4FC7A

Studies on dcr shed new light on peroxisomal beta-oxidation: crystal structure of the ternary complex of pdcr
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
274
structure length
274
Chain Sequence
PPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASRSLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLCPAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGSAKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLGNKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Studies of human 2,4-dienoyl CoA reductase shed new light on peroxisomal beta-oxidation of unsaturated fatty acids
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Peroxisomal 2,4-dienoyl-CoA reductase
total genus 105
structure length 274
sequence length 274
chains with identical sequence B, C, D
ec nomenclature ec 1.3.1.34: 2,4-dienoyl-CoA reductase (NADPH).
pdb deposition date 2012-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fc7A00
4RQUA 1GFSA 3I6QA 3K92A 4PN3A 1MB4A 3ITKA 3QQPA 3WQRA 2O7QA 4IM7A 4J1TA 1TB4A 2GD1O 5KJEA 1ZJZA 4BGUA 5AXCA 1BSVA 4M87A 2DT5A 1Y8QA 1Z7BA 3KM0A 5B4TA 3HQ4O 3FWNA 2R00A 3BA1A 4ND5A 3ABIA 1DPGA 5G4LA 4FSHA 5IDQA 1SEVA 3K2BA 2Y66A 3INGA 4HFRA 3RU7A 4TSKA 4CV0A 5IZCC 1F8GA 1V35A 1GUFA 2GN8A 3O4RA 3AY7A 1YL7A 1JVSA 1N1GA 3D0OA 3DZFA 3G79A 2CDAA 3KHUA 1LSSA 1AHHA 2C2YA 2H1SA 1QG6A 2OFPA 1MFPA 3INRA 3PFWO 1R66A 3EY4A 5A04A 4CM9A 1ISHA 4C7KA 1JWBB 4LMPA 5T6BA 3TFOA 3NTRA 1EUDA 3JQ6A 1IULA 3TOXA 1BMDA 4IDDA 4BNGA 4FCCA 2J5QA 4LVUA 4OM8A 2O4CA 4NDNE 4BKUA 1PZEA 4R01A 3GGOA 9LDTA 4WNCA 2CVOA 4Q3BA 1OZAA 1Z73A 3I9KA 3CZMA 4OOFA 5JO9A 4KMSA 5IJZA 1YBAA 3EC7A 3BAZA 4WECA 2AE1A 2YV3A 1GDHA 2BFOA 4NFSA 4O0LA 3PQFA 1OI7A 1YDWA 4GLOA 5DCYA 4GSKA 1O9BA 1LC3A 1VJ0A 4N5LA 4XZ3A 4ZU3A 3VVCA 2YV2A 3H2SA 5FWNA 4CM4A 3K2EA 3RC1A 3UW3A 3WWZA 4KDFA 3E6AA 3QVOA 3ZV3A 5JAMA 2Y1OA 4PRLA 1WLYA 2FRDA 1E6EA 4U0JA 4R3NA 2JHGA 1DHRA 4F45A 1M6HA 5A06A 4J0EA 3DBLB 1L7DA 4ZA2A 4ALLA 4I9HA 5JCJA 5CEFA 2DLDA 1PGOA 1PS8A 3KYCB 4WNIA 1DIRA 1JVBA 2IODA 4IPTA 1P1IA 1QYWA 2NVUB 3ZV6A 1NASA 1ZKMA 2P68A 2JFGA 1LNQA 1X7GA 2G17A 2Y0DA 1KETA 2UAGA 4OJNA 1U3WA 3LQFA 3P5SA 4OIMA 5DF1A 5ITWA 5GZ6A 5IDWA 4GKBA 4XKJA 3ZNPA 1FDWA 4IDAA 3H5NA 4YAJA 1E3JA 1G0NA 1P44A 2FP4A 3EZYA 1SB9A 1HRDA 3H9UA 2Q99A 3P2OA 3HDYA 4KWIA 3PHLA 4TRRA 4HNHA 1JLLA 2FMUA 2J8ZA 2Y1FA 3E5MA 3HJAA 4M89A 4ONEA 4CQMA 4B4WA 2R6JA 2RCYA 3GNTA 5HA5A 4QEDA 4CLRA 3L9WA 1PS0A 1U4OA 5ADHA 1EK6A 2HK7A 1PJSA 4HFJA 4LRTB 3MWEB 4P4GA 1B7GO 3QWHA 4X54A 4J4HA 3WX0A 1NFFA 1YVEI 3W4IA 1X0XA 2IYOA 2DUUA 3ZWXA 5DULA 3PYLA 3S2IA 1Y5MA 1BXGB 2DM6A 1LDYA 5G0WA 4PLZA 3W4KA 4R3WA 3S55A 5MGBA 2D4AA 5DBGA 2B5WA 4YJHA 2I99A 2Y93A 4CV3A 5KCZA 4OMUA 2NVBA 4G2NA 4GKVA 1HSOA 2GZ2A 3PHHA 1A4UA 3MJSA 4GMFA 4R1NA 3WWYA 2P5YA 2ZQZA 1QYCA 1JQBA 3GNQA 1UDBA 2YDXA 1UZNA 3BHJA 2EGHA 3FPCA 3ZWVA 4UVDA 4YJDA 5TQVA 3ZWWA 2E4AA 4BV9A 4AJ1A 2H5LA 3DBHB 4UEOA 3L6EA 1GUZA 1PJQA 2Y1DA 1Q0QA 3RUEA 4J7CA 3KZVA 4U6QA 4FFNA 4DQXA 1HF3A 5TIIA 1IPFA 2X9GA 3JYOA 1B14A 2OBYA 5CDUA 3GT0A 1X7HA 2Y1EA 1UR5A 3CTMA 4Z0TA 1KIFA 2Q4EA 5JAZA 4XX0A 3VPXA 5COQA 3LLSA 1UUFA 3WSWA 2YHUA 5A5FA 2O4UX 2X0NA 3I6IA 1ONOA 5JAQA 4FOOA 3LF2A 3PK0A 5HTOA 4NU6A 1G0OA 5JS6A 5JPIA 3GF4A 4CUJA 5I7EA 1PWXA 4JLWA 5AXDA 2GUGA 1OMOA 3R3SA 4UUPA 4Z3DA 4YDRA 1B3BA 5L4SA 1C1DA 4HV4A 4ALNA 4I5GA 3V1TC 4ALJA 4CLEA 1H93A 4U0KA 4ZJUA 2EWMA 4J7UA 2PZJA 4HP8A 4OYRA 4RF4A 3TZQA 4FFPA 4J9VA 5L51A 4AJOA 3IMFA 4DPKA 3RC9A 1NHGA 3O8QA 2DQ4A 4L8VA 4MKRA 2PKQP 2PZLA 4P4NA 3V2UA 3LK7A 4G65A 4MIEA 3VPGA 5BSEA 1K2WA 2AXQA 1U28A 3GPIA 4DGSA 1YL6A 1H6DA 1E7QA 3NUGA 4YAIA 1DAPA 3DR3A 4WASA 3FSRA 3JQFC 5KNLA 1K6JA 2JAPA 3DDNA 1GPDG 1GD1O 1F8FA 1TXGA 3LC2O 4O5OA 3ZDFA 3WB9A 2ET6A 3EVTA 3IL2A 4FPXA 4WCDA 4EZBA 1Z7EA 1DRVA 3IUPA 3ASUA 1Y7TA 3WS7A 3ZU4A 2WSBA 1IHYA 3WR5A 3AWDA 3UCXA 1Z82A 3GEGA 3JQBC 4CL8A 3JYNA 4IBOA 5BSFA 4ND1A 1IY8A 4PLYA 1D4FA 4ZN6A 2G0TA 1HZJA 1L1FA 2IEDA 2ZTMA 2Y05A 1B3RA 2C59A 1I5RA 3QWAA 4YYZA 2VQ3A 3FPLA 4BNWA 3D4OA 3RROA 2VCYA 3B70A 1GU7A 3DBRB 2Z1MA 4QT0A 3DQPA 5JE8A 3AU9A 1NQAO 3ULKA 3R6DA 4DVJA 5K9ZA 1QLHA 1DXYA 2JL1A 3H6KA 4K6FA 2I6TA 3GMSA 2OMEA 1N9GA 2D1YA 4PZEA 4XJSA 4UREA 4FQ8A 3IQDB 3LZ6A 2QQ5A 1ZK0A 4QX6A 3JD3A 2C20A 3PWKA 1ISMA 5CFZA 1ZH8A 4N5MA 1BXZA 1GCUA 4CM4B 1HDCA 2DPGA 1PZFA 3QW2A 3GR6A 1DLIA 1HYGA 3C8MA 3T4EA 1MXFA 2D59A 4U5QA 1NP3A 1EDZA 1EEHA 2NACA 1WMBA 4UEJA 2XF8A 3TWOA 1I3KA 3KSDO 3F3SA 3JD1A 2AG8A 5C7OO 4XQEA 3LF1A 2OGUA 1X1TA 2NVUA 3CXRA 4BVAA 4H15A 4YEDA 1O89A 2V65A 5AOVA 3AI1A 3FNGA 2PKQO 4UEKA 5DCWA 3GGGA 1GYQA 1NQOA 3FD8A 5IN5A 3MTJA 1N5DA 1H6BA 3B6ZA 4F6LA 4FJ0A 1F0YA 1ZFNA 3NGXA 3W8EA 4ZQHA 2GLXA 4IQ8A 4P4LA 3PGJA 3S8MA 1HL3A 1T1RA 4W99A 3AJRA 2NADA 3GHYA 4XYLA 5CAEA 2VTDA 3E9MA 3OBBA 1SC6A 3VH4A 1R0KA 3N58A 4TROA 1A71A 4B79A 1C0PA 2FPPA 2PZMA 2Q2VA 2Q49A 3DFZA 5JFOA 3TZCA 1M6WA 1FDUA 3GN1A 3TZKA 1KYQA 2OXIA 1HT0A 1N9GB 2HMVA 1RPNA 3KEOA 3WGZA 2I76A 1E1NA 1NNUA 3B20A 4Y6PA 4E5NA 2JD2A 2YQ4A 4I5EA 4CMAA 2GNAA 1E3IA 2YJZA 3OEWA 5EN4A 1BXGA 2WD8A 1A9ZA 4KTTE 4Q3EA 2OO5A 1U5CA 4BKQA 