XU7A 2Y05A 4CLOA 3FCOA 3NUGA 1DRVA 1IB6A 1LXCA 2ZJ1A 5L40A 3NDJA 4I5DA 4BB6A 1UDCA 2GN9A 3PEFA 2WYUA 4R1UA 2DTXA 4IJUA 4BNIA 2VYND 1VSUA 3KBOA 3U3XA 3W4IA 2I66A 4XQGA 3F3SA 4FOOA 2QIOA 3PIDA 3D4NA 3HN7A 3QWAA 5B4VA 1TEHA 1D3AA 1B0AA 5JDCA 1BGVA 1UXGA 2V6BA 3WXBA 3ICPA 1GYRA 3PYMA 4R01A 3L6EA 4KOAA 3U5TA 4XYBA 3DAPA 3G0OA 3GA0A 1A9ZA 1XELA 2EW2A 1LSSA 4GLLA 1KYQA 1NQAO 4DBVO 3AWDA 5BNIA 1GZ4A 4CPDA 3TL2A 5L9AA 2HO5A 4BNKA 2ZKLA 1IPEA 2RBEA 4P4LA 3ONFA 3L0DA 3LZ6A 1E1NA 1SO8A 1HYGA 1HLDA 1LJ8A 1N1EA 2O2SA 3I9JA 4DC0A 5COQA 2O23A 3ZV3A 4IDFA 2Z95A 1UP7A 4RF4A 5IDXA 1E1MA 3D3WA 4M55A 3PGJA 4U0JA 1P9LA 5KWEA 3Q11A 1U3UA 3BMOA 2VZ9A 5DN9A 3RBXA 2X7HA 2WMDA 4BMSA 4H16A 1IHXA 2C07A 4IS2A 4WLUA 1X0XA 3RC7A 4DQVA 4D43A 1B8UA 2NU7A 3LU1A 4PVDA 4RQUA 2C59A 1I8TA 3SVTA 2W8ZA 2J5QA 3CZRA 1KEPA 3AI1A 4WLNA 4CM5A 4KP7A 3AUSA 2DPHA 3SC4A 3KSZO 5K0ZA 2WYVA 1B8VA 2NVWA 4S3MA 1NFFA 2E6UX 4R54A 1F8GA 4J2HA 3M1AA 3MTJA 1KY5A 3PPIA 5HA5A 3D3WB 3T4EA 2DVMA 5IAAA 4AL4A 3BMOB 1GAEO 4XKJA 1ZNQO 5JAZA 1UR5A 1LDGA 3GUYA 4H15A 5I9MA 5A02A 5EJ2A 4NMHA 1B16A 3VPXA 2Q1UA 3NAQA 2Y68A 3WNVA 1ZMTA 9LDBA 5AYVA 1SCUA 3D7LA 3HFGA 4IZIA 4BO9A 3ZV5A 2QHXA 1WWKA 3B1KA 2A9FA 2ZB7A 5JDIA 5IN5A 4CLRA 3QVWA 4ZQEA 3IUPA 1B3BA 2HK9A 4AICA 4LK3A 4YRBA 3LT0A 1VL0A 4BV8A 4QTZA 1MB4A 1S7CA 5T8KA 2P9CA 3ZU3A 1GADO 1VKNA 3ZHZA 1FMCA 1VLLA 4KMSA 5KJEA 1ZJZA 1UH5A 2HUNA 2QYTA 4AJHA 2I3AA 5IDQA 2E37A 5JCXA 4U7WA 4MVJI 3DHYA 5B4UA 3PFWO 4L76A 1UXJA 4JCOA 3RC2A 3QIVA 1NQTA 3S2FA 3L4BC 2DTDA 3WYCA 4DLBA 1T2CA 1B7GO 1ONPA 4CLRB 5JS6A 1K3TA 2ZCVA 4DLLA 1DHRA 2H9IA 2X1HA 3PYLA 4ALNA 1TLTA 3A9WA 2GD1O 3I23A 4YAIA 1NWCA 2B83A 4QO8A 8LDHA 3GEGA 2BRUA 2OO5A 3JQBC 2NNLD 1HSOA 1R0LA 1TXGA 3ZU4A 1HDRA 4BO0A 1SPXA 3F9IA 4TROA 3S2IA 1AN9A 2DFDA 1MA0A 3CH6A 1U8XX 5L4SA 1YL6A 5G0VA 3K6JA 4NZ9A 2EWMA 4NBWA 5HBRA 1LX6A 2BFAA 3GFBA 5DF1A 3PWSA 2F00A 4IPTA 3A14A 5AQ1A 2BMAA 3GC6A 4RPHA 3I9KA 2VNAA 3PHLA 1SB9A 3LDHA 4P22A 3I5MA 1A5ZA 4MIOA 1BVRA 4CQMA 4R3WA 4M8SA 1BSVA 4MO2A 1H9BA 1I30A 4UVGA 3WGQA 1DRWA 2YUTA 3PLNA 4NBVA 2HLPA 5L53A 1QYDA 2VWGA 1Y5MA 1QYXA 1B2LA 3PRJA 4E5YA 2NUAA 4BVAA 4Z3DA 4YPOA 3ZWMA 1DDOA 4I8XA 4R1NA 4HBGA 1ZVMA 2FN7A 3BIOA 4INAA 2IE0A 4DTIA 2B36A 4DWVA 1WMBA 1KS9A 3UVEA 1QRRA 3D5TA 5JW6A 3QE3A 1WDKA 2FPGA 1B15A 1J4AA 2IDZA 2X0IA 1Z7EA 3RJ9A 5KKAA 3MCVA 3GMSA 3WWZA 1P1RA 3RASA 4OO3A 5A04A 5C7OO 4EJ0A 1NBOA 4NBTA 3V1UA 1WDLA 1HWYA 4IDEA 4RZHA 4YJDA 1CQIA 3ZHBA 3EYWA 4JX8A 3E5MA 3GLQA 3AI3A 1EE2A 1U5CA 3GVPA 3P7MA 4GKVA 4RQTA 1ZK3A 3N58A 2FMUA 3GZ4A 3JYQA 4IXTA 2X6TA 3JQ8A 4WK6A 3V2HA 1NAIA 5ICSA 4ITUA 1AXGA 2UV8A 3FR8A 1T25A 1PJCA 4L4SA 2PKQO 4CLHA 4L0QA 3UGKA 1N2SA 1CETA 5ER9A 4P38A 3A4VA 3RUHA 3AM3A 3JD2A 1K0UA 3ZI0A 1AXEA 4DPLA 1PU2A 1QYCA 3GRKA 4PCVA 2GUGA 4TRMA 5CFZA 4R4JA 4OKNA 3INTA 3PWZA 2BGKA 4FGWA 4LSWA 3BMCA 2B69A 3SJ7A 2W98A 3OQ1A 3RU9A 3AU8A 3OSUA 3ZHYA 2QRLA 1O9BA 3HHPA 4FC6A 1I0ZA 1N9GA 4NU6A 3K2EA 2OBNA 5H83A 3KZVA 5KVCA 3S2GA 2GDZA 4XYMA 1VJTA 1O0SA 3IUSA 2VCYA 5B4TA 4WOJA 2PK3A 5HRUA 2W90A 3DBHA 1WMAA 5IZCC 4L4RA 3G79A 2UUPA 1HRDA 2JAPA 2P4QA 3ST7A 1UP6A 1MG0A 4XRGA 3I4CA 4FFMA 5L95A 2NU6A 2FRDA 1JVBA 3BMCB 3FPCA 4NPCA 4Q9NA 3ZCXA 4JROA 2AQIA 1N7HA 1X1EA 1C0KA 1N9GB 3JQDA 3KYDA 3FTPA 1BHSA 4XD2A 4B4UA 3TPCA 4PVCA 1OI7A 3F6YA 3M1LA 4JXKA 4OQYA 4WKGA 1SNYA 5EL0A 5KJ1A 1IY8A 3OECA 4TQGA 1GR0A 2Y1GA 4W4TA 1YOVA 1NHGA 4AVYA 2YDXA 3WNQA 3DWFA 1Y8QA 2HMWA 2YFHA 3FI9A 4PLPA 1JKJA 4B7CA 2A35A 1DFGA 2DPGA 3NDRA 4A73A 1W8DA 1H6AA 3E03A 3H4VA 2RAFA 3F4LA 3GN1A 1B14A 4WOKA 1GPDG 1LQTA 1XHLA 3CE6A 5TT0A 1EDOA 2AE2A 3F4BA 3LLVA 2Q2QA 5BSFA 3KYDB 3NT2A 3VH1A 2AQKA 2I67A 1DOHA 1I2ZA 3DBRA 4TVBA 3DAFA 3JQ9C 4ZRNA 5A9RA 4IIVA 3WOHA 3O26A 5KJCA 1H2BA 1YKFA 2O4UX 3S55A 1YOVB 4LVCA 5G4KB 1LQUA 3LF1A 3OETA 1VJ0A 2VUUA 4DIOA 4FC7A 3Q3CA 1Y8QB 3VHRA 3OJOA 4CR7A 4GAEA 1CEQA 4B7UA 4J91A 2X0RA 1BDMA 2DUWA 4CV3A 3GDGA 1QKIA 4XZ3A 1BW9B 1UAGA 2VOJA 1IOLA 4WNCA 1NFQA 2NTNA 1O89A 1GUZA 1LRKA 1R16A 5C7LO 1O6ZA 4N5LA 4ZQGA 4DRYA 3EVNA 1A4UA 4ONEA 4TRJA 5THKA 3FF4A 3DBRB 4A27A 1EMDA 1LDNA 4GWGA 1OBFO 4HFMA 2DBVO 4NHEA 4KDEA 3NGXA 1B3RA 4XR9A 1XYGA 3DO5A 2AQ8A 3ZNOA 2H5LA 1XGKA 3IS3A 3ROMA 1YL5A 4NK5A 4W9NA 4CQMD 3ZH2A 5C37A 4OOEA 1ZXLA 2H63A 3EUWA 1WNTA 4Q3NA 3ROPA 4TSKA 4E33A 2YJZA 4YTEA 1UUFA 5TT1A 2J5RA 2ZQYA 4U6QA 3WG9A 5KJ6A 4JQCA 5L7TA 1A72A 1C0PA 1J5PA 1JQBA 1E3LA 3I6IA 3JD1A 4TZKA 2EP5A 4BKUA 4FJ1A 4OMUA 3FRJA 2X58A 2Z5LA 3IL2A 1U4OA 2HU2A 5I9NA 4J4TA 1R0SA 1M6HA 4BNFA 3BXXA 2P5YA 1ZFNA 4LMPA 2OL4A 2ZYAA 5I8WA 3H8VA 2DFVA 4IGEA 1Q0LA 2GGSA 1UXIA 1DBVO 4YQZA 1UDAA 2JCYA 3KYBA 4FDAA 4Z0PA 1NR1A 5AXBA 5AOVA 2DBQA 2X9NA 3BHIA 3C1AA 1KETA 3UAGA 1ONOA 2OFPA 4NR0A 4K26A 3WDSA 1F12A 2Z1MA 2FHSA 1R6DA 5I9LA 1YDEA 4YT4A 4G65A 4YA6A 4QECA 1JKIA 4Y67A 3MZ0A 1RKXA 1EDZA 3QWHA 1ADFA 3L07A 4EEZA 1NM5A 1K2WA 