4FCIA

Crystal structure of the mn2+2-human arginase i-agpa complex
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
313
structure length
313
Chain Sequence
b'SRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginase-1
publication title Binding of the unreactive substrate analog L-2-amino-3-guanidinopropionic acid (dinor-L-arginine) to human arginase I.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 109
structure length 313
sequence length 313
chains with identical sequence B
ec nomenclature ec 3.5.3.1: Arginase.
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00491 Arginase Arginase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.800.10 Alpha Beta 3-Layer(aba) Sandwich Arginase; Chain A Ureohydrolase domain 4fciA00
3RLAA 4IE2A 5RLAA 1P8QA 3E8QA 4Q3QA 4IXVA 4MYNA 1WVAA 1T4SA 1TBJA 4IU0A 1T4RA 3SJTA 3GN0A 1HQGA 4Q3TA 4I06A 3TH7A 1WOIA 2EF5A 1HQXA 5HJAA 3F80A 3DJ8A 2AEBA 4Q3RA 3TF3A 4FCKA 1ZPEA 2ZAVA 4Q41A 4RHMA 2PHOA 4IXUA 1HQHA 3SKKA 3LP7A 1HQ5A 4IU5A 4RHLA 4MYLA 3THJA 1P8NA 1T5GA 1P8RA 1GQ7A 1RLAA 4Q3PA 1WOHA 3NIOA 3GMZA 1T4TA 1TBLA 4ITYA 4RLAA 1P8OA 3PZLA 4Q3VA 4GSMA 2PLLA 4IU4A 1HQFA 1PQ3A 4IU1A 4Q3SA 1XFKA 1CEVA 4HZEA 3SL1A 3NIQA 1T5FA 1P8SA 2EIVA 2PHAA 4RHJA 5CEVA 1T4PA 3SL0A 1TA1A 4DZ4A 1R1OA 3CEVA 4GWCA 3MFVA 3MFWA 2CEVA 4MXRA 1WOGA 1P8PA 4IE1A 4GWDA 2EF4A 4MYKA 4MYFA 1ZPGA 3E6KA 3MJLA 5HJ9A 3LP4A 4GSVA 1D3VA 4IE3A 3KV2A 3E8ZA 4Q42A 4Q40A 1WVBA 1P8MA 4RHIA 3M1RA 1TBHA 4CEVA 1GQ6A 4FCIA 4GSZA 3THEA 3THHA 4HWWA 2RLAA 4Q3RC 4RHQA 3MMRA 4HXQA 3E6VA 3NIPA 4RHKA 3E9BA 2A0MA 4Q3UA 3LHLA 4G3HA
chains in the Genus database with same CATH superfamily
3RLAA 5LI3A 4IE2A 5RLAA 1P8QA 2VQVA 3E8QA 4Q3QA 4IXVA 4MYNA 4RN2A 1WVAA 1T4SA 1TBJA 3C0ZA 4IU0A 1T4RA 3SJTA 4BZ8A 3GN0A 2V5WA 5G10A 5G12A 5EFNA 5DC6A 1HQGA 4Q3TA 5IX0A 4I06A 5EEKA 3TH7A 1WOIA 2EF5A 1HQXA 4LXZA 2VQOA 5EFBD 5FCWA 5HJAA 3F80A 3DJ8A 2AEBA 4BZ7A 4Q3RA 5ICNB 5EFKB 3EZPA 1ZZ0A 5EEMA 4QA2A 4FCKA 1ZPEA 2ZAVA 3TF3A 4Q41A 4RHMA 4A69A 4ZUNA 2PHOA 3F06A 2VCGA 4IXUA 5G0YA 4BZ9A 4ZURA 1HQHA 5EFJD 5G1CA 5THSA 3SKKA 3LP7A 1HQ5A 4IU5A 5G0XA 5EEFA 5EFHA 4RHLA 4MYLA 5FUEA 3THJA 1P8NA 1T5GA 1P8RA 1GQ7A 1RLAA 3MZ4A 1WOHA 4Q3PA 3MZ3A 3SFFA 4ZUPA 3NIOA 3GMZA 4QA6A 3SFHA 1T4TA 1TBLA 4ITYA 3MAXA 