3UGKA 1IUKA 4QQRA 1KY4A 3DWFA 1EFLA 2HK9A 1PU2A 3IS3A 4RF3A 2IYPA 4L75A 1GV1A 2YHIB 2WE8A 1LRJA 3FNHA 4IJWA 1C0KA 3SLGA 3BZUA 1I30A 4BV8A 3MWDB 4AJEA 2ZYAA 1TEHA 1FMCA 1E7RA 3WLFA 2AA3A 4IIVA 4IDCA 3JYPA 4DQVA 4MPDA 5C7IO 4E2XA 5FYDA 1HLDA 2WYWA 3HDQA 3LT0A 3WTCA 1ENPA 1CRWG 1HSZA 3PIIA 2POQX 5I8ZA 4CLOA 2Q1WA 5F1PA 3V1YA 3UCEA 2Y1CA 3JQAB 1RM0A 1S6YA 3PEFA 4TVBA 3BMCA 5AQ1A 3UN1A 1XU7A 1EE9A 3FR8A 3OQ1A 1E3LA 4JP2A 5AVOA 2J5RA 3H3FA 1T2EA 3M1LA 3RSHA 5I7VA 1TLTA 3FN4A 2DTEA 1QRRA 2HCTA 3JV7A 3U4CA 5G4KB 2V7PA 2A9FA 3WICA 2O2YA 2GDZA 1HEUA 3TNLA 1HXHA 3K6JA 3ZWNA 3RUFA 1EQ2A 1B15A 1BDMA 4KQXA 4UVEA 4ZGWA 1PZGA 1I24A 5EL0A 1ULUA 4DIOA 3WIEA 3RUIA 5JMPA 3GOHA 3F4LA 5JDCC 4GGOA 4YAKA 4R69A 4BNTA 4L76A 1DC5A 1HZZA 2DBVO 4HXYA 3VTFA 1ENOA 5ICSA 3WBFA 4JBIA 4NFYA 5H82A 2OBNA 3JSAA 4QO8A 2AMFA 1U7HA 5JCJD 1GAEO 4IZIA 4XGIA 3DZBA 3BMNA 1BVUA 3D64A 3QIVA 4BNMA 4IGEA 1QYVA 2FR1A 1CETA 4QFDA 3CMMA 4PG6A 4BQPA 4FIZA 1EVZA 4BNJA 4MVJE 9LDBA 3KETA 2CDCA 2FPGA 4EEZA 3DZIA 1HWYA 1C14A 4TRMA 5ES3A 5L95A 1G6KA 1EMDA 2CD9A 5TLSA 2GZ3A 3AUTA 3SJ7A 1MA0A 2X8LA 4NK4A 1P9LA 2PD6A 2CVQA 1ZSVA 1R4NA 4Y9DA 5CG2A 3BMCB 2HUNA 2Q1TA 3BYZA 1IOLA 3RUHA 3PWSA 2R2GA 3NAQA 4CLXA 4GLLA 3OMLA 4DA9A 3VZPA 1LX6A 5U4QA 3NT2A 4NG5A 2CZCA 5G4KA 1A9YA 3UOGA 2BFPA 4AL4A 3L77A 3KSZO 3CPSA 1DIAA 1ZNQO 4R54A 1C0IA 2RH8A 5DP1A 5A9RA 1NR7A 3ICCA 4LISA 1ENYA 4RDHA 4CM8B 3D4PA 3WGGA 2Z5LA 1WDMA 5A1TA 1ZXLA 1N2SA 4NBWA 5A05A 3ROMA 4E4YA 1NTOA 2B83A 2WD7A 2VTEA 4IY1A 3H9QA 1YH3A 2PNFA 3JQ9A 3NKLA 2Z95A 4A7PA 3NX4A 2OORA 3LT1A 4D0SA 2R00C 3NT5A 3FBTA 3OP4A 4FW8A 4DLLA 1G1AA 2AEFA 2B4RO 2NU7A 4NQZA 1JAYA 3OECA 5A3VA 5A4DA 5GZ3A 2GYYA 3RC7A 1Y5RA 3UVEA 5JXWA 2B4QA 3AOEC 4XQ9A 3TQHA 4NU5A 5CHEA 1UAYA 1K3TA 3KO8A 1F06A 3A14A 3QA9A 3RVDA 1AXGA 4BKOA 1YQXA 4DL9A 4PG8A 1YO6A 3DTTA 2NQTA 4WLOA 1UXHA 3T4XA 1O0SA 2I65A 5EERA 4CM7A 4UUMA 2RHCA 2QIOA 3I9LA 2GF2A 4B8WA 1H0KA 2C5AA 1LDEA 1VPDA 2EKLA 3VZRA 2JFHA 2O2SA 4E33A 1E77A 2GN9A 2PWZA 2ZB8A 3QE3A 3GDFA 2J3JA 4AJPA 2A94A 1R16A 3BTSA 1DC3A 3EW7A 3DAGA 6ADHA 3U09A 1JA9A 3BTOA 1V6AA 4Z3KA 4HKTA 1V0JA 2JAHA 3GEDA 4RPKA 4DYVA 1ID1A 1XEAA 1GV0A 4GWKA 3MJCA 2BI8A 1A7AA 2IXBA 1EQUA 3AUUA 3STHA 3GVHA 2B35A 3PXXA 5CPFA 4K6CA 3ZW8A 2G5CA 4MVJP 3GEMA 5THKA 3EK2A 5TT1A 2NQ8A 4IJUA 3RFXA 4NR0A 4BO4A 2IDZA 3TL3A 1H94A 4L4RA 4EUHA 5GY7A 3PIDA 3ZWOA 1HE4A 3HSKA 1N8KA 4IS2A 4J3FA 2PKRA 1MP0A 3Q9UA 4W7IA 1LC0A 2D0IA 3FWZA 1BXKA 1OC2A 3GA0A 4AJ2A 5B1YA 1PSDA 4ZQBA 7MDHA 4OQZA 4CM9D 1LQUA 1EFKA 5A02A 1GADO 2YFQA 4XR4A 2O23A 1B8PA 2FZEA 3D4NA 3PHJA 5FI5A 3V2HA 3M2TA 4RORA 2W2LD 3GMDA 3QLJA 1ZK4A 4A10A 1DC4A 1QKIA 2PD4A 2X4GA 3E48A 4FJ2A 3WYCA 4DLBA 1ZVMA 4L73A 4C7JA 3Q3CA 1PJCA 1MG5A 3C3XA 5FF9A 4YACA 2NU8A 4DMMA 3FR7A 2YY7A 1J6UA 2Y0CA 1D1TA 1YWGO 4HADA 4N18A 4XB2A 4E0BA 2DUWA 3WXBA 2O3TA 4PLFA 1LEHA 1BVRA 1ULSA 3JYQA 3PTZA 1U7TA 2AG5A 3ADPA 3RWBA 4RLSA 1KC1A 4OXYA 1SO8A 5IF3A 4IDEA 4WUVA 4AJHA 1A4IA 3C7CB 3ZWAA 2LDXA 4RVFA 1V3TA 1YE3A 3VPSA 3ANNA 4OSPA 5L7WA 1T2DA 3K8ZA 5JYEA 1QSGA 1UDAA 1GQYA 1ISGA 5I9LA 4RPGA 5KJ1A 3OA2A 3EAGA 1MFZA 1WW8A 4MKXA 3UHAA 4E5KA 3GAFA 4R41A 3G3EA 3F6YA 5K6AA 2RH4A 4WLEA 2Q3EA 3I4FA 4PLWA 4W9NC 1JDJA 2G76A 3ZHXA 5L4LA 2GN6A 3ENKA 1E7SA 1TI7A 5KIAA 2BD0A 2AQKA 4YT4A 1ADCA 4JCOA 1I33A 4RF5A 4B8ZA 4MKZA 1EVJA 2VWPA 1E1MA 5EMHA 3LC1O 3RJ9A 4BNKA 1SNYA 1X1EA 3QY9A 3VKUA 3H2ZA 4TWRA 3Q9NA 4CR7A 1P1HA 1L7EA 5U9CA 5F3RA 3IUSA 3JQ7B 3QJ5A 3VC7A 2ZJ1A 4L4XA 1R4NB 1KC3A 3WOHA 1NYTA 4PLPA 2VRCD 4WCFB 3PYMA 3W1VA 4DMLA 3L07A 2QYTA 2GR9A 1E3SA 4I1IA 1U8XX 1F17A 3OIGA 1LJ8A 1ORRA 3AY6A 4N54A 3RC2A 2OP1A 3IJRA 3DZKA 1SAYA 3BMOB 3DMTA 3W6UA 3OJLA 2HLPA 1UDCA 4PLVA 3PP8A 2V6FA 4BQRA 2X86A 4FB5A 4ND3A 5AXAA 1PR9A 2CSUA 1J5PA 4DRYA 1YJ8A 2PD3A 4RVSA 1U1IA 3HG7A 1VE9A 2AE2A 2HMSA 4HBGA 3ANLA 5G0VA 4BO2A 3UXYA 5C37A 1ONPA 2WD7B 4RPHA 3K5PA 5FFFA 3P7MA 4KUHA 3VH3A 2PA3A 1ZW1A 1PJ4A 3OICA 3IC5A 5DNAA 1Q2XA 3AM3A 1Y9AA 4PVDA 2BFMA 4GI2A 4YB8A 2RHRA 4HFMA 1DBVO 4BB5A 3SEFA 4XDZA 1XSEA 1U4SA 3MJVA 1Y8QB 3W8DA 4E5PA 5JMWA 5TJ9A 3LLVA 3WJAA 4R9SA 4YR9A 1KEPA 3RIHA 5DN9A 1CEQA 3TFQA 4MP6A 3ROPA 4PIVA 3HE3A 4E32A 2Q46A 3U0BA 3JQAD 3EMKA 4LGVA 2IXAA 3RFTA 1XR3A 2UVDA 4WEQA 1AHIA 2UYYA 2Q2QA 5K6AC 1RYEA 3GUYA 2P4HX 3JQ7A 3JQ9C 3OJOA 4RPLA 5JBIA 4OO3A 3AU8A 2B0JA 4AJJA 1U5AA 2EHDA 1PJTA 2VZ0A 3NJ8A 1P1KA 3CKYA 3GDOA 3LDHA 2WJPA 3JQFA 1WDKA 4R1TA 1ZEJA 3HWRA 3CUKA 3BIOA 1PEDA 2VOJA 5HWSA 3EVNA 3SXPA 3H9EO 2VYVA 4A27A 1NAHA 5A3JA 3H5AA 1HDRA 3KLPX 1AUPA 2PFGA 3I23A 3M1AA 3NTQA 1HDYA 1KVUA 4H16A 5DDIP 1BG6A 3K73O 1BDBA 4CM6A 5JAIA 1MLDA 3ZWCA 4XRGA 4YQYA 1GTMA 4KUGA 3GH3A 3PPIA 2D8AA 2VNSA 2B4TO 4BMNA 2Y68A 2NUAA 1E1KA 1VJ1A 4BNHA 3KB6A 4YA6A 1R4MA 3F47A 3IKTA 4NZ9A 4AJLA 3RBXA 1YBVA 2X9NA 1PQUA 3V8BA 3HUDA 3H7AA 3IOYA 4R5MA 4DC1A 3C7AA 4G81A 4I8XA 1WAMA 2QHXA 3KEQA 4XYGA 5ICMA 1I0ZA 2EW8A 4LCEA 4R16A 5C7LO 4NJOA 3OA0A 1E3WA 3I5MA 5HBRA 5KJFA 1R15A 3Q1LA 4ZHSA 4BNUA 1P74A 1YRLA 2GERA 3RJ5A 3K9QO 4GX1A 5BSGA 1BRMA 2F00A 4ID9A 3D3EA 2NLOA 3WQSB 2VUUA 5DCUA 4A26A 2P9CA 1AN9A 4TKLA 3BHMA 3HDJA 2V6MA 1V3UA 3TOZA 5L9AA 