2BD0A 3TZHA 2ZK7A 5TJ9A 1DIHA 4YVFA 3RQSA 5EERA 3U4DA 2DU8A 3ZV6A 3GEMA 5DZSA 2UAGA 4BNNA 4FR5A 3VOSA 3SEFA 3OBBA 4CQLB 3JQ6A 4KTVE 1YBVA 4KWIA 4PLZA 4C4OA 4G2NA 1HXHA 4WECA 4E2YA 3ZN2A 4AJKA 3F47A 5TSDA 1U3VA 3WQSB 4I1IA 3LSYA 4YT8A 5A4DA 1Y6JA 4XDYA 2JHGA 4FOSA 1JA9A 3EY4A 3ITDA 3JD0A 2X0NA 3KEQA 3INGA 3Q9UA 1YS4A 1PQPA 4A2CA 2DAPA 3V5NA 3ZGYA 3G1TA 4DXHA 4PRLA 1LUAA 3PHGA 4Q39A 2J3HA 5I7VA 5F1KA 1ZEMA 4IMPA 1HL3A 4J6FA 4QFCA 1P0FA 3ENNA 3E48A 2A94A 4YRDA 1IHYA 3I9MA 5K6AA 2EJWA 3E82A 4YACA 2F1KA 1GTMA 4CLDA 2EGGA 3EZLA 3JQGA 5AXAA 1AE1A 1IUKA 3A28A 2WTBA 3MJCA 1DJNA 2OBYA 4FFPA 4YCAA 3K96A 1OZAA 3RWBA 3LQFA 4IBOA 3Q9NA 1ULSA 1BXGA 3WTCA 4EITA 5DT9A 1NVGA 3MOGA 1KVTA 1R66A 1AUPA 1DXYA 4BHTA 3MJVA 4CMBA 4TRRA 1RPNA 3S8MA 3NT4A 5ITVA 3B6ZA 3ZNPA 4R3NA 5ADHA 1CDOA 1LSOA 3NTOA 1OFGA 1ISGA 1M75A 3Q2IA 2UUOA 1HLPA 3JQGB 2V6FA 1DO8A 4FD3A 4IJWA 4KUEA 4KQWA 2YQ5A 4ALIA 3WYBA 3AK4A 4XGNA 4II3A 2YFQA 1LNQA 1H5QA 1Y81A 2CY0A 1BXGB 2Q2VA 4J7UA 4MVJG 3KETA 1W4ZA 3L77A 1H6CA 2BKAA 3WJ7A 1D7OA 1K6IA 2AG8A 4PLYA 2D1YA 3D4OA 3HDHA 2EP7A 4RGBA 4DLAA 5CAEA 1I24A 4FFRA 2OOSA 3W8FA 3ADOA 3HADA 4KWHA 1MP0A 2IODA 3WFIA 5JYDA 4B7XA 1PJBA 5FEUA 1GCUA 3FHLA 3W8EA 1KIFA 4RJTA 1ID1A 3RFTA 1XIVA 4CL8A 3RUDA 1GQYA 1GCOA 4BV9A 3LT2A 4XX0A 4ND4A 3OP4A 2WD7A 3I9OA 4XDZA 3RUFA 2Q2WA 3H9EO 3GNSA 2O3QA 4DQXA 1W6UA 3O8QA 4B8ZA 2C54A 4OM8A 3L4BA 1PS8A 1I2CA 4J7CA 1HDZA 3C1TA 4OJNA 1DHTA 4R69A 2O3UA 3ONDA 2X0JA 3PIIA 3UW3A 1V3UA 1EFKA 2VNSA 1PIWA 4BIIA 5L45A 4NJOA 2I76A 1VI2A 1ZEJA 4A26A 4ZHSA 2O3TA 4A10A 1C3VA 5TNXA 5JNLA 1TA4A 1NQOA 3JQBA 4GGOA 4R9SA 1HEUA 5ER6A 2BFOA 1YWGO 1YQXA 4XQ9A 1GUFA 1KBZA 1WW8A 4Y6PA 3DC2A 3DR3A 2OUIA 3FNEA 4JP3A 2WD7B 3NEPX 5FF9A 1P44A 2Q49A 3CEAA 1WXDA 3O8QB 1UJMA 1ZUD1 1C14A 1XSEA 1EVZA 4OH1A 3TFOA 4J1QA 3EDMA 1NR7A 1OOEA 1SB8A 2P68A 4WLEA 1O95A 3L6OO 3JD3A 3NGLA 4HNGA 3EK2A 4R1SA 3H2SA 3OIFA 5A9TA 4E2ZA 2G82A 1U28A 1J49A 1U4SA 3AY6A 3IC5A 5KVQA 2EKQA 1PS0A 4OQZA 3UHAA 5F3RA 3HFSA 3IJPA 5IZ4A 5CPBA 1LU9A 4PLWA 4DIFA 1DC3A 1ZCJA 5JPIA 4GBJA 1I10A 4WASA 4L74A 1G1AA 3GGOA 4E6PA 4RCVA 2IZ1A 3BTVA 5JC1A 3O4RA 1P45A 3GHYA 2I5PO 4D79A 3C7AA 3WWYA 4PRKA 3WLEA 4L4XA 1OC4A 3QLJA 3FWNA 4HUJA 1PL7A 1OMOA 5LCXA 1VKOA 2PD3A 3QV1A 4R5MA 5DCYA 2XAAA 2EHDA 4J4HA 1NQ5A 3IMFA 3JCZA 5DCWA 4BUCA 4B3IA 3K8ZA 4BNYA 2B5WA 3K31A 3CMCO 3N74A 3NTQA 3IQDB 1XR3A 2Q1SA 3UCEA 4J90A 3RC9A 1SOWA 3H3FA 4IZHA 4F6CA 2ZTMA 3JSAA 4PLVA 3CUKA 5JC8A 3BZUA 5JSFA 4KDFA 3NTRA 3QW2A 2HMTA 2OP1A 4WLVA 3PWKA 1IZ0A 4XB2A 2HRBA 4L9RA 1T26A 2WDZA 4YYZA 2PGLA 4NJMB 2G76A 1WZEA 1HZJA 1FJHA 1T2FA 1YE3A 4WUVA 4PFJA 3W4JA 4ILKA 1G6KA 2GPTA 2HAEA 2PV7A 3E8XA 1NXQA 4WNIA 5DOZA 7ADHA 2FZEA 5L51A 1PS9A 3SBOA 2LDXA 4M87A 3MJEA 3GVIA 1GZ6A 1GYQA 5KVSA 3TN7A 2QQ5A 1YJQA 4JBGA 4HKTA 1ZSVA 5ILOA 3KOUA 1WPQA 2VOEA 2B37A 5K6AC 1DFIA 4S1VA 2PKQP 4CMJA 5IZCA 3GOHA 3WB9A 2AE1A 1WDMA 5A5FA 3ANLA 2Q50A 3OJFA 5G4LA 4IDCA 3ROKA 4IXWA 4R1TA 4FFLA 3TZQA 1E1KA 1Y1PA 4W7HA 2VHVA 5H82A 3WGGA 4RPGA 1QYVA 1RYDA 3OIGA 1G0OA 2BGMA 5B12A 3C7CB 1JWAB 2V7PA 4KZPA 2H6EA 2IZ0A 2C7GA 3E18A 4GSLA 4K6CA 1DIGA 1MXFA 4R68A 1K6JA 2NQ8A 2Y1OA 3LC1O 5COAA 1BRMA 1U5AA 3V1YA 3BTSA 4J4BA 3LVFO 3U4CA 4FFNA 2JD2A 3UOGA 4E2WA 1V35A 4XIYA 3WSWA 1T2EA 4ZU3A 3MJTA 4Z0TA 3KVOA 4IJVA 2C5AA 2PFGA 4ALMA 2J6IA 1YQGA 3BHMA 1JLLA 3AUUA 2RHCA 2VN8A 5JO0A 3DHEA 1R4NB 4B3JA 3JQCA 4CM9A 3S2EA 3FNHA 4J9UE 1ML3A 1WLYA 1DIRA 2WWRA 1HTBA 1U3WA 3JQ9A 4XGIA 3WTBA 1NWHA 2X4GA 1V8BA 2W2LA 2Y66A 1NX6A 1LLQA 3OA0A 1X7DA 1F14A 1PZGA 4RVSA 4JGBA 3WICA 4ROSA 3EVTA 1UZLA 3ULKA 1QLJA 1NVTA 3U4HA 5A9SB 1L1FA 4PZDA 4L73A 1F8FA 1QP8A 4YAKA 1V9LA 4PLGA 1ULUA 4FJ0A 3WBBA 3GF4A 2OORA 1HKUA 2CVOA 4RV9A 2HK7A 4Y6SA 3ZWNA 2HJRA 4HADA 4CMKA 3TWOA 1Y5RA 3GNTA 1SBYA 3IKVA 4HP8A 3TOZA 3VZQA 4IS3A 4AJ1A 4ZICA 1V6AA 4MIYA 3ZWWA 2PA3A 3C8MA 1W73A 3ONEA 1MC5A 1HDYA 3HB4X 3KB6A 2IYOA 3SLGA 3JYOA 2B4TO 5JXWA 3AUTA 1Z7BA 1ZH8A 3WGIA 3COSA 3IAHA 4G5HA 4BNZA 4WE3A 4F3YA 3QWFA 3QJ5A 3NJ8A 1Q0QA 1U2DA 3HN2A 4MVJH 2EKPA 4E5KA 4E12A 2VWHA 4NNJA 4K9DA 1YB4A 1VPDA 3I9LA 5F1OA 4YXFA 1E1LA 1VL8A 5IFLA 1D4FA 3RUCA 4E5MA 1BMDA 3KYCA 3KXDA 3K5PA 1T1RA 2ILTA 5T6BA 4IUYA 3ZWOA 2WE7A 4BMVA 3KHUA 3LK7A 4IDDA 4JLWA 5BT9A 5HWSA 3FTNA 1EUZA 3AOGA 3BAZA 3ABIA 5BQFA 3QA9A 4B4VA 1ISJA 1J6UA 1M6WA 4UVHA 4DUPA 3EAGA 1XLTA 4ZQBA 3ZWYA 4FGSA 4FIZA 5CEJA 3OJLA 4D0SA 2O7QA 3SX2A 3KSUA 4WLFA 2RIRA 1EBFA 1ZW1A 3FBTA 3HSKA 1NNUA 2VTEA 5EQDA 1I36A 2GZ3A 3PQDA 1ADCA 4IGFA 3WR5A 5J23A 2J8ZA 3KYCB 3HWRA 2I65A 1PR9A 2JD1A 4DVJA 1PZEA 1UAYA 3ORFA 1LC0A 1LDEA 1HDGO 5CEEA 2Q1WA 3LYLA 1K6XA 4GI2A 1EBUA 4D0RA 2WE8A 3T7EA 1PWZA 3K92A 4JP2A 1PZFA 4OOFA 3GQVA 2V6MA 4WGGA 1GZ3A 2POQX 1N7GA 4BGVA 4K28A 2NV6A 3GGPA 4WJZA 5MDHA 4OKIA 5JLAA 1HSZA 1E3WA 1JN0A 2CDBA 2G0TA 3K30A 2VRCA 4BO8A 5BSGA 3AI2A 2O2YA 2X22A 4BNJA 4W99A 4D46A 