4MVJG 5L3ZA 1CQJA 4UVHA 4RL6A 3O03A 4JP3A 3RKRA 3UICA 1DIHA 2HRBA 1XELA 4D79A 3EDMA 4KUEA 1Y8RA 1D7OA 4CLHA 4CM3A 2X0RA 1NWCA 1D1SA 1EVYA 1YB1A 1Q0LA 2HO5A 1NPDA 1E7YA 2EKPA 4CMBA 4ND2A 2X23A 5EPOA 4G5HA 1UH5A 2AQIA 2NWQA 4JROA 4OGWA 4J4TA 1LDMA 1DIGA 4IGFA 4CLRB 4YRAA 3TPCA 4M55A 4YWJA 3CEAA 1UP4A 3D1LA 1EUCA 1LSJA 2CDBA 1N7HA 2PY6A 3E9QA 4BO1A 1W0CA 2VYNA 2QRLA 5T64A 2EV9A 3RU9A 1DRUA 4Y6SA 4EITA 2O3RA 2EP7A 1H6AA 1NX6A 4I9UA 3E18A 3U9LA 5ILOA 1H2HA 3WMXA 3ZU5A 1GQQA 4GX5A 1U3VA 4D41A 1UP7A 4MVJA 4YJFA 4HWKA 3NDRA 1KEVA 1K6IA 4RZHA 1NQTA 3QP9A 1PQWA 5TS3A 2FPIA 3G49A 3DBHA 3ZW9A 2XPCA 1DB3A 4LCJA 1LUAA 5L40A 3D5QA 4DUPA 2P9GA 1LRKA 3F4BA 4GX0A 5BNFA 4WLVA 4JQCA 1PZHA 1YOVA 2AEJA 4RF2A 3COSA 5C3MA 3NTOA 2ILTA 4J43A 1X14A 2VWGA 1E7MA 2I9PA 2OP0A 1T4BA 4JIGA 2XXJA 4H3VA 3NDIA 4CM1A 4J0FA 4B4VA 2NTVA 5CEEA 4W9NA 1F14A 2WYVA 4FC6A 4J16A 1W6UA 4ALKA 1HETA 2PZKA 1QV6A 3WTBA 4A0SA 1EBUA 4R5HA 2QRJA 1GZ3A 4OL9A 2D3TA 1YBMA 1KVQA 2EP5A 2E48A 3ANMA 4YPOA 1E7WA 1F12A 4PG4A 4CR8A 5TF4A 3K30A 3ON5A 3VH1A 2XXBA 1I3NA 4N7RA 3TN7A 1KERA 3IAHA 2BELA 4YTEA 1ADGA 4INAA 5A9TA 1C1DB 3I9MA 3WLEA 1NHWA 3F1LA 4PLCA 5CDGA 1PTJA 3PI7A 1PR3A 4DIBA 3PZRA 2GGSA 4TVOA 4GSLA 3DZGA 4CR6A 2VOEA 4NI5A 3RAJA 4ZRNA 1VC2A 3E82A 1V3VA 1QP8A 1VL8A 1O95A 3PJDA 2W90A 1JKFA 4BNFA 5IFLA 1SMKA 4B4OA 1T25A 1ENZA 1EZ4A 3SX2A 2PTGA 3UH1A 3JQ8B 5LDHA 3KTDA 3JQDA 4DLAA 5JY1A 3H8VA 4W4TA 4DBVO 1B8UA 1Y9EA 2BRUA 2GO1A 1YONA 3RCBA 4FGWA 1PL6A 2D2IA 3M2PA 1YOVB 1U8FO 4URFA 1XIVA 2HDHA 7ADHA 4R1UA 2PV7A 2PLAA 3L6DA 4I5DA 1E1LA 1U3UA 1A7KA 2IZZA 4XGNA 2ZCVA 1UZLA 4CLDA 2NU6A 3A06A 2J6IA 4O63O 4MVJH 4XD2A 3GZ4A 5A9SB 5JSFA 3VDQA 1VJTA 3HFSA 1NVMB 2YYYA 2ZYDA 3WGHA 5L45A 1BTOA 4CMIA 3LSYA 3WNQA 5C5IA 2Y1GA 5F5NA 2HMUA 4HY3A 4M49A 1HE3A 3DC2A 1T2CA 4MJLA 3KXDA 2I5PO 4CQLA 3T7EA 5KJ6A 4R68A 2GZ1A 1UXIA 2J3HA 2ZTVA 2JCXA 3H4VA 1BW9B 1Q0HA 4IDBA 4BNNA 4TZKA 4E12A 5KVQA 3TDKA 3V1UA 1I01A 3GVPA 1PGPA 4Y8VA 2O3UA 2HKIA 5FI3A 4ILKA 2XOXA 3QRWA 5CPBA 3MEQA 4A2CA 4ZD6A 2QYSA 3HDHA 3SC6A 3WIDA 5JNLA 1E3EA 1KOLA 4IJVA 1AXEA 3PQEA 1R12A 3GLQA 4CM5A 4XEHA 3D3WA 4RZIA 1J0XO 2AW5A 3S2FA 2VT3A 3DOJA 5BR7A 2EXXA 3BTVA 3TSCA 1R0SA 4I5FA 1PJLA 4GVLA 2BLLA 4RCVA 1BWSA 3OFSA 4YT8A 1Z6ZA 2BI7A 2D5CA 2AHRA 1PGNA 1R37A 4ROSA 1P77A 2Q1SA 4CMEC 4TZTA 3OHSX 4BGIA 4RQTA 3PWZA 2PGDA 4ESOA 3G17A 5JC8A 4NBTA 1I32A 4U8GA 2J5KA 3I3OA 3H9JA 1YXMA 4O59O 3LT2A 5HM8A 1ZMTA 3ZV5A 2GASA 2WDZA 4OXNA 2QZZA 3HN7A 1MC4A 5IXYA 5I8WA 2C29D 5I9NA 1PL8A 4CMIB 1QORA 4DC0A 5L53A 5T8KC 3DBVO 5CDSA 2YZ7A 3WFJA 1YS4A 5KWEA 4Z9XA 3I1JA 4WLFA 1ISFA 5G0SA 4GMGA 1BW9A 3AM5A 1C1XB 2C7GA 4PFJA 4WPGA 4D44A 3WMWA 2UUOA 4I08A 2QX7A 4BNIA 1A5ZA 4BB6A 4FFRA 3VH2A 2PH5A 1ZK3A 5IG2A 1VKNA 4CMJA 1PGQA 1GUYA 1UJMA 2YHIA 3NV9A 1NBOA 1SOVA 4JBGA 3JQCA 2BGLA 1W4ZA 1X13A 1CDOA 4MO2A 2FZWA 2VUTA 4U6SA 1LXCA 2BMAA 1KVRA 4IDGA 1EUZA 4DPLA 3GK3A 5DOVA 2W8ZA 5KTKA 2FR8A 5F1KA 1M66A 2GCGA 3RI3A 2B69A 4CMGA 4ND4A 3GDGA 1I36A 3G1UA 2AQ8A 4UVGA 1JN0A 1DJNA 4PZCA 3E1KA 4Q39A 2DFDA 4MVJM 3VVBA 3VPFA 4B4UA 5BNTA 1P3DA 2VRBA 4EJMA 2BHLA 3RKUA 2LDBA 2J3IA 2X5OA 3C7DB 4E5MA 2NSDA 3NEPX 2X5KO 1E6WA 3RUDA 1BHSA 1R0LA 2GPTA 4YT2A 3DBRA 2FSVA 5COAA 3HFGA 1UXJA 2NTNA 4KDEA 4CQMB 5L7YA 1R6DA 2FN7A 1Z74A 5GMOA 1YDEA 1OBFO 2YW9A 3C24A 3QWBA 4J2OA 4JGBA 1ZSNA 3SJUA 2ZCUA 5EQDA 3ENNA 4MIOA 3L0DA 2C0CA 2B37A 3AFNA 3K31A 1YB4A 4FBGA 1XCBA 2BF7A 3HN2A 2DAPA 2JD1A 4QFCA 4WE3A 3ZZNA 4R1SA 3JQGA 3MJ4A 1WZIA 3IKVA 5LDGA 1TA4A 1T26A 3NT4A 3WFIA 1Q1NA 3PHGA 3PYXA 2DBRA 4Q3CA 3RASA 3Q2KA 2FWMX 3BXXA 1HYHA 3CMCO 3E5RA 1ZCJA 4PRKA 3O26A 4A73A 1VSUA 1LSUA 1W8DA 3H9GA 5I7FA 2IZ1A 3OH8A 2C5EA 3JQ8A 4QSMA 3JQEA 4J49A 4JJFA 4XB1A 3OJEA 1DFIA 5J23A 4W82A 1IZ0A 2EG9A 1GPJA 1XA0A 3U4HA 2W4QA 3ITDA 3PDJA 4RVHA 1XYGA 4BL5A 1AE1A 5CDTA 5LC1A 1IHXA 3HNPA 1X7DA 1SOWA 3WNVA 5HRUA 4WJZA 1FDSA 2X22A 3OIFA 3PJFA 5IN4A 4W6ZA 2W98A 1ISJA 4EBFA 3AUAA 3CE6A 4UVIA 4OQYA 1E92A 4FOSA 2JHFA 4B3JA 2EGGA 1YQDA 4IMPA 3L4SO 1YJQA 1I2CA 2VWQA 1EBFA 1VLLA 3MCVA 4IZHA 2Q50A 1LDBA 3TRIA 1X0VA 1EVIA 3GC6A 5BQFA 4RVUA 3AM4A 1NXQA 3O38A 4Q9NA 4CQMD 1Q7CA 4CV1A 5TT0A 4NBUA 1JW9B 4BNVA 4XIYA 8ADHA 2WMDA 1Y81A 3MZ0A 1K89A 4CM8A 1ONNA 4GQAA 2ZK7A 4E21A 2EEZA 4MP8A 2I66A 4XGKA 1K6XA 5KOIA 3AY3A 2IZ0A 2RBEA 4RGBA 1P33A 3WGTA 3IJPA 4RV9A 2X6TA 5DBIA 4KP7A 3A1NA 2VNAA 3DAFA 5CEJA 4UUNA 4I9NA 5TSDA 3I9JA 1RM3A 2A92A 4AJ4A 3G0OA 1EE2A 5GZ1A 3EHEA 3OIDA 3GVIA 1JAXA 3DXFA 5DZSA 1B26A 4QO7A 3DBLA 4U7WA 1GZ4A 3D3WB 4XYEA 3C1TA 3VKVA 4B3IA 1VI2A 4QECA 3DB2A 4DTIA 2ZYGA 4NK5A 4J9UE 1LLQA 1SBYA 3ETGA 5CG1A 2I3AA 5ER6A 3I9OA 4E2ZA 4Y6RA 4EDFA 4FC7A 1LLDA 2ZJ0A 2VZ9A 4FGSA 4LRSB 3HZZA 4NFHA 3QVSA 2X0JA 3GG9A 3ASVA 1E5LA 1JU9A 3KYDB 2JCYA 2W2KB 4DREA 1LLCA 4M54A 5KVSA 3ZNNA 2HMTA 2HAEA 4GGPA 1A27A 4KTVE 1KY5A 1LBEA 3WGYA 2Q4BA 1Q7BA 1KBZA 4E30A 4AG3A 3FNEA 2C2XA 1NAIA 5DOZA 3GFBA 4AFNA 3ZNQA 1QYDA 3CIFA 4BNLA 1QV7A 1LDNA 1NWHA 1GCOA 1ZO8A 4JJGA 4CPDA 4IDFA 4XYMA 1CIVA 1NM5A 3ZU3A 5KJCA 4F46A 2OOSA 1M2WA 4FN4A 1GQ2A 3GVXA 5IXSA 2BKAA 4LW8A 3LYLA 4DPMA 4MVJD 3ONEA 3GNSA 4ITUA 3OSUA 3NRCA 4J4BA 