2Z1NA 3R6DA 4ZN6A 4II2A 4BNWA 3C1OA 4YT5A 1NFRA 1G0NA 4LRTB 2CF5A 4TVOA 1WAMA 1EVJA 4Y6RA 2CMDA 5T57A 3DONA 3ICCA 1DSSG 3BTUA 5KKCA 1X7GA 4CMAA 4R9RA 5CG2A 3HE3A 3QVOA 2R6JA 3I52A 5L7WA 5TRTA 2JAHA 3DL2A 4YQYA 2GN6A 1P74A 1E3WB 1JTVA 2GERA 1P0CA 3E9MA 3ZNNA 1RWBA 2JL1A 4O59O 1RYEA 1SZJG 4I5FA 3W6ZA 1GYPA 2DM6A 4BO1A 4CODB 4M89A 2OP0A 4J2OA 3RUAA 1ENZA 5HS6A 3AM4A 1HZZA 3TZCA 1DFHA 2GYYA 2D4AA 4CL3A 2AHRA 1X14A 2VRBA 4MP3A 5IXYA 2FSSA 4XYEA 1U9JA 1OAAA 4MVJF 1R15A 5CDGA 3H5RA 4IDAA 2EW8A 2HQ1A 5CG1A 1KOLA 1O94A 4ZQHA 1DPGA 5G4KA 4ZD6A 3QP9A 3WGZA 1HDOA 1C0LA 5DBGA 5JFOA 1F0YA 5TS3A 3R0IA 1VM6A 5T64A 5U1PA 4CM9D 2NSDA 4NK4A 1ISIA 4BNUA 1LDMA 3B70A 4KUHA 4W7IA 2B35A 2C2XA 3F1LA 2W2LD 4PZEA 5JMWA 1UXHA 4MKXA 1BW9A 3E9NA 1PJLA 3GZNA 3DFZA 4Z9XA 2OGUA 4O0LA 2AMFA 3C85A 3D64A 5F5LA 1FF9A 4GX2A 3V2UA 3ASVA 4A7PA 3B1FA 4ALJA 3GUCA 4QQRA 4CM3A 3DDNA 4HXYA 1EUCA 2IZZA 1FK8A 1QORA 2EERA 2HJSA 3CPSA 4RVGA 4WLOA 5JO9A 3WX0A 4ZGWA 3GRPA 3GDOA 1P31A 2Y1DA 1R37A 5G0TA 4B4OA 1D8AA 1T4BA 1XEAA 2B4RO 4A03A 5F21A 5HTOA 1ARZA 1SAYA 3OQ6A 5CDTA 2CNBA 4UUPA 1QR6A 4AJOA 2V6GA 3GZNB 4WEOA 3VPFA 3OJ0A 4Q3CA 4LISA 2BGLA 5GY7A 2C0CA 4BOYA 3L9XA 1EVIA 2ZYGA 2X9VA 3HB5X 4KUGA 3H2ZA 4Z3KA 1LI4A 3VH2A 1YDWA 2Q99A 1PGJA 5TX7A 1MXHA 2GN8A 1UXKA 1NAHA 4RVUA 1ZSNA 2GRAA 1DRUA 2ZTUA 1M2WA 1IYZA 3DMYA 1Q1NA 1QSGA 4ND3A 3ZW9A 4PG7A 1N1GA 1HT0A 2JFHA 4OXKA 1GPJA 4DIBA 1GY8A 1Q7CA 2YQ4A 1LDBA 1R0KA 4D3DA 3AUAA 2HMSA 3DOCA 3GY0A 2FPPA 3T4XA 1BG6A 1P1HA 1H93A 4RZIA 5H81A 2C29D 2Y1CA 2WEKA 4K1LA 4NBUA 1Z74A 2JJYA 4EZBA 4DYDA 1YH3A 1E6WA 3GVXA 5FWNA 1H9AA 3EZYA 4Z9YA 1NVMB 3WGYA 4CM8A 3RC1A 4EEXA 2GCGA 4QT0A 2ZTLA 1RM5A 5L4LA 1T2AA 2Q4BA 2IEBA 4HY3A 3DMTC 3O38A 4W82A 2QG4A 4XIJA 4L8VA 4U8GA 4CQLA 3F5SA 1GV1A 1TB4A 3ZWPA 4MP6A 4TMFA 3ETDA 3CMMA 3VDQA 4FJ2A 2GSDA 3BYZA 3CZMA 3U49A 5JY6A 1HETA 4RDIA 3ZV4A 3OFSA 1PGQA 1DC6A 2Q1TA 2Y1EA 4MINA 1PL8A 2BH9A 3ZWXA 1YRLA 3INRA 1NPTO 3AU9A 5BR7A 3D4PA 1IPFA 3C7DB 4CM8B 4FS3A 4NI5A 2VRCD 4J9VA 4WCFB 5JAQA 5JY1A 1DJQA 2FY8A 3PJGA 3UCFA 2PKRA 1VL6A 4I9HA 2P5UA 3DZJA 3K9QO 1X13A 4CUZA 4F45A 4DBZA 2Y67A 3I1JA 1E7QA 1I01A 1I5RA 4LN1A 4RLSA 3P2YA 3EW7A 4J7XA 1RJWA 4XRRA 1IULA 3O9ZA 2HCTA 3TRIA 3RBVA 1P33A 1PJ2A 4BQPA 5TLSA 1P1JA 2B5VA 3RU7A 3I6QA 3DHNA 4MVJM 3VVBA 2O3SA 5KCZA 2V65A 3HJAA 2J5KA 2XPCA 1CJCA 1YJ8A 1ZIDA 3WGTA 1SOVA 1T4DA 2FR1A 2UDPA 3IJRA 5EPOA 2R00C 5TJHA 5BNTA 3P2OA 2PTGA 2J3JA 1ZBQA 2C7VA 1DLIA 4QX6A 3M2TA 4UULA 2BI8A 5KIAA 1I3LA 3DZKA 3QY9A 3UH1A 5FI3A 3ZZNA 1DLJA 2HRZA 2VHYA 2O48X 3D5QA 5I7SA 3DBLA 3LC2O 1Y9AA 5A06A 1D1TA 4OXNA 3UXYA 4C7KA 5TGDA 1ZK2A 4BB5A 2NM0A 1YBAA 3ENKA 3ZU2A 2IXBA 1IZ9A 2HSDA 4NQZA 3RFXA 1YXMA 3NT5A 1OC2A 4QSMA 2LDBA 4MP8A 3V1TC 5DULA 1ADGA 1RM3A 2WJPA 1JVSA 3QRWA 2OZPA 4Q3BA 3R3SA 4UVIA 4EYEA 2AEMA 1C1XA 3I4FA 4FN4A 4I5GA 1E6UA 3I3OA 4YAEA 4QXMA 3I9NA 4CM4A 3PDUA 3GGGA 1U3TA 4GX1A 4WPGA 4U6SA 3AY7A 3JYLA 3LF2A 2PR2A 3DBLB 3PI7A 1DC4A 4J16A 1DC5A 3WFJA 3UUWA 4AJEA 4B8WA 1MFZA 2E49A 2BFMA 2ZB3A 4N18A 4GMFA 4ID9A 4CMGA 2AA3A 2E48A 3PZBA 3IP3A 2AQHA 1RM4A 4XGKA 3RI3A 3WS7A 3FNGA 4D42A 5I7EA 2CSUA 2Q45A 1AHHA 4QUKA 2ZJ0A 4DPKA 2VHWA 1C1XB 3H5AA 1E92A 4LRSB 2NACA 4UUMA 1R4MA 1BWSA 3DAGA 2ZTVA 1KVRA 4HNHA 4XQEA 5FI5A 4LSMA 4Y8VA 4CM4B 3WJAA 1MUUA 1UZMA 3U9LA 1JKFA 1I33A 3GG2A 2GR9A 4I9NA 5BSHA 5L4NA 4CM1A 4DREA 2ZIZA 3V8BA 3ZW8A 3QSGA 4JJIA 3AFNA 4GQAA 2D3TA 4MPDA 5DOVA 3TFQA 2QW8A 3LLSA 4YEDA 3H6KA 3FNFA 1E0DA 2AW5A 2VQ3A 1W0CA 1TVEA 3KSDO 3VH4A 3ZWCA 1VRWA 4E5PA 2P9EA 2O3RA 4TKMA 1R4MB 3PYXA 3MWEB 8ADHA 3AJRA 5GMOA 3CIFA 5G0WA 2DTEA 2JD0A 4DA9A 4NDNE 4MIEA 4J49A 3KM0A 3G3EA 4XJTA 2BELA 2X5OA 1JDJA 1N92A 2PY6A 1QLHA 4E30A 3SJUA 3UFXA 3PQFA 4IIUA 4GSKA 4PGFA 3W6UA 3DZFA 3VPSA 2I3GA 1U8FO 5DBIA 2AG5A 2FP4A 3KLMX 4LCJA 1LC3A 1L7DA 2DT5A 2W4QA 3DOOA 2VWQA 1AGNA 4P8RA 3E6AA 3ZWBA 1E7RA 2J3IA 1DIBA 3F1KA 3ZWAA 5KVVA 3QWBA 2XOXA 4LGVA 2D5CA 1Y9EA 4XJSA 1XCBA 2P91A 2PZKA 1U7HA 2J3KA 5ENVA 4H3VA 5B1YA 1BDBA 3M2PA 1UZNA 1HE3A 3PP8A 3GHHA 4WCFC 1GEEA 1T1SA 2YV1A 4D44A 2ET6A 3AM5A 1VE9A 2CDAA 1SMKA 4DL9A 4XCVA 4RORA 3AY3A 4NJMA 4Z9FA 3IIEA 5COBA 1CQJA 3OQBA 2GZ1A 1E7WA 2NWQA 4PLHA 1BXZA 5F1PA 4UEJA 4A0SA 1S6YA 4FSHA 1Q0HA 1TI7A 5FYDA 1V0JA 3PGXA 2E82A 4ZQFA 3GVCA 5EMHA 4UVEA 5C7IO 4Y9DA 4TWRA 5KTKA 1BVUA 2DBZA 4HWKA 4IM7A 4OYRA 4TKLA 4ZJUA 1GU7A 1Q7GA 1E3SA 3HQ4O 2TMDA 3DBVO 3ZHXA 4XYLA 3RFVA 3PDJA 4H7PA 3JYPA 3TSCA 3TF5A 3PXXA 5DDIP 4E32A 3R1IA 3N7UA 4GVLA 4J43A 3MOIA 1ORRA 3K2BA 1MG5A 3IDSA 5GZ1A 2D5AA 1ZKMA 4WEQA 4U5QA 1GL3A 4GPD1 1NP3A 4ALLA 3ZWVA 1XA0A 2AXQA 4BO7A 1JW9B 2EJVA 2DLDA 4AJ2A 1LEHA 5HS4A 5I8ZA 4O63O 5ICMA 4PG8A 1O8CA 1Z6ZA 2OHXA 1IL0A 3H9JA 1P1FA 2R2GA 1X1TA 2B4QA 3GH3A 4B3HA 2FOIA 1PGPA 3R3JA 1HYHA 1KVUA 1XG5A 2QX7A 3NYWA 4EGFA 4AJPA 4CLOB 4BGEA 1WP4A 4JJFA 4OSOA 3TDKA 3GAZA 4NG5A 4RDHA 4BO2A 3VTZA 2EV9A 1A9YA 1ENPA 4CV2A 5EN4A 5JMPA 1DB3A 2TMGA 2VHZA 3VKVA 1I2BA 1LLDA 1PWXA 1CF2O 5A03A 4J1TA 4CUJA 3CINA 1LA2A 4D3SA 1PJQA 4FFOA 1R4NA 1Y7TA 3OF2A 5TIIA 1KVQA 1Z82A 2PNFA 2Q46A 4OSPA 1QXSA 1WZIA 2D8AA 2GASA 2Y0CA 3PQEA 1M66A 3D0OA 3LT1A 3OIDA 3A06A 2GF2A 1KEWA 2B0JA 3BMNA 3VPGA 3OA2A 3VDRA 1PSDA 4FCCA 3H9QA 2YW9A 5A9SA 3L4SO 4MJLA 1ZJYA 1FDSA 2CVQA 2CF6A 1BTOA 4RVHA 3OM9A 4GGPA 2DKNA 1MGOA 2EIHA 3BHJA 3W4KA 4YT2A 4XQCA 4Z6KA 3DXFA 4J1SA 3NRCA 5FFFA 4NH4A 1DIAA 4JNKA 2FZWA 5AXDA 1YL7A 3U0BA 1K5HA 4IQ0A 1EK6A 3RKRA 4PG4A 1FDWA 3WBFA 4N54A 1XDWA 2PH3A 3AOEC 2NQTA 2VYVA 1SEPA 2BLLA 3BMNB 2PLAA 3F46A 3PJEA 4B79A 4M49A 2UVDA 3WGHA 4AFNA 4E2XA 1GEGA 1X7HA 1E77A 3OICA 2JFGA 3RD5A 4HV4A 2CZCA 4X54A 2ZATA 4HX5A 4DGSA 2BF7A 2ZB8A 4E13A 2W2KA 4C7JA 1YONA 1LSUA 5EESA 2D59A 3ANMA 3PVZA 1JWBB 3ETGA 3TQHA 3VTFA 4MVJE 1QV6A 4JN6B 3DZGA 1AHIA 4LVUA 2PWZA 4J1NA 4UEKA 4D3FA 3VZSA 1ZSYA 1MC4A 4CMIA 4TZTA 1Z45A 2WYWA 4PZCA 4BNVA 1V3VA 2HMVA 3H9GA 3PLRA 1PZHA 4CMEC 1ONNA 4PLFA 4RF3A 3T7CA 3X2FA 4PG6A 3C3XA 2YHIA 2YV3A 4IDBA 1ADBA 5LC1A 1GQ2A 2W2KB 1E5LA 2HKIA 3UN1A 2A4KA 1JU9A 2YHUA 4RO0A 7MDHA 2UYYA 3TJRA 4CLXA 2RHRA 3SLKA 3W1VA 4CMCA 4JBHA 1E7MA 3TL3A 4BNGA 4GH5A 1N8KA 2GNAA 4ND2A 4P4NA 1EK5A 1PQWA 3KV3O 2I6TA 2Y99A 3HDYA 1PL6A 3VPHA 3FN4A 4CMIB 3JQAA 1F17A 3KLPX 1GFSA 1WVGA 3HZZA 2VZ0A 4IINA 4AJJA 4YDRA 2IYPA 3SC6A 1VC2A 3RAJA 3H5NA 3ZNQA 3UKOA 4ALKA 2YHIB 4OGWA 2Y93A 3ZDFA 2YDYA 1E7SA 2IEDA 3DMTA 4RL6A 3S1LA 4LCEA 2WSBA 5G0SA 1IE3A 2VUTA 5GZ3A 1KEVA 4ND1A 3PHIA 3IOYA 3UICA 4I5EA 2FR8A 3H3JA 5JCJA 1P3DA 2DUUA 1M67A 3JQFC 2CUKA 2X8LA 3GNQA 4GMGA 2BHLA 4CLEA 1U7TA 4EUFA 2P9GA 3JQAB 4E4YA 3QVSA 2G1UA 3HG7A 4R5HA 2P4HX 4E21A 4BS9A 3H9UA 3JYNA 3NKLA 4PIVA 4YB8A 3SXPA 3VZPA 2SCUA 2P2SA 3HDQA 3RIHA 3VZRA 5CHEA 5DNAA 4BMNA 2A92A 4D41A 4RPKA 4PN3A 3FR7A 4XEHA 5JAIA 1ISFA 4BKQA 4CQMB 1P1IA 1H6DA 4EJMA 1ISHA 2VHXA 3CSDA 1QMGA 1HE2A 4JJGA 3WYEA 1YVEI 3A1NA 1RM0A 3IP1A 4DMLA 1DEHA 2JFFA 2C20A 1FXSA 3GT0A 3PTZA 4RPJA 3DB2A 4DYVA 1NHWA 5EINA 4BKRA 4YWJA 4BQRA 5IF3A 2RH4A 1PGOA 5JDCC 2G5CA 5L7YA 5DBFA 2AEJA 4PLCA 2EGHA 4R16A 1NTOA 2R00A 3NV9A 4URFA 5MGBA 4IQ8A 3ANNA 4TRNA 3NJ4A 1V3TA 2JHFA 1EFLA 4O1MA 1A7KA 6LDHA 2XF8A 2Q4EA 1KEUA 1E3EA 1PJTA 3FPLA 2I9PA 2NU8A 4NU5A 1NASA 3STHA 5G2OA 2E4AA 2AEFA 5CP8A 1EUDA 1LRLA 2FPIA 3JQ8B 3K73O 1GDHA 2Q3EA 3V2GA 3KRTA 3GR6A 3VAZA 3DOJA 1NYTA 4RF5A 2D2IA 4M54A 2GZ2A 2WM3A 3PZRA 4Z0HO 3EGOA 1YGYA 5HM8A 3G49A 2O7SA 1ZK4A 4F6LA 2C5EA 3TOXA 3GFGA 4HFRA 1HE4A 1GQQA 1PJSA 4IY1A 4MKRA 4OIMA 4PLTA 3JQEA 3WIEA 3OEWA 3DTTA 3DZIA 1CERA 4R41A 3PHJA 4Q3EA 4YBZA 1VJ1A 1XQ6A 3WIDA 3G17A 1H94A 5EIOA 4BNTA 4XB1A 3GPDG 1X0VA 4U0KA 5CPFA 2VYVD 4IJKA 5T5QA 4BKOA 1CYDA 4M86A 3RVDA 3H7AA 2RCYA 3AW9A 1T24A 5T67A 1MFPA 3DBHB 9LDTA 4RPLA 1Y8RA 4FQ8A 1KERA 2ZCUA 2O50A 4FBGA 1L7EA 1EZ4A 4FPXA 1U2GA 3EHEA 3ROQA 3MJSA 4CM7A 3JD4A 3LT4A 4EW6A 3HDJA 3RUEA 4EUEA 5JDIC 1FDUA 1NPYA 2CFCA 1LDYA 1GUYA 1XKQA 2X86A 4BKPA 5IDWA 2FR0A 2NU9A 4N7RA 3GPIA 3WSVA 1PEDA 4AJIA 5T8KC 4FW8A 4O6VA 1ENOA 3MWDB 3JQ7A 2QRKA 1UDBA 3DFUA 4XWYA 3MTGA 2X23A 1XU9A 3DZHA 3VH3A 3E1KA 2Y0DA 1Y8RB 4ZA2A 1A71A 1B8PA 1Z75A 3KUXA 3OJEA 4GL4A 4J0FA 4BL5A 3Q2KA 1FDVA 3D1LA 1ZXBA 3PFFA 1XQ1A 3P19A 1NPDA 1YO6A 1E6EA 1YB5A 3EC7A 5AXCA 3RROA 3U62A 4P4GA 1I3KA 4OHUA 5B37A 3RUIA 4UUNA 4NFSA 3TZ6A 3JQAD 1ENYA 1J0XO 4E31A 4RVFA 3WGOA 3UF0A 2QYSA 4RLHA 3TNLA 2X5KO 4A5OA 2BFPA 3L6DA 5DP1A 3KEOA 1GD1O 3JQ7B 4R51A 3D3EA 3WQRA 3BTOA 3VVCA 2O4CA 3RSHA 5GZ6A 1R12A 5KOIA 4N5NA 3RCBA 3ZU5A 2NTVA 2NADA 4GVXA 3OMLA 4CV1A 3W8DA 4EI2A 5JCJD 3FWZA 4QEDA 4WCFA 5DCUA 4I08A 4LW8A 4BO3A 1P1KA 2EF1A 5JAMA 4GX0A 3O03A 2EKLA 4DPMA 3ETEA 3HNPA 3VKUA 4DQUA 2QRJA 5TF4A 1PX0A 2NLOA 5K9ZA 1ZK0A 4MVJA 1ZMOA 3PJDA 2Y0EA 3GG9A 3IKTA 1E3JA 3FBGA 4GLOA 1HE5A 1KC1A 1ISMA 5A05A 2CD9A 1A4IA 1P77A 3QQPA 4MDHA 4NFHA 4GX5A 1H6BA 2VWPA 4BGUA 2YZ7A 4XA8A 4BNXA 5C5IA 3QWIA 1UP4A 3ASUA 3BA1A 4OL9A 5AVOA 2EG9A 2GLXA 4JK3A 2GO1A 4PG5A 4GWKA 3CTMA 1SC6A 4YJHA 1DAOA 3KTDA 3GDFA 3NX4A 4NIMA 4YJFA 4JBIA 4CV0A 1E3IA 1LBEA 3CXRA 3GK3A 1ZZEA 2NTJA 1Q2XA 3P5SA 4D45A 2HDHA 4J0EA 4E3ZA 5A3VA 4EJ6A 4F46A 4BO5A 1HYEA 1HDCA 5CDUA 3AFMA 3ADPA 2IXAA 5C3MA 1KVSA 3OEYA 2VT2A 1CRWG 1LTHR 1DAPA 4YAGA 4YRAA 2VYNA 1PJ3A 4Y98A 1O5IA 4RVDA 5JBIA 5EQFA 4YJHB 2DC1A 1QYWA 5G0UA 4W6ZA 2DQ4A 2C2YA 1A7AA 3OH8A 4YJFB 3WMWA 4CJXA 1EQUA 1VSVA 3U4IA 4BNHA 2CVZA 2NVUA 3QVXA 4UAGA 4KQXA 2YYYA 4BNLA 3B1JA 4Q3DA 1D1SA 1PQUA 5DP2A 2NVBA 4UVDA 4AJ4A 4ND5A 4ZRMA 2VTDA 4KTTE 2O3JA 3GEDA 1H0KA 2FWMX 5BNFA 3I83A 5IJZA 2CDCA 4L75A 4CUKA 3E5RA 3OHSX 2EEZA 5CDSA 3DTYA 3KO8A 1LSJA 3WMXA 4HFJA 3GN2A 1K89A 5ES3A 6ADHA 2OXIA 2C82A 1PJ4A 2NVUB 5A3JA 2D0IA 3DZBA 4NFYA 2X9GA 4IMRA 4ESOA 4J3FA 4K6FA 3GVHA 3M6IA 4IDGA 4B4WA 4OXYA 2Y1FA 3WLFA 1XWFA 2QZZA 3EMKA 1FDTA 5LDHA 5U9CA 3ON5A 1HDXA 1KC3A 5IDYA 2PGJA 1TT7A 4CR6A 2XXBA 3MEQA 3FD8A 2XXJA 2PD4A 4CM6A 1I3MA 3AOEA 5BSEA 1EEHA 2QZ9A 4LMRA 1HF3A 1ZK1A 2PZJA 2JKVA 1ZO8A 1YQDA 1PGNA 4MVJP 2YY7A 4YAJA 1A27A 5F5NA