4BO3A 3TJRA 4YRBA 1C0LA 2O3JA 1RM4A 1KVTA 1HLPA 5F1OA 2OZPA 1N7GA 1XU9A 3W8FA 4AJNA 5KKAA 1WPQA 3KSUA 2HQ1A 4OOEA 5I7SA 4IINA 3DO5A 4D43A 1XLTA 3ONFA 3KV3O 4EEXA 1QR6A 2O48X 1GR0A 2UV8A 2JJYA 4QXMA 4YAGA 3GN2A 1DSSG 3HHPA 4M8SA 1DOHA 3Q6IA 1WXDA 2E37A 3DEYX 4MIYA 4WKGA 1FF9A 2ZKLA 3GZNB 2C82A 1GEGA 4EW6A 3AOGA 1LI4A 2WEKA 1V8BA 3GRKA 5JO0A 1I2ZA 1MXHA 3ICPA 2SCUA 1NVTA 2W2KA 2PR2A 3PFFA 2NTJA 4L74A 4NIMA 2E49A 1U2GA 3U5TA 2X9VA 2JD0A 3P19A 5JC1A 1V9LA 1PJ3A 2YFHA 2QG4A 3ZN2A 3LT4A 4AVYA 3H5RA 4YRDA 2HSDA 3F1KA 2HRZA 3MJEA 1ZBQA 3ETEA 4XRRA 4Z9FA 2VRCA 3X2FA 2PGLA 1J4AA 4TRJA 4NBVA 3UFXA 2NV6A 2ZB4A 2DU8A 2NM0A 3GRPA 2TMGA 3UAGA 3VZQA 5JDIA 1C3VA 2OL4A 3JCZA 1HYEA 4WLNA 1RYDA 3E8XA 3JQGB 4L4SA 3GVCA 3VTZA 5IZCA 2UDPA 4YQZA 3O8QB 5EJ2A 3WGQA 1NQ5A 2OUIA 4RVGA 1FJHA 5IAAA 4K1LA 3WJ7A 1HDXA 1JKJA 1VKOA 1PGJA 5T57A 2WE7A 4BO9A 3GG2A 2P2SA 4EI2A 1HDZA 5CDYA 4IS3A 4UUOA 4FR5A 2EIHA 1P0CA 2P91A 4GBJA 1B16A 2H6EA 1MGOA 3KUXA 1DHTA 2HMWA 3WSVA 2E82A 3ROKA 2ZB3A 2Q45A 1HDGO 3S1LA 4NJMB 5T5QA 1PX0A 4E5YA 4E2WA 1B2LA 3CINA 4IXTA 4XA8A 4B3HA 3LVFO 4J91A 2ZTUA 1W73A 3BMQB 2BH9A 1LQTA 4HUJA 1DAOA 2J3KA 4A5OA 3GGPA 4CMCA 3UCFA 4EJ6A 4CLOB 3T7CA 4TRNA 1XHLA 3F5QA 4BOYA 4D0RA 1IB6A 2CNBA 3JQAA 4GAEA 3ZGYA 1H2BA 2V6GA 3DMTC 4DQUA 3ROQA 2WWRA 4BNYA 2VN8A 3FTNA 3NYWA 4GWGA 3WQQA 4M86A 4KZPA 2PK3A 4E2YA 5EINA 1UXGA 3U3XA 1MV8A 1LSOA 2PGJA 3KBOA 3GHHA 1ZMOA 5AYVA 1LA2A 3B1FA 4K26A 3VPHA 1E5QA 3GPDG 3CZRA 1EDOA 1WWKA 5ITVA 1OAAA 3ST7A 1GY8A 4BIIA 1ZUD1 4DWVA 2YDYA 1RWBA 1KVSA 5A03A 3ADOA 3I4CA 4GH5A 2P4QA 4D3FA 3LU1A 3WDSA 3I83A 5B4VA 4LSWA 1ZIDA 5F21A 1DFGA 2I3GA 3IIEA 3JD0A 2WM3A 5HS6A 1CQIA 3FF4A 2OHXA 4NPCA 3QWIA 1DIBA 3QWFA 3GFGA 2YUTA 2IEBA 3BMNB 4XYBA 5L7TA 2NU9A 5TNXA 4BS9A 2CVZA 3R1IA 4P38A 5JW6A 3VOSA 4B7CA 1D3AA 4WLUA 1QYXA 2AEMA 4JBHA 2DTDA 3OQ6A 3U4DA 2JCVA 2VHWA 1RM5A 4JK3A 4CJXA 4EGFA 4QUKA 1DLJA 3JD4A 3PLNA 3RUAA 3KYDA 3WBBA 3INTA 2D5AA 1MUUA 3OM9A 1T2AA 4NNJA 4BGEA 5F5LA 3QHAA 1NPYA 3DZHA 1QXSA 1YB5A 4PVCA 1LTHR 2DVMA 1SB8A 3DOOA 3PVZA 1KEUA 1E6UA 2UUPA 5B12A 4NBRA 4M1QA 4IJKA 3O9ZA 2A4KA 2XAAA 1OC4A 2DKNA 1IPEA 4KQWA 4K28A 4Z0HO 3RBZA 3S2GA 2DFVA 3BTUA 1NPTO 4D7AA 3A28A 3F5SA 3L9XA 4OKNA 3PZBA 4YJGA 5KVCA 5ILGA 3NGLA 1E0DA 3I9NA 1PJBA 4OH1A 4GL4A 2CY0A 3I52A 4JXKA 2CF5A 1M76A 4YXFA 2CF6A 1GZ6A 4KWHA 2TMDA 3KRTA 1XKQA 1I8TA 1YGYA 4LN1A 1O5IA 1LDGA 2EW2A 3FI9A 4EJ0A 3ORFA 4IMRA 4YBZA 1KS9A 4R4JA 1SPXA 2QRKA 4FJ1A 2ZQYA 5T8KA 3ZWMA 4LK3A 1PS9A 2Y67A 5DT9A 1S7CA 4EYEA 3FTPA 3VAZA 4Z6KA 4CODB 4GX2A 2VHZA 3DFUA 5JYDA 3D5TA 3EGOA 1I3MA 1WMAA 1VRWA 4S1VA 3PRJA 2NNLD 4ZQEA 4BKPA 4MP3A 3GZNA 3RUCA 4UULA 4JJIA 3CSDA 4TQGA 3S2EA 3QSGA 2IRWA 4BO6A 2DBQA 1D8AA 3ZH2A 4FFLA 3GY0A 1ZZEA 2VYND 3E03A 1MC5A 4J1SA 1K5HA 4RDIA 1DJQA 4CV2A 1ISIA 3PJGA 1FDTA 4RVDA 1P1FA 4AJIA 2HJRA 5IDYA 1ML3A 3FHLA 4LVCA 3U49A 1FK8A 1PL7A 5CP8A 3ZNOA 3BMOA 4MVJI 5G0UA 4H7PA 4PLHA 3B1KA 4YJGB 3ZWYA 5BT9A 1N92A 4BO8A 5TRTA 3U4IA 3OJFA 3L6OO 2FHSA 4J6FA 3MOIA 3NJ4A 3RBVA 2B5VA 4MDHA 4Y67A 1I2BA 5EIOA 5JDIC 2QW8A 3JYLA 2WYUA 4QTZA 1I10A 5IZ4A 1QLJA 1P0FA 2VWHA 2ZTLA 2VZ8A 4BUCA 3SVTA 3RFVA 4J2HA 3MJTA 1HE2A 2C07A 3EYWA 4PG7A 3TZHA 3ETDA 2CUKA 3OQBA 4E13A 4R51A 4WK6A 1NR1A 1N1EA 5TGDA 3F46A 2PH3A 3M6IA 3QVWA 3ONDA 4YJFB 4PLGA 1P45A 3EZLA 1LU9A 4CUKA 2A35A 2EJWA 1ADFA 1QMGA 4II3A 4NJMA 2DPHA 2W2LA 3IDSA 2X5JO 2X7HA 4MOWA 1RJWA 4IUYA 3TL2A 1DRWA 2ZIZA 3BMQA 2P9EA 3ZI0A 2F1KA 5THQA 1YL5A 2H9IA 4NH4A 4BHTA 3Q2IA 4L0QA 1PJ2A 3X2EA 4E6PA 2WTBA 4Q3DA 4XDYA 5MDHA 6LDHA 1VL0A 3AUSA 3PQDA 1ZK1A 4CMHA 1IL0A 1M75A 1GEEA 5H83A 3BHIA 1WDLA 3IP3A 4IXWA 3UKOA 4D46A 2P5UA 5IDXA 3FBGA 3FRJA 3G1TA 4P8RA 1DEHA 1K0UA 1VL6A 3AW9A 1H9AA 4RO0A 2C54A 4NHEA 3HB5X 2X0IA 1XG5A 2JFFA 1IE3A 5TX7A 2B36A 2Y0EA 5I9MA 4FFOA 1OOEA 4RPJA 2CFCA 3E9NA 3EUWA 1B8VA 3VDRA 4XQGA 1U3TA 3C1AA 3PGXA 4BMVA 5COBA 5LCXA 4CUZA 4DBZA 3DHEA 1R4MB 4Z9YA 5B4UA 5EQFA 4L9RA 2V6BA 1X15A 2FY8A 1CF2O 1SZJG 3R3JA 1PQPA 1NFRA 1XQ6A 4ALMA 4B7UA 3HB4X 3W6ZA 1GYPA 4WOKA 4JX8A 3R0IA 2CMDA 3AI3A 1Z75A 5A5EA 4OXKA 5ER9A 4BNXA 3C85A 3KOUA 4Z0PA 2O3SA 3DMYA 1TT5B 1T4DA 4C4OA 3KYBA 8LDHA 1FDVA 5K0ZA 1Q7GA 1UXKA 4YCAA 4O6VA 5H81A 2GRAA 4N5NA 1P1JA 3UUWA 1DFHA 3N7UA 3DTYA 4XWYA 4WOJA 4XIJA 1CWUA 4JN6B 2EKQA 5G0TA 4D45A 4FDAA 3ZHYA 4WCFA 1SEPA 3D7LA 4YAEA 3WGOA 5DBFA 2DC1A 4UAGA 2X58A 4CL3A 1VSVA 1VM6A 1Y8RB 5U1PA 1NVGA 1H6CA 1NFQA 5AXBA 3SLKA 4D3DA 4JNKA 3RQSA 2YQ5A 1U9JA 3V5NA 1JTVA 2FOIA 1XDWA 1CJCA 3HADA 1T2FA 3FCOA 4GPD1 3Q11A 4FD3A 5B37A 5KKCA 4IIUA 3MOGA 1MG0A 3SBOA 2VHVA 4TKMA 1XQ1A 1M67A 4TMFA 4RLHA 4YT5A 1IYZA 5ENVA 3PHIA 3ZWPA 3L4BC 4J90A 4W7HA 5ENDA 3TF5A 4CMKA 3WG9A 4A03A 1EK5A 4OKIA 3OEYA 1O6ZA 4FS3A 4BO0A 1HKUA 4MVJF 2AQHA 3F9IA 4IQGA 1WP4A 3V2GA 4RJTA 4OSOA 4DIFA 4K9DA 3KVOA 2DTXA 2YV1A 1JWAB 5TJHA 4MINA 1PIWA 1MX3A 3GUCA 1HTBA 1GYRA 3DL2A 1UP6A 3AK4A 1JKIA 2ZATA 3PJEA 4HFNA 1GL3A 1ZSYA 1HE5A 1TT5A 4WCFC 4ZRMA 4BO5A 1ADBA 3KYCA 3W4JA 1XWFA 3RD5A 4XJTA 2HK8A 3H65A 3WYBA 4GVXA 1DDOA 2ZB7A 3K96A 2VYVD 1SCUA 3QV1A 1ZJYA 4F3YA 3MTGA 1H9BA 2RIRA 2G1UA 4J1QA 3DZJA 4ALIA 4R9RA 4BKRA 5HS4A 