chains in the Genus database with same CATH superfamily
2GEUA 3OZTA 1QYRA 1X1DA 2ZLBA 2R2AA 1JXQA 1MLDA 1OIXA 2JCVA 3AETA 3FMPB 5CVJA 5B58T 3RBZA 5LQMA 2B4AA 2ATVA 3KXIA 3C3BA 4AECA 2BM1A 1JFTA 3EPRA 3HDTA 2KS6A 1CUXA 2HSWA 3PFNA 1FXWA 1N5MA 2GJ9A 1LS6A 2R4UA 1ISRA 3EOBI 4OGLA 3UK7A 1QFSA 3D8UA 1X94A 2BDUA 3BK2A 2XCSB 3KV1A 2CZQA 3AFGA 1QANA 2PD6A 3A3NA 1RZRA 3Q8MA 1JHPA 2BL4A 3K1YA 3PB3A 3QUSA 3Q6IA 4HFNA 1B26A 1G7RA 2I99A 3T9FA 3VC7A 5ALPA 4JIGA 2PZAA 1XZQA 3QNUA 5DYYA 5AIAA 2GBIA 1C8LA 4HS9A 2EXXA 5HXAA 5E9WA 2VPTA 2O5EA 5LNK6 1TT5A 3M81A 1LI5A 2VI5A 1BGWA 1FXUA 1K8XB 3FOBA 4BU0A 5M29A 4E5UA 3JV7A 5KQPA 2DKFA 3HP4A 1XNGA 4ZI2A 5CAEB 1CY6A 1XZLA 2LBPA 3ITKA 3MD0A 3PL5A 3SYKA 4MR9B 4TTRA 2JI8A 3F5QA 3M4YA 4AC9A 3WQQA 3DQPA 1SIUA 2MSDB 3TZKA 4KN8A 2XYRA 1TL7C 5ALVA 3FHOA 4GGMX 1PTJA 1YJBA 1FMLA 2HM7A 4G81A 1N2BA 1C1DB 4ZYXA 4AJNA 4W9NC 2YV2A 3GLHB 5BQOA 1BJTA 2RH8A 3T3DA 4XH9B 1JAYA 3L6BA 4CKEA 4WCDA 3HUDA 1UBGA 3NHYA 5A5EA 4MVJD 4FYVA 1MV8A 3OCJA 4MKZA 3FYCA 3L7AA 2WPDA 4KJXA 1M10A 4DMMA 5A4IS 3PQ7A 3R0JA 1LRJA 2XQVA 4I9UA 4F1KA 1ZR2A 1H8HA 2NZYA 2HTFA 2NSHA 2HWKA 5EP4A 3ZHOA 2GN4A 3AHHA 4YV0A 2FEOA 5CEFA 2IHZA 3IEIA 2NO5A 2OBLA 4EDFA 1N2CB 3DVRX 3KZKA 3G2IA 3S70A 1L7MA 5HQJA 1E7YA 5JE8A 2VQSA 4EB8A 2X4IA 2P2DA 5DSTA 4E07A 4WFQA 1GV0A 2OMEA 2RGCA 2V0CA 2WLTA 3A9SA 4C29A 4POAA 2CVPA 2QTHA 2ZTSA 3ACDA 2WV7A 3G1UA 1LLUA 5IRCD 1RMQA 4EBFA 4GKBA 5IARA 1USKA 2VO1A 4ZYTA 1CWUA 4NTZA 1HBJA 4ZO4A 3KG2A 4YJ3B 4NY1A 5LM3A 3KQNA 1N2EA 3A31A 2ZI6A 3EXHC 1OHHA 1XTQA 1THMA 1G63A 4HGQA 3F6CA 5B30A 2XZOA 3FLMA 4MA5A 2SKEA 3WSTA 2I62A 1FA9A 1MVOA 4PWZA 2Y05A 3ABQB 1NVUQ 3LCJA 4FEEA 3WYAA 4EB6A 3ZHVA 1LXCA 4DR7B 4ON9A 5TS2A 3NDJA 1V4NA 1UDCA 4NG4A 5L3SB 5I7WA 3MWLA 4Q34A 3DZCA 3LIPA 4IJUA 1XBTA 5ALDA 4BNIA 1GLVA 1VSUA 3AP3A 3KBOA 3NIBA 5F77A 4YMHA 3N0VA 1KJZA 3RGGA 3VJLA 4R0VA 5KPJA 3F3SA 4X7MA 3RYCB 2QIOA 3H2IA 1I9GA 3K72B 3HN7A 1I13A 2W6QA 4ARZA 2JZNA 1G19A 4ZV7A 5C32A 1SXJD 1BGVA 2V6BA 4L8GA 3WLPA 2OZLA 2IE8A 1E4OA 1RAHA 2DOKA 1GYRA 1BQEA 1KK0A 2FUNB 1Y89A 2QAJA 2XMSA 3ICPA 3NHFA 2O2DA 3PYMA 1NYLA 3GA0A 1U1DA 2P35A 1QDUA 2GKGA 3F90A 2UUBB 4KN5A 2ZBEA 1JFSA 4DV0B 4QDUA 3LUFA 2NX2A 3AWDA 2C78A 3LXMA 4CPDA 3BFJA 5L9AA 3I53A 4OFZA 4EI7A 3ONFA 3CLTC 4TM7A 4H3KB 1DDIA 1HYGA 1UWKA 2O2SA 1ZCFA 3LYAA 4IHKA 3OAAA 5DN6D 1UP7A 2B9VA 3HUUA 4I4IA 1SKQA 2C2WA 1FBNA 2YWBA 3G2NA 3PDIA 3D3WA 2YICA 4L2IB 4OUDA 3IPYA 5JTUA 3PGJA 4UU8A 3TQCA 4NENA 1PZNA 1RHUA 4Q7EA 5FP0A 4BXOA 1TMOA 1U3UA 5CA0F 4KV9A 2Z4RA 5KQRA 2QI9F 1IHXA 2D54A 2PN1A 1PT5A 2ZIAA 3CG0A 6ABPA 4PVDA 1PKEA 2YJTD 2I6FA 4AW9A 1LH0A 4RTNA 1I8TA 3RK0A 1T8TA 1Q77A 2IVFA 2W8ZA 2D1FA 4WZZA 3HK2A 4TMTA 1ZN7A 3SC4A 3KSZO 1R6AA 4XM2A 3T6KA 1CRZA 3TTWA 2HBZA 4BX0A 1SVMA 3WJ2A 1EDEA 4R54A 2QRVA 2R1TB 2ZSDA 3EZ6A 2ZUDA 2I03A 1JQKA 5DEIA 1FTGA 4BJ5A 3PPIA 3GLRA 4U9IS 4JBXA 1U80A 2DVMA 1GTJ1 3DOIA 5IAAA 1MZVA 3I58A 1AGXA 1E3QA 1SQ6A 1V1RB 2OEPA 1BD3A 3DW1X 3A6GA 3BMOB 1IOZA 3FWKA 3IT0A 4B3DA 3SYNA 5JQGF 4AKIA 2WAOA 1ML4A 1Z17A 1LDGA 2HIMA 2IV7A 5I9MA 2ZWOA 3H5OA 4CZ2A 5EJ2A 4NMHA 3LNCA 4C22A 3VPXA 4EA8A 3AONB 5HR5A 2CMKA 2Q1UA 3HZOA 3NAQA 3HB1A 1WRBA 4Q9DA 2ONCA 1KXZA 2EFEB 2G7MC 5JAUA 1AKVA 1UBUS 3WHIA 1JIKA 1WWKA 2QHXA 4I81A 2XHZA 5BUSA 5KUTA 3K1JA 2C2BA 5BW5A 4DIMA 3I9V6 4DUZB 2GBPA 1Z4JA 3V2IA 3VX4A 2ZRGA 3QVWA 4ZQEA 2WG0A 3U7GA 1VCMA 4B9AA 2HK9A 4LK3A 4YRBA 1RHQA 2YVQA 3LT0A 3O8OA 2ZYVX 2P8SA 4BV8A 1I2AA 2QTVA 2AR0A 5H1YA 3B7PA 1S7CA 2P9CA 2DEUA 2PLNA 1VMIA 4O8CA 4OB6A 3ZHZA 1XRMA 2O8DB 1BOOA 5AW9A 2QVGA 1NBIA 2NQ2C 2Q6LA 3TM5A 4FOPA 2M98A 1UMDA 1ZJZA 3QYPA 5KJEA 5PGMA 2Q3LA 4AJHA 5EHIA 4D8XA 2E37A 3QE0A 3GQBA 5EHZA 4MVJI 3DHYA 1SCAA 4GHWA 5HQ3B 5B4UA 4OTZA 2RGBA 3OTGA 4JCOA 1V11A 2UYCA 1D9ZA 4B83A 2YWGA 3WYCA 2DTDA 4LOAA 1L4KA 5SY9A 2GHIA 2XI4A 5E8JA 3LH5A 2RGEA 4HQKA 2H9IA 3EOAI 3PYLA 4M0FA 1SIBE 4RSRA 3QGMA 2G5TA 2V1XA 4QYSA 2BEUB 2GD1O 3UAWA 1SQSA 2DWPA 1NZFA 1NWCA 2BFFA 5SV2A 1PUXA 3UO8B 3RRYA 3GEGA 1RWXA 2BRUA 1L0BA 4ZCRA 2YR0A 3ENZA 2XGMA 1OWLA 1HSOA 3F78A 3BKXA 1OX6A 4ILEA 5IEBA 1T36A 1JHMA 2QZSA 3THWA 4P0QB 1FMJA 4XD7D 4DQKA 1AN9A 3CH6A 1U8XX 4X6XA 3K6JA 2R6GA 3VO2A 4XWKA 1OTHA 4NBWA 3RF7A 4GMKA 4QTXA 4YS6A 1B73A 3PC6A 3KR2A 4FCVA 1LX6A 3BWEA 5HBRA 1C4OA 2EDCA 2BMAA 2Q0SA 3AB3A 3GC6A 3I72A 4FFVA 4RPHA 4TYWA 4IDHA 4MA0A 3IHTA 5C0OE 3PHLA 2V8BA 4OHYA 2K5UA 3O5AA 5JEDA 2XUZA 2VP2A 3I5MA 2CLCX 3VTKA 5HKKA 2INGX 5KKNB 4DT1B 1Y6RA 1EX7A 3KXPA 1Z62A 3HBFA 1H9BA 2A5GA 2WTMA 4JEIA 4LQDA 4UVGA 1V5IA 4FT4A 5KBYA 1AMUA 3UEOA 3PGVA 2ETVA 5J4HA 1YHNA 1ZNWA 4ZCPA 1B2LA 3WDLA 3SX0A 1PYOA 2NUAA 4C1NA 2LPMA 4E5YA 1I94B 2HXYA 1NDHA 2WKQA 1Y7PA 2SICE 2RARA 2GBLA 3ZWMA 1T6XA 3MMSA 1BA2A 3HP7A 1HT2E 4LJKA 1TK2A 1CNFA 2DHDA 2WM9B 3BIOA 3L7CA 1X86B 2DUJA 1BEZA 1CNMA 2F1OA 2QROA 3IV7A 3QBJA 2CL0X 4DA6A 5AM2A 1WR8A 221PA 2Q3DA 1BN7A 5IC4A 1ACMA 3UVEA 4P3OA 1VCNA 3PUVA 2FPGA 1B15A 1KJYA 4HDNB 4Y18A 1I6WA 5KKAA 4DS3A 1RC8A 2XBMA 2GARA 1LPMA 3C43A 3W5JA 1P1RA 3HJTA 1PDOA 2FDCA 3AUKA 4YASA 4RZSA 3E9RA 1WDLA 1HWYA 1SQ5A 4IDEA 4Q00A 1I7SB 2F64A 4YJDA 3I6BA 4ECEA 1CQIA 1AZWA 2FMIA 3KSRA 3NWEA 4U2KA 4A2QA 4EELA 4JX8A 3E5MA 3GLQA 4MRMB 2RHTA 3QIAA 4Q93A 5H9WA 4XVUA 5JZVA 3U4GA 1U5CA 2A1UB 2RGYA 4P80A 4GKVA 4DNQA 4FGJA 5BYBA 3D6VA 1Z38A 3GZ4A 2JCBA 2WBLC 1DXOA 2I2DA 3V2HA 3ZI4A 4V0LA 3TNYA 5ICSA 1AXGA 1NXWA 2IL1A 4HDSB 3NC0C 4X8HA 3DMHA 4L4SA 3YASA 4URYR 1RI3A 3GJYA 3F9RA 1ZONA 1ESDA 1XCMA 1ZRNA 2ATXA 2QM0A 2WOOA 3EGXA 4OP3A 5T4HA 3UGKA 1GPUA 2QTTA 3A4VA 4QAQA 2E0IA 2F2TA 3ZK9A 2I55A 1S01A 1UPFA 3GYGA 4Y0VA 3R9XA 1N5RA 3G02A 1LBHA 1QYCA 2DX7A 2JHPA 3CT6A 3PRKE 4LHWA 3TQQA 4MSUA 4PXYA 3TW8A 2A9QA 4MAMA 4B3SB 3PWZA 4HVAA 3H2BA 4FGWA 1JGTA 5JRJA 3BMCA 1OKKA 1UXOA 2B69A 3M5DA 3TIXB 2W98A 5IWAB 4PHHA 2P79A 3B9PA 3U48A 1DAHA 2FYTA 1GG9A 3HHPA 2KMLA 3V8EA 3DLAA 2GDZA 3MMNA 4J3NA 2N1MA 4M98A 3D59A 1COWA 3ZKWB 3A4YA 4QYXA 1P4HA 3MCTA 1U5BB 1BYUA 1NXVA 4IIYA 5HRUA 2OO3A 5JTTA 2XX3A 3H13A 3AUJB 3CCCA 1TU4A 2YCLA 5M5BA 1C8VB 3KXLA 3X1MA 5IZCC 4JGIA 5I5EA 2HJHA 3H05A 1CZKA 3L1IA 3TO5A 1II8B 3ST7A 4UBIA 1M1YA 2V7GA 4XRGA 4FFMA 5KWSA 4B5LA 1W0JD 4O2AA 3C98A 1JVBA 1T13A 5HZKA 1I6KA 3ONVA 3FPCA 3N8HA 1E2KA 1AS3A 3KJZA 3V7YA 4FCWA 2KYRA 2XVAA 1N7HA 1X1EA 4LDZA 1C0KA 1N9GB 3KYDA 3SM9A 3FBWA 4PTYA 5BORA 3STVA 5L51A 4NXMB 1MTZA 2WZBA 1Z25A 5LQRA 1SNYA 3KKEA 3PX2A 3DWEX 4L8LA 1HH4A 3GP3A 1L7NA 2HD4A 3H86A 1VKJA 2AJCA 4ZO8A 1B74A 3RVNA 1PSZA 4D82A 5LWQA 1Y6GA 4W4TA 1YQWA 1YOVA 3FRHA 5JNTA 3GJXC 4ZPXA 4EHLA 2YDXA 1QUEA 2I2XB 3H2KA 2HMWA 2KBEA 1J2YA 1NQWA 3P0RA 5BOVA 3GROA 3SHOA 4OQ4A 4B7CA 2A35A 5FL3A 4EIWA 1DFGA 1NMXA 1RHMA 2V7XA 4A73A 3RLIA 5AM3A 2ZWVA 1XOIA 2JIZA 3H4VA 4ITRC 2NU6B 1WMSA 2GETA 3F4LA 2GT1A 4QLAA 5TT0A 1LQTA 2DWUA 3CE6A 4M8KA 3RHFA 4E70A 4S24A 5SZHB 3REOA 5JYCA 2AE2A 4MKHA 4R8LA 4B87A 3LLVA 1SU4A 2Q2QA 4NLLA 4LUCA 4ZOCA 4FGKA 2WQZA 3VH1A 4F6RB 2AQKA 3E22B 1ZIYA 2I67A 3A27A 3DBRA 4ND6A 3C3CA 3DAFA 2PKXA 3L82B 3P71T 4TVBA 5GADl 3PFCA 3GFTA 3MPUA 3NHMA 5DYNA 1U65A 3W0LB 2PMEA 2FN8A 3SDSA 2HQBA 1YKFA 2ORYA 3ABOB 5DM4A 1GFIA 2CJWA 1A3CA 2HRQA 3OETA 2WIFA 1NUUA 4KAFA 4UAUA 1VJ0A 2IP4A 2VUUA 3GUUA 3H4MA 3VYRB 4CN8A 1JIXA 2R5NA 4RZXA 3I0NA 3V55A 4EECA 3PC8C 1FFXA 5AUPB 4N5DA 4DCJA 1UBFA 4EX7A 3PPWA 1ETHA 2NSYA 1V48A 1C9NA 2BMVA 1FQOA 1BW9B 1UAGA 2QSUA 1LK0A 1IOLA 2VOJA 3FMGA 4UDNA 4WNCA 1BFUA 2HJVA 3BZBA 2JH9A 1NUHA 1TM3E 2Z4TA 2HLDA 1C4KA 2VSYA 5B53A 4I7EA 4ZODA 5C7LO 4ZQGA 3EVNA 4B0OA 5EMNA 1Q95A 5THKA 3UNXA 5KINB 1WHSA 2QD4A 4HZUB 4C6HA 2OTCA 4R0MA 5U4XA 4G0VA 1LDNA 2CVHA 3U37A 1OBFO 3OLVA 4DYHA 4MV9A 4U1RA 4NHEA 1WUHS 3SY8A 1Z6AA 1R7RA 1KAMA 4Q3OA 2IBSA 3GCWA 4TTAA 3TX6A 1YTUA 4XR9A 1XYGA 2E7ZA 2ZANA 3BDVA 3LVRE 2AQ8A 5HE9A 1IJEA 3TH5A 1J99A 2AC4A 2F3TA 1QGYA 2DY0A 4W9NA 4CQMD 5IHPA 1JFRA 3MT9A 1M7HA 3D6TB 3IMKA 4X1YA 5E1OA 3ICQB 2AYYA 2OXTA 1RBMA 2CXHA 4QYWA 3T1VA 2PEZA 5L3QB 1JQ3A 1ZXLA 3RRFA 4AIIA 1RJGA 1SKYE 2NYRA 5HGJA 4ZK6A 1BEUB 1KF0A 1QZZA 2CK3D 1RWVA 2AX4A 4Q3NA 2ZKIA 3RPEA 3T9AA 3TRHA 4YTEA 2FUG1 4GOJA 2HGZA 5TT1A 1HE1C 1KYTA 3I05A 3SZMA 4YAWA 4TOIA 3CZPA 2PUEA 2DCMA 5KJ6A 4RMJA 4AY2A 2QI9C 2AI3A 1K1EA 1E3LA 4HGOA 1QIGA 4K2HA 3UANA 4WFJA 3ZPXA 1Q3HA 1G8SA 2X58A 3FRJA 3OMXA 3U39A 3ZY2A 4AX8A 5JZ9A 1TIPA 5GM2A 1XEWX 2R62A 2ZRDA 3FVRA 4J4TA 4EKDA 1EX6A 2WZQA 3EEOA 2YOHA 4LXXA 4PSDA 3O2JA 1JHYA 3BXXA 4LMPA 2ZYAA 3AHIA 5AJYA 4O4IA 1L7PA 1RTKA 4YRPA 1P7ZA 1Z5WA 2GM9A 5I8WA 5JCOC 2DFVA 3DZDA 1MA3A 5DK4A 4ZJYA 2BW0A 1M8PA 4R6WA 1W19A 1K7XB 4KOEC 3TTXA 2CKDA 1X3LA 4G23A 3EXHA 3KYBA 3OFNA 4R31A 3UV6A 1N1DA 3P97A 2E1PA 2WMNB 1ZJWA 3WL3A 1YVUA 4PHGA 5CH5A 3KYJB 4YMIA 1ONOA 4Z4IA 4NMXB 5CJ2A 1ZH4A 3DEIA 4R98A 1F12A 2RGDA 5CA1F 1R6DA 3FMIA 1VBNA 1SIOA 4G65A 4ZANA 3V3TA 5M7EA 2R8RA 2YS6A 1FE8A 1JLMA 5BSUA 3KELA 2QJRA 3AUYA 3RAGA 4FI3C 3QWHA 3L07A 4ZCIA 1K2WA 4RVNA 1H5NA 1EFRD 2ZK7A 1E4EA 2JVKA 1DIHA 5CMLA 5TDHA 3RQSA 3VVLA 5EERA 5LP1A 5BR1A 4FHZA 3OC6A 3TQTA 2WNIA 1F2UB 1P1CA 1KEEB 4B46A 5AM1A 1JG6A 2POCA 5IVDA 1U4NA 4ZAWA 3GJ4A 4RK0A 1VL5A 3SEFA 1H1LB 4KTVE 1YBVA 4URHA 4R9NA 3CF4G 4Z4EA 4PLZA 2HMYB 4C4OA 1HXHA 1I2MA 3A32A 3PFIA 4FNOA 4BP9A 3PXEA 4DJDC 3W04A 3ZN2A 4AZWA 3F47A 1X8JA 2X13A 1KIAA 1E69A 1U3VA 3KHKA 3O7WA 3BD7A 2DPXA 1LPAB 2FJPA 3L40A 4R3UC 3LSYA 4ARVA 5HJ7A 3V80A 4GS5A 2R9VA 4XDYA 1JA9A 3EY4A 1KSHA 1SHZA 3QOXA 3EGIA 3IAAA 3K5HA 1E94E 2DAPA 1ZGZA 2V4ZA 3ZGYA 2DUMA 1Y1KE 4MVXA 1BGXT 2COUA 4UCXA 3ECSA 1E62A 3G5LA 4TZ0A 4Q39A 3FLEA 1EIZA 2C8KA 5I7VA 3NIGB 3W1WA 3AQ4A 3GDHA 3IA7A 3FDZA 3NYIA 