1RKXA 1O8CA 2VHYA 3VZSA 1T24A 3JTMA 5G2OA 2QZ9A 5L4NA 2Y99A 1U2DA 1T1SA 3UF0A 1LRLA 1YKFA 3A4VA 2GN4A 3CH6A 3DOCA 3OF2A 4LMRA 3WYEA 1ZXBA 5BNIA 3LC7O 3ZV4A 5BSHA 2Q1UA 2X1HA 3KLMX 3NDJA 1AGNA 2Q2WA 4ZQGA 4ZVVA 4CMEA 3L4BA 2VHXA 2FR0A 3B1JA 4HX5A 4S3MA 2BGMA 1C1XA 1TT7A 3WGIA 1P31A 1J49A 4P22A 1CERA 4XR9A 4BMSA 3FNFA 2FSSA 3GAZA 4ZICA 1WZEA 1UZMA 5FEUA 1PWZA 2EF1A 4DXHA 4DYDA 4PGFA 4YJHB 4E31A 2EERA 3ZWBA 3OJ0A 4HNGA 4IQ0A 1WNTA 1I3LA 1O94A 3AI2A 4J7XA 5EESA 1B0AA 1IZ9A 4E3ZA 2HU2A 3Q0EA 4OHUA 4KOAA 4BO7A 4OAQA 3QVXA 2C7VA 2GSDA 4Q3AA 1E3WB 4D3SA 2O50A 4XCVA 1Y6JA 1DO8A 1UAGA 2RAFA 4WGGA 2EJVA 5TC4A 4FFMA 3SC4A 4F6CA 1Y1PA 4PG5A 4D42A 3IP1A 3DAPA 3DONA 5DP2A 5JY6A 3ZHZA 3TZ6A 3PDUA 5KVVA 5JCXA 2HJSA 4PCVA 1ZK2A 4B7XA 1XGKA 1Z45A 1TVEA 4XQCA 4NMHA 5JLAA 1HDOA 2H63A 4AICA 4J1NA 4O1MA 1YQGA 3PLRA 3OETA 3DHYA 1A72A 3AFMA 1P1RA 3AOEA 3N74A 3P2YA 4II2A 5A9SA 3ZCXA 4ZQFA 1LLUA 2Z1NA 2O7SA 1WVGA 2IE0A 4PZDA 4Y98A 3ZU2A 3H3JA 4YVFA 3JD2A 2O3QA 3JQBA 5T67A 1FXSA 2I67A 1KEWA 4PLTA 3GQVA 4CQLB 1CYDA 3QVTA 2JKVA 4LSMA 1DC6A 3U62A 4AJKA 3ZHBA 2BFAA 4EUFA 5JDCA 3VHRA 2VUSA 4EUEA 1OFGA 2E6UX 4BGVA 1H5QA 2G82A 2VT2A 3DHNA 4BNZA 3C1OA 2BGKA 4Q3NA 4WEOA 2NVWA 1ARZA 3A9WA 1ZEMA 2DBZA 1BGVA
chains in the Genus database with same CATH superfamily
1INLA 1ZGJA 2IDMA 2K4MA 3I6QA 1MB4A 1EFPA 1G8MA 3UMMA 4OMFG 2HH9A 3WQRA 2W8BB 3LKZA 1TB4A 2G9ZA 2GD1O 3PI6A 2XB4A 4K86A 5EIHA 5AXCA 4ZAWA 2DT5A 1E6MA 1Y8QA 3HJUA 3HBMA 4ND5A 2R00A 1DPGA 4BB0A 1SEVA 1ZVKA 1QAQA 2Y2VA 4IO1A 4HPXB 3BD9A 3MGGA 4QAQA 2C7RA 1ZOPA 3R7DA 4QJBA 3KXKA 3SZGA 2GN8A 2YS7A 1ZD5A 1N1GA 3D0OA 3PD1A 1JYSA 4QBIA 1YS7A 3KHUA 2EGUA 1MJGA 1Q0UA 1GKIA 1ZITA 3TO5A 4YY3B 2JK0A 3NBXX 5J59A 1Q92A 1NV9A 2ZREA 3UUGA 3PFWO 4KACA 3ESXA 1IG0A 1ZY2A 5A04A 4CM9A 2B7CA 2VHUA 4G01B 4LMPA 2O06A 4FW9A 4EQ6A 3NTRA 4J6EA 3VJRA 3T41A 1K8QA 3OZIA 1IULA 1CDEA 4GYKA 2ZYIA 3L6RA 1XQYA 3H5OA 1GQSA 1EG2A 2O4CA 4JDPA 3A6JA 4R01A 5DPMA 3T61A 3KQOA 3GGOA 3NM6B 4UCXA 3WHKA 2ZWAA 5IS2A 1FRQA 3CH4B 1MO4A 3GLKA 4WNCA 2O0LA 4G8JA 3WNZA 5LP6B 2HA7A 1FLVA 3I9KA 3VPDA 2ZAIA 2WTMA 1XZLA 1X1CA 1GXSA 2OZKA 5JO9A 3VNQA 4ARZA 4BFYA 2NZJA 1U1CA 3G8YA 4U2EA 2MSLA 1PV2A 3M5WA 4HDKA 4EKNB 4RZ2A 4NFSA 4JI6B 4O0LA 2QN6A 1VJCA 4KIWA 1YDWA 3KQKA 5DCYA 4GOMD 4JYAB 1LC3A 2AVNA 1R9MA 4DDKA 1RXCA 4EYGA 1R6UA 3MFYA 4QDUA 3VJLA 1UKAA 1JNXX 2JBAA 3H2SA 1H8ED 2AJ8A 2WNIA 3EN0A 3DAHA 4GC9A 3N0VA 2XV1A 4TV8A 4MR7A 3NHFA 1EFPB 4AZ0A 4WNAB 2NP7A 3QVOA 2X9LA 1M1NA 4PRLA 4U0JA 5HFAA 2Q6OA 4R3NA 2JHGA 1DHRA 4BPBA 3WMFA 4BZXA 5I5EA 3NO4A 2LRHA 5IU6A 4CEJA 1ZNXA 2CE7A 2C2WA 1WSDA 4JYMA 2BFNA 2KM1A 4RDXA 5JCJA 5CEFA 3KYCB 1CQPA 4D3YA 2P1RA 3I30X 4IPTA 1P1IA 3B5EA 1QYWA 2PNJA 4IXNA 5M04A 3PVCA 1OXUA 3PNOA 5HW0A 3CA8A 1LNQA 1G21B 2WM9B 4MJXA 3Q3JB 4LWZA 2Y0DA 3ENVA 1QJ4A 2UAGA 4Q9IA 3QNUA 1U3WA 1RHUA 4OIMA 5DF1A 3VX3A 1R6XA 1Q1QA 3C4QA 3FF1A 4G0OA 3VR4H 3FJYA 3ZNPA 1JDPA 4DLKA 5IDWA 5JRJA 1Q20A 2XD9A 4JGGA 3H5NA 2FYTA 4LNAA 1E3JA 1QHGA 2GBGA 2Z2YA 1X7YB 3B1ZA 1JYFA 2F3TA 2VJKA 2J6HA 3EIXA 1D4ZA 3EZYA 3L02A 4L0MA 4L5YA 4NYIR 4E7PA 3TLXA 1XRRA 2Q99A 2PMDA 3LBYA 1P7WA 1Y9ZA 5J40A 2EX0A 2EKZA 3PHLA 5CW2A 5BW6B 1JLLA 2J8ZA 1OT3A 2BM0A 1RP7A 4WOCA 3GEBA 3SYLA 1LBHA 3J81A 3WRYA 1W2HA 3DUFA 4QEDA 5M7EA 4CLRA 1PS0A 4IHKA 2LE0A 1U4OA 1EK6A 2HK7A 4MUBA 4PX3A 1QNFA 5JS1A 3F3MA 3KKEA 2QL9A 1F2TB 3MWEB 3QWHA 3EXHC 5GM2A 4B6PA 3CQ9A 1AK2A 4RHEA 4INJA 1GFIA 4TSRA 4I14A 4P4TA 3URKA 1KXZA 1XMVA 1QIEA 2XHZA 4IFEA 1BXGB 1QWSA 1TUBA 2PR7A 1P0MA 3MK31 5G0WA 5EP2A 3W4KA 3LYUA 2FXIA 3M7IA 3HS3A 1YMQA 5U4XA 3ZVRA 4AZ0B 4V38A 2Y93A 4CV3A 3GGSA 5KCZA 1TZ2A 2HU5A 3CZCA 3QLEA 4GKVA 3N86A 5F78A 3MJSA 1JDUA 3L0PA 3NTUA 3JR7A 4HYEA 1P3Y1 3LDGA 3KU1A 3T06B 2ZQZA 3HBAA 3NM4A 2F43A 3GNQA 1ZGHA 3BHJA 5IJAA 3SYMA 3DHWC 3FPCA 4BLUA 1OTYA 2YVUA 4UVDA 1BS1A 2MOKA 4YJDA 1P0QA 4JJZA 2E4AA 5C31A 3ZWWA 4C88A 4ETNA 1JR3A 1FXUA 1X86B 2H5LA 2XUJA 4BV9A 5JNSA 3L6EA 3PL1A 5CIQA 5C1IA 1Z4KA 1EGAA 4KX5A 1Q0QA 4TS3A 3RVOA 2HL6A 4J7CA 3O84A 4UU8A 4M6WA 1JT2A 2FDXA 3D54D 2FX2A 4V0NA 3FNIA 1CBUA 1ZGBA 2AC4A 2QAGA 4YCNA 2IGTA 1DBPA 3HDGA 3OO0A 4IFTA 4QYSA 5B1SA 1V5GA 5C8ZA 1KQFA 2J4FA 4IZOA 3CIOA 2G28A 2IPLA 2JLSA 2Q4EA 5HZKA 4YDSA 5EE0A 3VPXA 4TQ9A 5COQA 4OVKA 4F11A 3K72B 4ATNA 1RRMA 1SHUX 3SWWA 3TEMA 1I1HA 2X0NA 1H42A 4F5DA 2XD4A 1RZ3A 4KEAA 2WOOA 1YIDA 1YCGA 2FPKA 2R7KA 3OFND 4URWR 1XZKA 4FOOA 1H3FA 3WK5A 4DIEA 5HTOA 2VSQA 4RE6A 4X85A 2BMJA 2X2FA 3MT0A 5CK4A 3I64A 4DNOA 1S9DA 3U16A 5AXDA 2GUGA 4Q03A 2PN1A 5EHNA 4EF5A 1L7QA 1NXTA 3R3SA 5HUHA 4JFRA 4NEQA 5KHOC 9ABPA 3RTEA 1C1DA 1EZ1A 4HV4A 4CLEA 3E2IA 3FCYA 3LNTA 5J4VA 1ZNZA 1QZUA 4MJ3A 3GRYA 4YPVA 4HP8A 4RF4A 3TZQA 4J9VA 1EA7A 3CGWA 2GARA 4AJOA 4P33A 3O8QA 1G8HA 4CGYA 4MKRA 4UHBA 3HP7A 2EIXA 4MHSA 3W2TA 3VSDA 4ACAA 5BSEA 1WM1A 1XYYA 3CTPA 1IZ7A 3L0YA 1NQXA 1U28A 2AFIB 2ZEJA 3FW1A 1G4HA 4UARA 4MEJA 4Y2RA 1SXJC 3NUGA 1W30A 5EMNA 5BNWA 4Y1GA 3JQFC 1K6JA 1U1GA 2A9RA 4YP7A 1O3YA 4AY3A 5CDFE 1AZTA 4M1EA 4P4UA 1TXGA 4MRNA 1QANA 1E5XA 2ET6A 3EVTA 3G85A 3EQ8A 4FPXA 2G9UA 4W8HA 2VYCA 5DK4A 1SU7A 2FPGB 4HDMB 4AO7A 2IHNA 1FU8A 5FWAA 5LU9A 1XCPA 3AWDA 3HJNA 1FMLA 3UCXA 3GEGA 3T7SA 2VBIA 4DRXA 2WHPB 1R5NA 3BQNB 2FN4A 3DNMA 2NSLA 2JKYA 4Y1EA 3RVRA 1JG4A 1VYHA 1E3DA 1YI0A 2ZTMA 3T3EA 2Y05A 3ADKA 3E4CA 1Z0UA 2C59A 5ALIA 5LD2C 1L8LA 2ZYSA 3QWAA 2YKGA 1EKXA 2VQ3A 3FPLA 3KKNA 3CUWA 3UOWA 3B70A 4S0XA 4JT8A 5KTMA 3RFFA 5KYWB 1PBNA 4QGHA 5FOUA 1RI2A 5JE8A 4BFCA 1WZNA 4F86A 5CXQA 2UYGA 4RLQA 1WV1A 2VP9A 5J4KA 2VDNB 2O0JA 3AIOA 1NQAO 2JDID 1T8TA 2P9FA 2QLNA 3AERA 1U0EA 4LOLA 1EGQA 2JL1A 3H6KA 4NVRA 4ZGGA 5MGNA 3GMSA 3AUYA 4G4IA 5TGZA 4AU1A 1H3EA 5E9JA 1TCUA 2PFSA 1PSZA 3HJBA 2LW7A 3K0AA 4FQ8A 1UK9A 3K4PA 3ONVA 4AX4A 1YRHA 4KSBA 2QJFA 2C92A 3O4IA 4HQRA 1KMIY 4F38A 5HX7A 3QU2A 3JD3A 2C20A 4ZI3A 3MLEA 2BRUC 4MGZR 5CFZA 1ZH8A 4N5MA 3CZQA 3HACA 5FA8A 2Y92A 3RNLA 3F7TA 4E51A 3QW2A 2HLDD 1HYGA 3PNPA 4OG2A 2PEZA 2D59A 3CLUD 3KIPA 4MHOA 1T9ZA 2NACA 4Q21A 1WMBA 4H3KB 3QF4B 3TX6A 4YMLA 3DLBA 3LUBA 1RJGA 4EMSA 2GEBA 4H1WA 3TWOA 2ZRIA 4H1TA 1I3KA 3S8EA 1F0PA 4UUBA 3THXA 1ZMXA 2XUOA 2FMXA 4NTZA 3UMFA 4JQZA 2J0UB 4ISCA 5C7OO 2O8DA 1T3LA 2Z2IA 1QBGA 3LF1A 2VAXA 4GOKA 4HXEB 1MZPA 5LPNA 4A2WA 2RC6A 1LGYA 1QO9A 2GRJA 1WQ1R 4ACBA 4S24A 1D1QA 5LMNB 2C77A 4RETA 4Y2QA 3T7IA 3EPLA 1TE2A 3G2QA 5DCWA 3C3MA 3FD8A 3WY9A 3NAZA 3KDAA 3R7AA 1FUYB 1NF2A 3DMHA 3BCSA 4BQNA 1F0YA 1RBZA 5EWLA 2XRFA 1ZFNA 1EWTA 3U31A 3W8EA 1KMHB 2QTRA 4AKEA 3T5PA 2YZ2A 2II6A 1Z0JA 3L7OA 4O8CA 3D8SA 4Q1BA 4BMDA 2AR0A 4KBYA 1C7RA 1E79A 1R0CA 4P4SA 4XYLA 2G3YA 4MVXA 4XJXA 5J5AA 3VH4A 4BAUA 3MB8A 5BVHA 3N58A 1P73A 1FFYA 1CFJA 1A71A 3UFXB 1T4CB 3TZCA 1WU7A 3OZXA 4Y0VA 3GN1A 1FFHA 1TC2A 2XNCA 1KZ7B 3D8NA 2VYQA 4C6TA 2WIKA 3GLVA 3UK1A 2WMOB 4UTVA 2JD2A 3RK1A 1X2EA 1XU4A 2I2FA 5EIEA 4Q9AA 1YQQA 3PA6A 2VK4A 1Z6QA 3IQHX 3NVAA 4N7BA 1IUKA 2EARA 3RYIA 2ODQA 3NOVA 4X84A 1EFLA 1OWNA 3BJEA 4JKOA 4V3BA 5F7OA 1ULTA 1M8KA 1IY9A 1IBSA 2OQIA 2D7CA 2CLMB 4BLSA 4OK5A 5FNVF 1H5NA 1C0KA 1B74A 1F5SA 2PT7A 4ARUA 1RKVA 2IELA 2ZBPA 1I30A 1L5FA 3B5JA 2QRMA 3OCXA 5E6RA 5CJ2A 5A0TA 2Q62A 3K20A 2AA3A 2XQKA 5PNTA 4IIVA 2HBQA 4EHIA 2ZSEA 1NMQA 3BFPA 4MS3A 2MJLA 1X92A 4EAQA 1EXVA 3JYPA 1T9BA 4DQVA 4TL9A 4C5AA 2YOGA 1TUIA 1GPMA 2WYWA 1XL0A 4KHZA 3G6WA 3WTCA 1NF9A 4TT3D 3PIIA 4TTTS 3VI4B 2YH2A 3EZGA 2VNIA 4IIYA 5C4MA 3UCEA 1UJ5A 2HEIA 3HDTA 4KODA 2VP2A 3JQAB 1S6YA 4OQXA 1PHPA 1EE9A 1VJGA 1NN3A 1QGOA 3ADCA 1WE2A 4QDKA 1T2EA 3T9CA 3G2PA 7YASA 1PP4A 3M49A 1SBTA 3RSHA 1TLTA 3IELA 2OY0A 3IMEA 2KHZA 3IVAA 2QDXA 4V1CA 3E15A 4BXOB 1RHQA 2OCGA 5G4KB 3WICA 2I3BA 1CR6A 5CNIA 3TNLA 1HEUA 2HXSA 1HXHA 4MKGA 4N6NA 3R7WB 3ZWNA 2IUYA 4ZGWA 1BDMA 1CF9A 1E2EA 2E2WA 4UVEA 3FFAA 3JAWA 1A8SA 3Q5EA 4JFAA 3E9ZA 4N8DA 3GRUA 1XZQA 2QXTA 3WIEA 3C8ZA 4MA4A 5KWJA 3L84A 2ISCA 4NZZA 3TMYA 3WZMA 4BYMA 3HHEA 3VR6H 3F4LA 3QELB 5JDCC 4YAKA 2C5LA 3N2KB 4R69A 4Y2YA 3TBHA 2P90A 4F2GA 5DX1A 5EFZA 3H75A 1JR6A 1W88B 2BTQB 1HZZA 1UBCA 4PE5B 3VTFA 1O4WA 2Y3IA 1GLNA 1P39A 2Y77A 1TF7A 4BJ1A 5LQJA 4JBIA 4NFYA 3GFOA 3CEJA 2DQZA 5DLEA 3WLNA 1NYLA 4MI3A 5FCDA 1L4BA 4QO8A 3H42B 3QPAA 2AMFA 4XFJA 4RHUA 2PQ6A 3I09A 4BZZA 5JCJD 4DUYB 5CLLA 1B4DA 3DZBA 4ZC1A 2GJ8A 3BMNA 4JP1A 2Y6UA 1QYVA 3CG0A 1O6BA 2HJVA 3CMMA 1PDVA 4FS8A 2PWYA 3G0DA 5I45A 4G0WA 1ZCZA 2O05A 2OHIA 4E6EA 4XVCA 4MVJE 4R2JA 1HMPA 3QTBA 2FSPA 3R9XA 3ILSA 1C14A 2HWXA 2J0VA 4Y2TA 3D7NA 3WMEA 1ZS9A 2RJ3A 4LYEA 5CT8A 3PVSA 1YT5A 4P32A 4YXWD 3OTOB 3SKXA 3SZMA 1WBDA 2OILA 2R5WA 1CHDA 2C8JA 1FFXB 1SKAA 2FR8C 4LJRA 2W83A 1EVQA 4DCOA 5CG2A 4MAFA 3V2IA 2Y27A 5JRDS 3BMCB 4FM9A 3BYZA 2ZIEA 3KEMA 3I58A 4I19A 4K6KA 1PLKA 2E89A 1G9TA 4G0YA 4ML3A 5D85A 1IOLA 1EFRA 4KIJA 3QLVA 3FLMA 3D2CA 3AEQA 3OMLA 3IP9A 2Q6VA 5DHFA 4ENRA 4GHWA 1UM9B 2I7XA 2PCLA 4LYYA 1R0YA 1YZNA 4LWPA 2CZCA 4CF3A 1II8A 1TKAA 3KD3A 4AL4A 3OWOA 3KSZO 3R75A 4FFVA 3M82A 1Z6GA 2ODNA 3NHRA 1Q6YA 1US8B 2DE0X 3CVXA 1OV6A 2WWTA 4MSUA 1NR7A 2IU4A 1GTSA 3AVXA 5GPBA 1FLAA 4YIHA 3D4PA 2Z5LA 1CJSA 1U1DA 3P9IA 3BFJA 3VSEA 3G59A 1N2SA 5LQSA 1X39A 1RI3A 5AI9A 4LSGA 1JQDA 5CX1A 5E4YA 3TR0A 3V33A 4D97A 3T8YA 2B83A 2QRPA 1M33A 4ER7A 3UBMA 2IZ7A 4X71A 2PNFA 3JQ9A 3NKLA 3CB4A 2Z95A 4A7PA 3ZCTA 2E5LB 1QH8B 4D0SA 1I4LD 1OIWA 4YMWA 4QQKA 1ZCFA 1ODTC 2MWMA 2BGNA 2R1VA 3OP4A 3OJXA 3KT8A 1G1AA 2AEFA 2B4RO 4LGMA 4NQZA 3OECA 2PXXA 3BC1A 5A3VA 4DXDA 1KHTA 1BGWA 1E2LA 2M6SA 4XSHA 3HA3A 3UVEA 4C7OB 1N57A 3RWMB 3KCQA 1IOVA 4Y1FA 1GGEA 3KO8A 4F3TA 2H08A 3WK7A 4JBWA 3A14A 3QA9A 4H1HA 1JG2A 3H0KA 4DL9A 3AHDA 4IIHA 5H80A 2QRUA 5B3KA 1I80A 4DV3B 2ZRAA 4FT2A 4YCBA 1BJRE 3T4XA 3DE3X 1IWOA 1O0SA 2I65A 3CNEA 4Q9KA 4CM7A 5IKXA 1GT6A 4WZ6A 1NRIA 4OXIA 3ZE7A 3CT6A 3I9LA 2VBFA 3MAJA 1NKSA 3JAKA 4BVHA 1PFKA 1PUJA 1VPDA 2EKLA 2JFHA 1U6IA 3OLXA 4QBFA 3R9WA 3T54A 3K6KA 2XOKD 4E33A 4MUEA 3GUUA 1AO0A 1MRSA 2ZB8A 3QE3A 4UDYX 1J20A 3FVRA 2IYQA 3GDFA 1ETHA 1IATA 3TPZA 3TLMA 1RCTE 3BTSA 6ADHA 2GBPA 2QN3A 1R8XA 4TLAA 1RACA 1I3CA 1U0SY 1ZRSA 2CNDA 4HKTA 4HF7A 5ARBA 1VGRA 2JAOA 4DYVA 1JG1A 1ID1A 2OV6A 1S2DA 1KL7A 1UODA 1Z5VA 1A7AA 1ZIOA 3MJCA 3KQPA 2QPAA 3EPPA 3MUEA 3AUUA 2QR5A 4RZXA 3BL5A 3C6QA 4AXXA 4IIJA 1H4VB 1NR5A 3GPBA 1GZ7A 3BDAA 3FJOA 4I1PA 3F3KA 1QPZA 4QEZA 3ZW8A 4X6LA 5C7YA 2G5CA 2BEWA 