4EFNA 4HJXA 1K66A 1QGUA 4KO2S 4URWR 3GRAA 1JHOA 4NATA 3E48A 3Q15C 1Z34A 1ZWKA 5FBZA 2IZ5A 1RRPA 1IWBB 2YL2A 5H9VA 3SC2B 3GLIB 4KV7A 3LP8A 3KR0A 3P9YA 4BRSA 1YIAA 4G5GA 4CLDA 1WB5A 4Q9LA 2I3BA 1NOKA 2CXSA 3NALA 4EHKA 1IUKA 1XDBA 2A0FA 2GZMA 5AI9A 4ER6A 5JPCA 1DJNA 5T41A 1YIOA 2Q4DA 2XNCA 3KR1A 5ALZA 2AKAB 4ENRA 3LQFA 4RA6A 1MHPA 3K20A 1YQQA 3L18A 2FPMA 1SCIA 2XMPA 2YV4A 3WTCA 4ZPJA 1NVGA 1T5IA 2CNWD 4YJ2F 1AUPA 2JAQA 1DXYA 1RWQA 4RX1A 1JDUA 2K7ZA 1I1NA 2NTYC 1DO2A 4ESEA 3PUXA 3DL4A 3PU6A 2BUBA 4ND8B 2BMFA 3KQMA 4OHMA 2H1HA 1N4DA 4G1EB 1GRVA 4RGYA 1PT8A 3GZTB 3D2LA 5ADHA 4IXMA 1MNQA 3P9KA 4BZQA 4IIGA 3H19A 2PMFA 1UDRA 4BFSA 2V6FA 3QEMB 1DO8A 1E59A 1E96A 1CUGA 2EP8A 5KYYA 3ZIDA 2LE0A 3O0TA 5LYJF 1Q1GA 1DKRA 2OQRA 4G8BA 4II3A 3GYBA 3KETA 1H5QA 4J7UA 2Q2VA 3QMVA 4N03A 2P9BA 3L77A 1H6CA 3JAWB 1QHFA 3AFOA 2FJUA 4MDYA 4RWZA 2VSQA 2AG8A 1K6IA 4PCUA 2P5TB 1PP4A 3TE6A 3RO7A 1ZM9A 4QARA 5CAEA 2AFRA 3W8FA 3ADOA 2IODA 3JY6A 5AVSA 3WFIA 1GCUA 2V7QA 4KQHA 4TT8A 3B3JA 4RJTA 1GZUA 1Z28A 3SX4A 1ID1A 2LZ0A 3AJ8A 4PC2A 3UB2A 3N0XA 3H1PA 1PVDA 3B60A 5DSXA 2XZTA 2YBDA 5IBPA 3OQPA 4KACA 3OP4A 4DY6A 3I9OA 1E0AA 1EAYA 1JMKC 4PAOA 4Q4JB 4YO7A 1OU4A 1UBCA 3JSXA 4Y1RA 5ARDA 5ALUA 3O8QA 5D6OA 2C54A 2H65A 4OM8A 2PPLA 3ZJUA 4HQNA 5AHXA 1NYRA 1VCHA 4C30A 1JDNA 2O3UA 2GJKA 1M0SA 4AY4A 3OFVA 4D5GA 4DZRA 1Z0FA 2X0JA 2PXXA 1E9VA 1B00A 1V3UA 2CLMB 2VNSA 3EPPA 3IDZA 3UW3A 4BFUA 2I76A 1C3VA 1MOSA 1XZAA 3GO4A 5FTNA 2BE7A 2QMUA 1BKYA 3AUXA 1ZRMA 3HPQA 4GGOA 1HEUA 1CLEA 1UCFA 2BJWA 4MRAA 5G1OA 3R76A 3TLEA 2BFOA 3W3AD 1NVFA 5EYPA 3U3MA 1OF1A 1YQXA 3FJYA 1DIOB 5LFAA 2Q6VA 1KBZA 3L02A 2WUVA 1WW8A 1YGPA 4L5CA 1DO0A 4LQLA 9ABPA 3DC2A 3DR3A 3FNEA 3WA7A 4RHYA 4XX0B 4UU0A 3FHTA 4GZ6A 3JALA 3K0CC 4MR8A 3OLZA 1EQAA 2V6JA 2OHJA 1MBZA 2GD6A 4BQFA 2MINB 1WXDA 4PZYA 1X42A 2B94A 3FWPA 3W6PA 3GEIA 4WESB 3AVXA 5CFOA 3TFOA 2PRSA 3K70B 2V4UA 1YVRA 3FFWA 3FHJA 4U7PB 4WLEA 3V00A 1XL0A 1YDMA 3L6OO 4IX1A 1J8MF 3H2SA 1U4SA 4G5QA 3IC5A 5KVQA 5EWLA 4DIDA 3UHAA 3TXAA 4RFSA 3HFSA 3H2YA 1TDJA 4RTKA 1LU9A 2W6JA 4UTZA 2O8CB 1T6ZA 2IGTA 2MSLA 3CLRC 3MWGA 2QQEA 1YA8A 3MWJA 4IJ6A 4MKGA 1EIWA 3K1AB 2A86A 2HBYA 3GGOA 5DX8A 2YN2A 1I9CA 2OVBA 3AERA 5FPHA 4C0AC 5JC1A 2ZIEA 4B6OA 3GHYA 1JHDA 2LP4Y 3C7AA 1HYQA 7MHTA 2H7VA 3ER6A 4YYEA 1VG9B 3PQCA 1FRFS 3SR3A 5FUMA 1S2GA 1G17A 5IUJC 4QM6A 4R5MA 1ZJ4A 2H7CA 3MT7A 1ZD1A 2QUIA 1EVKA 4J4HA 4BUCA 3NWJA 5DCWA 3K8ZA 4Z7JA 3CMCO 1OFHA 2D7JA 1PRYA 2QG9A 3NTQA 4QUJA 1XR3A 3UCEA 1X39A 3S6JA 1CQPA 1M2OB 4H4CA 4TV8B 4RJJA 4JMPA 1H2ZA 1Z7GA 3DQZA 1L7RA 3HYRA 4PTLA 3BORA 4MA4A 1G7CA 4MV0A 3UUEA 2CLKB 1RQ7A 3QYAA 4HO1X 4IOJA 5JSFA 2YINC 2DSNA 3QW2A 4F06A 2HMTA 4BTVA 1Q0PA 2OM6A 2QLLA 4WLVA 1V95A 2Q2NA 4ZVUA 3LHDA 5KYWA 3PWKA 4HXEB 4XB2A 1E2DA 1T1GA 2HRBA 2IXGA 5IASA 1H22A 3QBDA 5DGHA 1NLUA 1KZGB 2YRWA 3VYUB 1HZJA 1KH1A 4AZ0B 2G83A 1JIJA 2XGSA 3R7BA 2WY2D 1YE3A 3CZCA 1WOYA 4RPIA 3W4JA 3H11A 3IRVA 3NW9A 3STTA 4QPZA 1G6KA 4JNCA 3DKPA 2YQZA 4UFNA 1DG3A 1XQVA 1GT6A 2GPTA 3E8XA 2PWBA 3BWYA 2V3VA 1JE1A 1L1RA 1RYHA 2E55A 5ICEA 1U0BB 4LIPD 3TBHA 7ADHA 2W6CX 1PS9A 4F85A 2BMJA 4NYJQ 3O74A 1VIYA 4B3TB 4MS1B 2BEVB 1GYQA 3P9XA 4N12A 3PLAE 2QK4A 4V1CA 4P4SB 3INNA 1ZSVA 1ACLA 3V4PB 4FGUA 5ILOA 3KOUA 2L69A 3PT9A 4O2LA 4Z86A 1WPQA 4A36A 2YVLA 2H1FA 3CLHA 2PKQP 4KLAA 4CMJA 5IZCA 4DV3B 1PW5A 4HQFA 3G5TA 2AS0A 3WB9A 5DM60 2EL9A 5EZSA 3P32A 5A5FA 2Q50A 3A70A 4U9HS 2JLRA 2J7KA 2GCIA 4FD2A 3PEVA 1ZCBA 4DA0A 4IXWA 1QS0B 2J9GA 2VHCA 3B5JA 4R1TA 4BRWA 3AKEA 4JI8B 1IM5A 1EGVB 4W7HA 2VHVA 1KU0A 2VSFA 2Y0PA 521PA 1RYDA 1IBSA 1NBHA 4WOCA 1FU8A 3QELB 4CG0A 1GAWA 1LTQA 3BILA 2HQOA 4K6CA 1DIGA 3BCRA 4R68A 5GP1A 2JFXA 4WBNB 1NMYA 3HGQA 4BX8A 2FI1A 4RPCA 4EMBA 1KDYA 4J4BA 1GKLA 1XJCA 1AA6A 2DLCX 3ZW7A 4IOKA 1AB5A 4FFNA 3U4CA 2SKCA 1VBMA 2XD4A 1JHZA 4EKYA 3UOGA 3OBIA 4R8SA 1F51E 4G0NA 4ZU3A 4EYGA 2C5AA 2PFGA 4DMRA 4F5DA 1JECA 5FKJA 5LXTF 1NYQA 1JLLA 1MB0A 3JZDA 2N9UA 3PL1A 3C5EA 2BEKA 3OX2A 4DDKA 3WGUA 2HWUA 9MHTA 3NFRA 1C81A 2OGWA 1H2FA 2O1EA 3GLUA 3JQCA 3FSGA 4CM9A 2C4KA 5JCZA 3LV8A 3WYDA 1QP7A 3VSDA 1U3GA 3FNHA 2AFIE 4B81A 1U3WA 1X87A 1JBQA 3TIGA 3L7DA 2QTLA 1NWHA 1KIMA 2J4FA 2XUAA 4CG3A 3OA0A 1X7DA 3WGLA 4JJZA 4YLGA 4MW9A 1JDBC 3EVZA 4YMLA 1RFLA 5DEOA 1GDTA 4NQRA 1FU4A 1GAJA 1JG4A 1SBIA 3PC8A 1QHXA 4HB4A 3U4HA 2YIMA 5TVGA 2ID4A 3PPVA 1BE8A 2J87A 5E7MA 5BN5B 3SF8B 1QP8A 1TD9A 4L8YA 2J3MA 3LBFA 1ULUA 2QLMA 4PZZA 1CUEA 1EVQA 2CVOA 4IOMA 4RV9A 5DGXA 2HK7A 3EWSA 5LPNA 3DL0A 5EJ4A 1VYHA 1Y5IA 3KCNA 3TWOA 1H23A 3IKVA 3OFKA 3Q3EA 1Z29A 1MJFA 1P2BA 1V6AA 4YK7A 5C1BA 5KPDA 1T4MA 4YP5A 1T91A 5LOVF 4CQNA 2GPBA 3DA8A 3MMXA 1ZD4A 2PRJA 3DEAA 3NWPA 4GMDA 4NZOA 4AUEA 3KKNA 1H05A 2IYUA 5C34B 4AMBA 4C08A 3OE1A 3CW2A 2X41A 3CRQA 5JXWA 4KQ9A 1MIHA 1ZH8A 4D02A 4D9EA 2DJIA 2F3UA 3SS9X 1E79A 1O95D 4RZ3A 4LGYA 2HPVA 4IJQA 4MMXB 3TIVA 