3P9ZA 4KMMA 2J30A 1KJJA 4X95A 5TT1A 4IJUA 1R5BA 1BQEA 3H1EA 1G41A 3TL3A 1H94A 3P20A 3U17A 1A98A 4C2UA 3PIDA 1OFTA 3N8KA 1JEDA 3CZ5A 1FE8A 3KKKA 2O1SA 1VL2A 5DLYA 3GLHA 1E4YA 1FP4B 2PKRA 4GSYA 2Q7DA 3V46A 2WSMA 2IE8A 5LOVB 3MM4A 1TIPA 1O54A 2RH5A 3GV0A 1USIA 1TUEA 3IBCA 1XD9A 1QPGA 5JH7B 3H1BA 1AS0A 2YZGA 3C5HA 5A02A 1E1YA 3H1TA 1GADO 1N3LA 3B6EA 1P9WA 2YFQA 3A31A 1B8PA 2FZEA 3D4NA 3M3PA 2XA2A 4F3NA 3GFPA 3MXOA 4L51A 4QT4A 2OFXA 3M2TA 3QEOA 3V4ZA 3HCRA 4GR4A 1AQJA 3RAGA 1ESNA 3QE9Y 1XRPA 3KAJA 2J7KA 2XYRA 1GILA 2UZAA 3F78A 2Y4OA 5DM60 2LWIA 1JTEA 3ZZ1A 4R71A 3LGAA 3P2IA 5AT1A 2AX3A 3UJPA 1MB0A 3WYCA 1RQ7A 4L73A 1RPZA 2J32A 4BMOB 1MG5A 4YACA 2NU8A 3ZLBA 4CR6A 2YY7A 3CCCA 2HQBA 3HGMA 4G0UA 1XPOA 4XB2A 1DV2A 1JQ5A 3BCHA 4BCCA 3NXSA 4PLFA 1LEHA 1BVRA 1NMSA 2V8OA 1P1CA 1U2PA 3PTZA 3ADPA 4PTLA 2I8AA 4RLSA 1ORTA 1TQDA 2OG2A 5EE1A 3I5YA 3WP0A 3ZZTA 1I5EA 1YSCA 2DPYA 1ZINA 5KNBA 3GFTA 1A4IA 5HK8A 2HCBA 1KAQA 3ZWAA 5M3BA 2LDXA 2O2CA 1NKVA 1SBQA 3PNMA 4FZ3A 1V3TA 1KMMA 1WO8A 2VQDA 2C2GA 4Z0NA 4I2NA 2V55B 4V0QA 1H2WA 3VPSA 3LOPA 3DF7A 4XD7A 3PEWA 5B36A 2UYCA 1DQNA 5L7WA 3W5BA 2G1KA 1CTQA 2NTEA 5JJCA 2G5TA 3IQFA 4RY2A 1QSGA 1UDAA 1QHIA 4W5HA 4CU2A 4IR7A 4HEJA 3DV2A 3HUTA 3FNBA 3CLHA 5I9LA 1XRLA 4POOA 1U0RA 3L7MA 3W9UA 4YP1A 3EMBA 3NCTA 2JFVA 4E14A 3SNHA 3DR5A 4RQBA 3RRJA 2X15A 4B71A 3JALA 3C3WA 2FFBA 2RH4A 2R7LA 4WLEA 4BMXA 5K6AA 3U44B 4W9NC 2CLOB 4PLWA 3LBAA 4D74A 4ZGBA 3ELDA 3A9SA 3CF4A 1RYHA 1LFAA 1R00A 1U1FA 5JNRA 5KIAA 1CD5A 2J5BA 4ITRC 5KHLB 1YVPA 3O2QB 3BILA 4B8ZA 4KREA 2VWPA 4HS9A 4DYHA 4BNKA 1SNYA 1SQ5A 4NCHA 1YIOA 1WA5A 2BUAA 4TWRA 4OQEA 1E32A 1RWXA 3A3KA 5F3RA 3PDIA 4UZSA 5T7BA 3CVYA 3JQ7B 3VC7A 2P9QA 3L7DA 3MMZA 3ONNA 1R4NB 3PCXA 3RLIA 4S2EA 4HAZA 4PLPA 2ZR7A 4OHFA 4F7WA 4WCFB 4FYKA 4PHFA 3MTBA 3NHYA 4PSVA 5A7HA 4MWCA 3L07A 1WCIB 1WUYA 1W96A 1YZKA 1OLXA 1QONA 1E3SA 1W4LA 2GR9A 4I1IA 2NMVA 3AHHA 4EY5A 3OIGA 2P9TA 4HZIA 1PD0A 2P7HA 3NFYA 3DZKA 2VH5R 4KNYA 3BMOB 4YUXA 5KB3A 4P9NA 1E2HA 1ZW6A 3KYIB 5AIBA 1LF5A 5ADUS 3LPNA 1EWQA 1ODJA 4EI9A 1JEOA 5JNWA 1YJ8A 1KDVA 3VNSA 3QITA 3BORA 2GMWA 1VE9A 1IY2A 1PYGA 2HMSA 2OVFA 2Q8QA 3CLTC 5JSZA 3U7GA 4KN6A 3TDMA 2XTZA 1ONPA 3TLEA 3OQVA 4MPTA 4XUDA 2V3VA 1EB9A 1O0BA 2C99A 2H07A 3D6AA 4BX8A 3SVTA 3P7MA 1BH6A 3OIVA 4PYLA 3O4GA 2IS4A 1PJ4A 3OICA 4OBXA 5EKTA 3AM3A 4DNQA 3TQCA 1S2LA 4D4IA 3LLMA 5DIFA 4DM4A 3SEFA 2JLAA 4FGUA 3INNA 1Q16A 2BGWA 3MJVA 4H0NA 3ANYB 3W8DA 4BRSA 4UHEA 5JMWA 1CEYA 4TKVB 5AM2A 1XE3A 3RHSA 3LLVA 4WVFA 1WEHA 4OGGA 2RBGA 2ZT7A 4UBMA 4UCFA 2IPOA 4OK3A 4RV5A 5DN9A 4K2HA 2I9KA 1TO6A 1VE3A 1JEQA 1LBTA 2R6HA 3HO8A 4PIVA 4QELA 1T4MA 4NICA 3KVVA 5IK2A 2VT6A 3K0EA 3U0BA 3WLPA 5K0JA 5HCUA 2E55A 5TEVA 4PR0A 5M5BA 1DUIA 4C7MA 2B92A 1RYEA 4GE3A 3U48A 4R2LA 4KO8A 3JQ7A 3F5FA 3OPMA 5ECGC 3OJOA 3H2HA 3AR2A 2C98A 1X80A 4UZEA 4IKOA 1YIAA 5CCDA 2XCIA 3ZDQA 3BT7A 2VZ0A 1SGWA 4RKFA 4YHBA 3HVUA 1P1KA 1QP0A 3DXXA 1EUDB 4JB2A 2ATVA 1L5KA 3IA7A 2WJPA 1Z9BA 2WUDA 3EDYA 4AYTA 3A70A 2Z58A 2O8VA 3LH5A 4R1TA 4REMA 2A0YA 2BZ1A 2VOJA 3JQQA 3KWFA 4UHCA 3UWOA 3QVJA 2VYVA 5LSAA 2ZI9A 3IJ5A 2XYQA 4LV8B 4QHTA 3H5AA 1D2GA 2PUAA 1XNJA 2L17A 1NLUA 1PD1A 1U3DA 2P9JA 2RB4A 4OHWA 3DNFA 4KQGA 3AKZA 3K1TA 1Z7GA 3K73O 4MRVA 4WFIA 4CM6A 1Z2DA 2OXRA 1QTIA 2BFBA 3FNRA 5FADA 5B1IA 5KWVA 2FB9A 2B6HA 1U2DC 2BFFA 1BWPA 3HJCA 2LKDA 4PXAA 1BWQA 2NUAA 4BMNA 4W6QA 4ZZ3A 2VQSA 1CG6A 3RADC 1YJ5A 5K51A 4YA6A 3QE0A 3T1OA 5ILQA 1TJPB 2WJZB 3EIFA 3EDCA 3UK7A 3IKTA 1M5RA 1YDHA 3OCJA 4AJLA 2XGSA 1TM2A 1PQUA 3HRKA 5GGYA 1KSJA 1D5WA 2FP3A 2WJHA 4R5MA 3VZBA 1DEAA 3KPWA 3E58A 3NTXA 5I6DA 5E2IA 5HOEA 4DB4A 3FPSA 1YZVA 5HNKA 1FLNA 3WB1A 2QQ0A 2F1OA 1ODIA 3QTTA 5CGQB 2GJ9A 3MGCA 2NXEA 4D6XA 3LV8A 5IABA 3I5MA 2QTZA 1TYEB 2O8FB 4I66A 5LQCA 4L9WA 3O9VA 4HLCA 4RFSA 5DGDA 1JEQB 2B7BA 1DARA 5TMDA 5FWXB 1M1YE 4ID9A 3D3EA 3PDHA 5DCUA 5BV7A 3DPIA 4A26A 2I7DA 2PUJA 4QC2A 4TKLA 2V6MA 5EKXA 2DECA 4EVSA 4GO1A 4QYIA 3TAHA 4LECA 1RE0A 4TWZA 1Z62A 4MVJG 4WSOA 5BUSA 3T1QA 4RL6A 3RKRA 2F59A 3EAFA 5G02A 4DEYA 3ZQ6A 3ZOZA 4C87A 5ALGA 1Y80A 3K16A 3EDMA 3VC3A 2MINA 4RMJA 5CCXA 3NXKA 2VJQA 1D7OA 3HVHA 1K98A 2VXCA 2X0RA 1D1SA 3TLCA 3TW0A 1HT2E 2H4ZA 2HO5A 1NXXA 4CMBA 1NM5C 2EKPA 2V0GA 4I9FA 1J33A 1XTBA 3EXHB 2X23A 4DR7B 1UH5A 5DO9A 4BIMA 1TCCA 2DYKA 3ROTA 2RARA 3DAOA 2XNKA 3IAEA 5FBVB 3TPCA 3VV3A 1QHFA 1IXRC 1O97C 3CEAA 5GV8A 3GEIA 3D1LA 1OFIA 2YOFA 2CDBA 4UU1A 2H4HA 1HO3A 3B36A 3MQ4A 3ZG6A 2FJUA 3PQ7A 3QVKA 3RU9A 5AKYA 2O54A 2GN2A 1JIQA 4EITA 1JPUA 2AKAB 2EP7A 3I2GA 4IO0A 2CSXA 1DQYA 3UV6A 1FQWA 5JI2E 4LF6B 1E4EB 1AKVA 1NX6A 1RHMA 1T6YA 4NRDA 3EQ7A 3TW8A 1UBMS 2NP6A 4UXIA 3WMXA 4JGIA 1E2BA 2PHZA 1X8LA 1GQQA 3S40A 2QTGA 2G77B 5CYOA 3UKJA 5LZ2A 4KXYA 1M73E 1FLDA 4HWKA 1JV2B 5IDVA 5J58A 4RZHA 2N0SA 2IYYA 3ILYA 2G88A 1K88A 4N8SA 5TS3A 3DBHA 1V8OA 3FB4A 3JVDA 3PUVA 2XPCA 1C3OB 3VR6D 1T0UA 6CHYA 1YJBA 5L40A 2IPXA 1DGQA 2XOEA 2P9GA 1LRKA 1XLVA 3DT9A 3F4BA 4LYGA 1II0A 3NBFA 2QX6A 2O20A 1NX9A 5E6SB 1JHOA 4XPZA 2FE1A 4HX2A 4JQCA 4JLUA 2AEJA 3VGPA 3COSA 2C2BA 5C3MA 4W9MC 1TPZA 4J43A 1NJ6A 1X14A 2BZSA 4IGKA 2I9PA 2P40A 3KTAA 3BK7A 1RHJA 4JIGA 2BFCA 1E1CB 4OHVA 4CM1A 3VMMA 2GFHA 4BAZA 2NTVA 3ENZA 4G1VA 1F14A 4HLUA 3H84A 5HIIA 4C0LA 4EG3A 1I0IA 1MF7A 3Q88A 1WZUA 1DJOA 1QV6A 5HGXA 5BRJA 3WNDA 2F64A 3K1AA 1K7EB 1GZ3A 2QRJA 4ZMBA 1L9XA 1BYUA 5BQOA 3UWDA 4K46A 3ZUGA 2JEZA 1D2RA 1KVQA 1JR4A 4EYKA 1Y4DE 1QGAA 3K30A 4HGRA 3AGPA 1J99A 3GMIA 1XKXA 1FNNA 4LF7B 2MSCB 4HQFA 4INAA 5A9TA 3I9MA 5JBNA 4CF7A 1NHWA 3F1LA 3FKSD 3FSGA 5DNDA 1R0WA 2C83A 1RWVA 4S04A 3PI7A 1NBIA 4HDNA 3F2IA 3GA7A 4HEA6 2QT9A 4JHLA 3R8XA 3RTGA 3STWA 3IKMB 1PR3A 4D99A 2QRVA 2QEQA 4DIBA 1R50A 2QTMA 2LCIA 1I4TD 4TKUB 2ZUEA 4TVOA 3ACBA 3TNDA 2GM9A 2NYVA 2R8EA 4CL0A 2XDQA 3ILHA 3IQGX 3ZZ0A 2WC1A 4GMKA 3OP1A 1VC2A 4EG5A 4WBNB 3E82A 1V3VA 4NMMA 1QP8A 1VL8A 4O29A 4V24A 1T5IA 1VPTA 3ZXSA 1AJEA 3G5MA 1K92A 1NU8A 1JSXA 1ORHA 3L82B 4MYRA 2ENUA 1N5MA 3HY6A 5G1NA 2PRSA 1KSFX 4ZVPA 3MINA 3R74A 4NARA 1EZ4A 5KNBH 1JALA 1KMQA 2FPIB 3E70C 5ITZA 1C3EA 4DLAA 4ZEVA 1BVYF 2OZVA 4K3VA 5JY1A 4W4TA 3JW8A 4F6RA 2Q07A 3PRKE 2QLBA 3CN7A 4PAGA 2FSIA 3DV0A 5JWOA 1RIIA 4Q4DA 1Z4QA 1ZL2A 2COKA 4G0PA 5EHGA 3RCBA 1PNVA 1UIRA 3M2PA 3WDLA 2HDHA 3GRRA 1OLSA 4CTJA 2PV7A 2PLAA 3L6DA 4GI5A 4I5DA 4ND6A 3VNUA 1JJVA 3F71A 4K7JA 2Q6KA 1Y63A 4KFTA 4CYMA 1THMA 3FCUB 4JH0A 3ZJYA 3HKBA 3A6DA 4BQOA 4U2GA 4UDNA 5DXJA 2EBFX 4KXWA 5E7MA 3O9MA 5JSFA 2ALJA 4Q47A 2HJGA 3OPXA 3WGHA 1G64A 2DCUA 3WNQA 3KTFA 3R3VA 2ENWA 4OA8A 4AKGA 3BJRA 1T3HA 3MWYW 1C2YA 4MJLA 1BOOA 4Y7CA 1TKCA 3KXDA 2JZCA 2I5PO 3O4FA 5HQJA 4REOA 1VPLA 3LDFA 1W87A 3AVOA 4R6WA 5FPHA 1J8MF 3AWIA 4EHKA 1NNEA 4DTCA 5C51B 1CLEA 1SXHA 2JGDA 4C4RA 2ZBDA 1G7RA 3P94A 4U63A 5HE9A 1YKSA 4BNNA 4E12A 3ESZA 5CFQA 2VXYA 1MORA 3SYRA 3TDKA 3GVPA 4NY1A 2OAEA 2J9FB 2HKIA 2QNIA 4Q4HB 4Y8VA 2ZRFA 2OC9A 5AVVA 5CPBA 1O0CA 1F60A 1V2HE 3MMXA 4K3UA 3E9CA 3DWIA 4MARA 1XTUA 4RA9A 4PQFA 1XP5A 4JQSA 5DYYA 4GDFA 3RG8A 1UBLS 2GEJA 4GNKA 1E3EA 2GAAA 2ZIGA 1FXWF 1R12A 2XJ4A 2QTFA 1UPUA 3TB4A 1V7ZA 3KPJA 4U7HA 5FR1A 1S02A 2V6IA 3DOJA 2ZUSA 1JJBA 2C0PA 2FZ4A 4RMGA 4X60A 5K8TA 5ITZB 2VDVE 2ZFUA 3I9V1 1L7AA 1R0SA 1PQYA 2X8BA 4D0GA 1KYYA 2JGFA 4RK7A 1T3TA 4F6RB 1KOJA 1K2VN 1BWSA 1WSBA 2AL7A 2OV3A 3PXEA 4JLVA 4X9XA 2D5CA 5C81A 2F1HA 2Q28A 4NPAA 2AHRA 1WQ3A 2OHGA 2EX1A 2QUHA 1U9CA 2JAWA 3OHSX 1S7GA 2QTWB 4RQTA 1KYTA 3P2EA 3GUHA 1ZJJA 4C14A 2V96A 4BLOA 1FJGB 1VJRA 3I3OA 2E6KA 3T52A 3VV2A 5JPDA 3OTWA 4N76A 2D1SA 4ZCLA 3OQJA 3SYNA 4KQKA 2GYVA 4KJZA 5SY6A 5KTOA 4I4CA 1PWEA 221PA 2IXGA 2WDZA 5E95A 2BF4A 1VIAA 5JR3A 4FDVA 2H4XA 3PUWA 1S8OA 4G23A 4NYIQ 4CMIB 5I9NA 1QORA 4F5YA 4AO6A 2JEYA 5EUMA 2FUG6 1TMOA 3EPRA 3SHTA 3LI2A 2IUUA 5T8KC 3NWOA 3VDMA 16PKA 1ZX1A 4OP3A 4UBKA 3DBVO 2CYAA 2YZ7A 5CDSA 1CW2B 1ODLA 4RAQA 2BBOA 2BKVA 1MQAA 1F7UA 1F2UA 2CL0X 2UVPB 2C94A 4WLFA 5G0SA 4EUKA 4D44A 3VAYA 1CPYA 1U9IA 1VLZA 4PHHA 4Q6WA 4QDOA 4QXRA 4BNIA 1G7CA 2QX7A 4I1YA 4M37A 5EYPB 4MQFB 2H1CA 4BP3A 1COWD 1ZMRA 4M9XA 4Q3LA 1TYZA 4GP6A 4WUTA 3CF4G 4FFRA 3VH2A 4Z3OA 2H59A 4GKKB 1X3SA 4MR7B 4C1NA 5I47A 1GA1A 3AF3A 1Q1ZA 3SICE 3ZVMA 5K8JB 4EG6A 1NDUA 1XZMA 3RYHB 1R27A 1VG8A 3DOEA 2UZ4A 4CT5A 4HB2A 2EJBA 2H7CA 2CN1A 2FZWA 4IIDA 1JLHA 2FQWA 4KQFA 2BMAA 3PRHA 4IDGA 1V8FA 3Q3HA 3NWJA 1ITZA 3CX4A 4M9UA 5ALLA 2A0XA 2B2XA 3B8EA 5KTKA 3TUZC 1JEYB 1IH8A 3W5IA 2FPSA 3U7FB 3TSAA 1E9BA 2WFZA 1G21A 3TG2A 2OYCA 4Y9SA 4H9GA 3TD9A 4FHGA 3UAVA 2OFOA 4PZCA 3DL0A 1XJQA 3E2MA 4OB8A 5I3CA 5K3BA 3T3OA 5BNTA 1YDFA 5DHQA 1P3DA 3HR8A 2ZWPA 3ZBTA 5K1ZA 5HILA 2J3IA 1QX3A 3GLFA 1ECLA 2YV4A 3NEPX 3IVCA 3LKBA 2CL5A 4QU9A 1R0LA 1V16A 3NHPA 4QTTB 1CJKC 1RLUA 1Z8DA 1O58A 1OWOA 2FSVA 3NBQA 4KDEA 1JKMA 4PRZA 2H2HA 3GO4A 3MCAA 4UDOA 5BW8A 2FN7A 1L3BA 2GJ4A 3P52A 1Z5OA 4RSGA 2XB2A 3RS7A 1P60A 1FDOA 2ABWA 3ENNA 4YYEA 1XVLA 5MN5A 2AIRA 4OMCA 1J5EB 4U2DA 2BF7A 3S1AB 2H52A 2DAPA 2JD1A 3DCJA 1I6WA 1E6LA 2QP3A 3U3RA 1J2TA 1I0LA 1WBJB 1LW6E 1Q1NA 2ILVA 3PHGA 3U7QA 1NJ2A 2JB9A 3BXOA 4ZKEA 1UPCA 2OBXA 1MGPA 2L18A 2XEXA 4PIMA 3CBQA 4NDAA 2PO7A 4NS1A 6GPBA 2B25A 2PL1A 2RJOA 1HFKA 1DAMA 1QOQB 2C3OA 4GZ6A 3BXXA 4PO8A 1SQSA 3A7EA 3CMCO 4FX2A 4OBEA 4C2AA 3ROXA 1QGYA 2Q0XA 3O26A 4V3CA 1RWKA 3TQIA 1JHAA 3I72A 2BTOA 3ZY4A 3KZ1E 5I7FA 5FUMA 2VQFB 2C5EA 2WG2A 3JQ8A 3PR2B 5GV7A 5F9FA 2GHQA 4HQNA 4WAUA 3WGJA 1R1DA 1KR2A 1M1ZA 4KPGA 4W82A 2EG9A 1IJEA 5HKKD 1JEYA 3PA8A 3A1SA 4TL6A 3BJMA 3ITDA 3PDJA 4RVHA 1H2XA 3SZOA 1GZSA 1N6KA 5CDTA 4EKYA 1P91A 1NE7A 4GPTA 4AZVA 2K5UA 2Z30A 1U5BA 2PUFA 1KJYA 1BJKA 1RAFA 4X8OA 1BMFD 2Z4SA 2D1QA 5AKKA 1BA3A 2ZE8A 2IKSA 3A36A 3OIFA 2FTKE 3GFFA 3PJFA 4R98A 1ISJA 4K03A 1E61A 1K97A 1XZDA 3IUJA 1MN6A 1KKLA 3Q7IA 4I4LA 5B30A 5KYTA 2WKQA 5DSXA 2UUBB 1C9EA 3H1AA 4L3WA 4W7SA 2E4VA 1IK4A 1YQDA 1CUVA 1I13A 4IMPA 1YJQA 1I2CA 3SJZA 1Z4OA 2VWQA 821PA 4LF9B 1SXGA 3HSYA 1VLLA 3MCVA 1UBTS 1OWLA 4KNWA 2Q50A 1HTTA 2XR1A 3FMIA 4LVOA 5EP4A 1L1RA 4W5RA 3U2QA 4B3MB 4R8KA 5TPWB 3W5AA 4RVUA 4M76B 4Q1FA 5EAIA 1YR3A 2BZGA 1EX6A 3STUA 4H17A 3QOFA 3BD7A 3VVMA 2DETA 1PE0A 2C3UA 5TT0A 4DV0B 1T6ZA 1EUYA 4BNVA 4XIYA 4PBTA 4ZI7B 1Z56C 2Q0HA 3RLFA 3VXKA 1K89A 3OOJA 2ZK7A 1HNWB 2FEPA 4MP8A 2WU0A 4RGVA 1K6XA 2Q3HA 3LDUA 1D9XA 4BZPA 4RA6B 2QXYA 5KOIA 5GIPE 3KWMA 4QG3A