2XNKA 3FCYA 5TVKA 4F3YA 3QWFA 1IONA 4Q16A 4X00A 1Y6FA 1UJ4A 1IQPA 4YLYA 2ZU6A 4F12A 2BJHA 1Z36A 3EISA 2QUZA 1WVMA 4MVJH 4MK4A 2NN3C 4BVLA 1C3XA 3BXZA 5JXGA 5CA0A 5LSAA 4RW0A 2D06A 2GESA 3OWXA 3GJ0A 5HIJA 3S44A 4WFIA 1XVTA 3K4HA 1T8RA 3I9LA 4P98A 1E1LA 1VL8A 3ACBA 4O8ZA 4UKDA 4E5MA 1UT6A 2F6RA 3B7WA 3KXDA 4EW3A 1T1RA 3U7HB 4GMHA 3GCGA 1QGZA 3KHUA 3LK7A 1JKXA 2CHVA 1M5UA 5D5HA 3TMAA 1YE8A 3AOGA 3TZEA 2A1UA 3ABIA 3OX1A 2YWFA 1Y63A 4ZRDA 3QA9A 1DQRA 4H6WA 5CDHA 5K4HA 4I3HA 5JCOA 4L6IA 4ZVLA 2D5BA 1P8JA 2ZJYA 3B1YA 4ZQBA 5FPSA 1L3IA 4LY0A 1MKYA 5CW1A 1JHQA 1TC1A 4FGSA 1EFTA 4FIZA 5TQ0B 2GO7A 5CEJA 3OJLA 4ZVRA 4I50F 1UFRA 1UQRA 5IK2D 1ZW1A 4XQ0A 2M32A 1RFGE 1UDWA 3FBTA 3GCDA 3HSKA 1XA3A 3PEUA 4WZ6A 4JI0B 2H3HA 2G5PA 2C97A 1I7QB 1VJ5A 1QTIA 3DDHA 2Z83A 3TB6A 3CLUD 3PQ6A 1ADCA 3BE8A 3CGWA 3WR5A 1C41A 1T6BY 2P2GA 2FZKA 5J23A 3HVRA 1OJLA 2MHCA 5C18A 1TE2A 4AB1A 3IVGA 2OILA 1LDEA 2Q1WA 1HKHA 3D8TA 2OBBA 3LYLA 1OPRA 4GI2A 1U94A 3UV7A 1K9SA 1OXKB 5C8YB 4IEIA 4KAAA 4D9JA 4WXPA 4JP2A 5FWAA 1PZFA 1PEKE 2FZ5A 4OOFA 3GQVA 2B25A 5BR8B 3IAS1 1XZCA 1RXWA 1JEAA 2Y3IA 4FFBA 1Q19A 1RPAA 4KLRA 5AW8A 1TAUA 1GGKA 2POQX 3F8TA 3ZKWA 4GLJA 4BGVA 4G0WA 4A8HA 5EWJB 2CMGA 5ECWA 1JIQA 2Q5OA 4EWLA 1VRVA 4JHXA 4WXMA 3K30A 2G0TA 1TA9A 5JLAA 1V25A 2HV8A 3MW8A 4JR1A 4BO8A 1PK7A 2O2YA 2Z57A 1EZZA 1RLOA 4P86A 4TXLA 3IT1A 4RANA 4X91A 5D85A 3ZX5A 4BNJA 4D46A 1RPJA 1DUIA 1JDVA 3I30X 4Z1MA 5GVRA 4BNWA 4HGZA 5E9QA 1AV6A 1QQTA 1KKUA 1SG6A 4QGFA 3X1WA 1PFGA 2CDRA 1Z6XA 2CF5A 3CFYA 4I55B 2CMDA 4LXTA 3WKAA 4PPGA 2H2DA 4U7HA 4E7PA 2B4KA 1A9TA 3E0XA 3BTUA 5AVUA 5KKCA 4M1WA 1GZ5A 4CMAA 4R9RA 5CG2A 1S3IA 3I52A 4RHEA 2EIXA 2WP0A 2ZJAA 2JAHA 2JS7A 4K8RB 4R9VA 1Z4NA 3Q3HA 4LZWA 4MQBA 4QBHA 2JIRA 4YQYA 3T5TA 3SWWA 4LDNA 4GI1A 4E51A 3T99A 1G60A 4OBBA 1E3WB 3MQ4A 1P0CA 3E9MA 1E8MA 2ZJ5A 4RD1A 3ZNNA 1OLXA 2JL1A 3ZTWA 3KC2A 4M0DA 1SZJG 3HWX1 3AFHA 5E38A 3IP5A 1JU3A 1TZCA 4LRYA 2ASVA 1P61B 2DM6A 3C2QA 4GI5A 1T4CB 4GZ3A 4M89A 3UJPA 3CPHA 3P9RA 5FWYB 2EOAA 2E4VA 3LXUX 4FGZA 4KI0A 2NSJA 3LPDA 4QGHA 1DFHA 4S1OA 4EYSA 1PFVA 1NXSA 2G8NA 4CL3A 2ZUBA 2VK2A 2VRBA 2ZYWX 3E22A 3TECE 5IXYA 2FSSA 3AVWA 2IZ6A 3MQ2A 1FS4A 1U9JA 1YBFA 2VR1A 4MVJF 4FE3A 4YNBA 4EMUA 4NXNB 1L5HB 1YJAA 1CVLA 1I14A 4OIFA 5K8IA 1DPGA 1I80A 4ZD6A 2E1RA 3QP9A 2H92A 5ALOA 1GWNA 4NX2A 3JAKA 3TR6A 5U1PA 4F21A 1GPWB 1PLLA 2PRZA 4CCSA 2BFDA 4NK4A 1IXZA 4BC1A 4H3HB 1ISIA 1KMIY 3D31A 3X3HA 1LDMA 3B70A 3OM8A 5IEJA 2C2XA 4A8JB 5JG7A 4BUZA 3F1LA 2W2LD 2PCLA 3O4HA 3OM1A 4IUBS 3RFUA 4MKXA 1BW9A 3E9NA 2VBIA 1SWVA 2KX7A 2LCFA 5CIYA 4RS4A 1R6BX 1AT1A 3SEZA 1GPYA 2J32A 4JBNA 4MEJA 3SHFA 4A7PA 3B1FA 3AIOA 1G21E 2GCOA 4JLPA 4QQRA 1TIKA 3EODA 4OGFA 3EQ8A 3X44A 2FLKA 2XMZA 3IEXA 3T54A 5K8JB 3MK31 3L0BA 1WHTB 2HJSA 3U4MA 1A96A 1PEYA 2GYVA 3Q9LA 4PC1A 2ZE8A 5JO9A 1SCBA 3QKWA 4QIHA 3GRPA 4HTFB 4TXMA 4C87A 1ONSA 1H0SA 3CTPA 3D0QA 2QRZA 1R37A 3HKEA 3QEJA 4LGMA 5IM4A 2J3DA 1UMKA 3FGOA 1T4BA 2B4RO 5I01A 5F21A 2XLBA 1SAYA 2Z8YA 3F7NA 3OQ6A 3V3KA 2IU3A 1B6RA 4UMFA 5B1DA 5CDTA 4CIBA 4NYJR 1QR6A 2ZIVB 1XYVA 1XHEA 2GCNA 2BCGY 3GIDA 3B2EA 4JB8A 1YSCA 3F4KA 1HEYA 3EAQA 4B43A 1BE6A 4IIHA 3W7AA 2Y1XA 4H1TA 3ZOKA 2AXPA 3L9XA 4S2EA 2P9TA 1YFZA 1H3FA 3TLGB 1XEWY 2QE6A 4FEAA 3HEMA 2YY5A 4XX1A 1LW6E 2XQGA 2Q99A 2ERXA 2FVYA 3KHTA 4LHYA 4BYMA 3PE6A 4PONA 1DGQA 5J2UB 2C84A 1MXHA 2A0WA 1LFAA 1FDIA 5ESDA 1NAHA 4DUGA 1ZSNA 2H2HA 3FETA 2IQIA 1GITA 3ZS8A 5D3MA 4IHAA 1O7JA 1DINA 4RK1A 4C0XA 1M2WA 4XFJA 1DZIA 3K0CA 3ZW9A 4OFBA 2BM8A 3EQ7A 2XDQB 3T94A 1N1GA 4OXKA 1IRXA 4YRQA 3JXEA 1NA5A 1GPH1 4DIBA 1GY8A 4FWIB 4IGKA 3VKWA 3SJBA 3R9KA 1U2DC 2IS6A 1R0KA 3ROFA 3TLXA 5FA8A 3AMVA 4CHGA 1PT7A 4NICA 3E7DA 3AR3A 4N5HX 1KZ1A 2YMMA 2HMSA 3T4XA 1WS6A 3UMMA 4WQMA 1HC7A 1KEZA 2GPYA 2WEKA 2A3RA 5MHTA 4LYFA 4AF8A 3KKPA 2JFBA 2JJYA 1QB8A 1O03A 2BKLA 1E6WA 1V1JA 2JPDA 3PD1A 5CLGA 4B71A 3EIXA 3DOUA 1K63A 3DV0B 3FE2A 3IAXA 2PEYA 2WU3A 2GA9A 2H48A 3H75A 4IIJA 5EXXA 3RC1A 4M0LA 2C2GA 3T5GA 2CXQA 4EEXA 3RS8A 4ADSG 1IBLB 1FL9A 2FK8A 3W5DA 1F2UA 4HY3A 1KEEA 4GDFA 2QTAA 4LKOA 4WN9A 4D9IA 4AUNA 1RXUA 2QUJA 3F5SA 1KE2A 4E7OA 1UIMA 3LFUA 1TUGA 3G2OA 3UENA 1GV1A 3VNSA 1TB4A 5JR3A 4MP6A 4TMFA 5M3BA 2OZEA 4F1WA 2V7EA 4JL8A 4KQJA 3BYZA 3H9CA 3CZMA 1X8KA 4OPMA 3SEAA 3U49A 3ZGNA 1TCVA 3L4JA 3U13A 1FQKA 1HETA 3QA3E 2XUKA 4IYJA 1XMPA 4FCTA 5AJWA 1E2GA 4GC9A 1KDTA 3OFSA 1JQDA 2Y1EA 4RKEA 3QLVC 4G24A 1ACJA 4R2LA 4G97A 3F0TA 1QVZA 4CFYA 4YH1A 1DBPA 3D4PA 3GB9A 5DMHA 4IR7A 1I5OA 4P84A 4CM8B 1DAMA 1L8XA 2J59A 5DVZA 1BMFA 1XLUA 5JAQA 4PX5A 2C98A 2FY8A 3UCFA 2PKRA 4NS4A 3CBGA 3FXAA 1VL6A 2OECA 4YECA 4PYLA 1VHLA 1OWPA 5SYAA 2P5UA 3UGQA 3UYKA 4FHDA 3V4LA 3HO1A 1JS1X 4RH3A 1KHHA 2X76A 4GR9A 3AG6A 3I1JA 3ROTA 3L1UA 1I01A 2CNNA 1Y1TA 4BE4A 2JANA 2RGRA 4WXYB 3FOCA 4QU8A 1JJFA 1ATZA 4J7XA 3DNMA 5TMPA 3SSMA 1VE5A 1P33A 2HI0A 4LBYA