4RLAA 1T64A 1P8OA 3PZLA 3Q9EA 4QA5A 4CQFA 4BZ6A 4Q3VA 4QA7A 5THTA 4GSMA 2PLLA 4IU4A 3Q9BA 1HQFA 1PQ3A 4LY1A 4IU1A 4QA1A 4Q3SA 1XFKA 5D1CA 1CEVA 4CBTA 4BKXB 4QA4A 4HZEA 3SL1A 3NIQA 5G3WA 1T5FA 1P8SA 2EIVA 3MZ7A 2PHAA 4RHJA 5CEVA 1T4PA 1C3RA 5THVA 1ZZ3A 3F0RA 5EENA 3EWFA 3SL0A 4QA3A 1VKGA 1TA1A 1T69A 4DZ4A 1R1OA 3CEVA 3Q9CA 4GWCA 3MFVA 5EF7A 3F07A 3MFWA 2CEVA 4MXRA 3RQDA 1WOGA 1P8PA 4IE1A 4GWDA 5EEIA 3MENA 4ZUQA 2EF4A 4MYKA 5DC7A 4MYFA 1ZPGA 3E6KA 3MJLA 4ZUMA 5HJ9A 5THUA 1C3SA 4BZ5A 5JI5A 3EW8A 1ZZ1A 3LP4A 5IWGA 3ZNSA 3EZTA 4GSVA 2VQMA 1D3VA 4IE3A 3KV2A 5G0GA 3MZ6A 5BWZA 3E8ZA 5EFGA 4Q42A 5G0JA 4Q40A 1WVBA 3ZNRA 5G1AA 5D1DA 5EF8A 1P8MA 1T67A 4RHIA 5G1BA 3M1RA 3Q9FA 1TBHA 4CEVA 5G11A 5DC8A 1GQ6A 4FCIA 4GSZA 2VQJA 5G13A 4RN0A 3THEA 3C0YA 3THHA 4HWWA 2RLAA 4Q3RC 4RHQA 5A2SA 3MMRA 1W22A 4RN1A 5G0HA 5DC5A 2V5XA 3C10A 2GH6A 4HXQA 2VQQA 2VQWG 5G17A 3E6VA 3NIPA 4RHKA 3E9BA 2A0MA 4Q3UA 3LHLA 1C3PA 4ZUOA 4G3HA 5G0IA 4QA0A 4CBYA 5D1BA
chains in the Genus database with same CATH topology
3RLAA 4IE2A 5RLAA 1P8QA 3E8QA 4Q3QA 4IXVA 4MYNA 1WVAA 1T4SA 1TBJA 4IU0A 1T4RA 3SJTA 3GN0A 1HQGA 4Q3TA 4I06A 3TH7A 1WOIA 2EF5A 1HQXA 5HJAA 3F80A 3DJ8A 2AEBA 4Q3RA 3TF3A 4FCKA 1ZPEA 2ZAVA 4Q41A 4RHMA 2PHOA 4IXUA 1HQHA 3SKKA 3LP7A 1HQ5A 4IU5A 4RHLA 4MYLA 3THJA 1P8NA 1T5GA 1P8RA 1GQ7A 1RLAA 4Q3PA 1WOHA 3NIOA 3GMZA 1T4TA 1TBLA 4ITYA 4RLAA 1P8OA 3PZLA 4Q3VA 4GSMA 2PLLA 4IU4A 1HQFA 1PQ3A 4IU1A 4Q3SA 1XFKA 1CEVA 4HZEA 3SL1A 3NIQA 1T5FA 1P8SA 2EIVA 2PHAA 4RHJA 5CEVA 1T4PA 3SL0A 1TA1A 4DZ4A 1R1OA 3CEVA 4GWCA 3MFVA 3MFWA 2CEVA 4MXRA 1WOGA 1P8PA 4IE1A 4GWDA 2EF4A 4MYKA 4MYFA 1ZPGA 3E6KA 3MJLA 5HJ9A 3LP4A 4GSVA 1D3VA 4IE3A 3KV2A 3E8ZA 4Q42A 4Q40A 1WVBA 1P8MA 4RHIA 3M1RA 1TBHA 4CEVA 1GQ6A 4FCIA 4GSZA 3THEA 3THHA 4HWWA 2RLAA 4Q3RC 4RHQA 3MMRA 4HXQA 3E6VA 3NIPA 4RHKA 3E9BA 2A0MA 4Q3UA 3LHLA 4G3HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLA A;  4IE2 A;  5RLA A;  1P8Q A;  3E8Q A;  4Q3Q A;  4IXV A;  4MYN A;  1WVA A;  1T4S A;  1TBJ A;  4IU0 A;  1T4R A;  3SJT A;  3GN0 A;  1HQG A;  4Q3T A;  4I06 A;  3TH7 A;  1WOI A;  2EF5 A;  1HQX A;  5HJA A;  3F80 A;  3DJ8 A;  2AEB A;  4Q3R A;  3TF3 A;  4FCK A;  1ZPE A;  2ZAV A;  4Q41 A;  4RHM A;  2PHO A;  4IXU A;  1HQH A;  3SKK A;  3LP7 A;  1HQ5 A;  4IU5 A;  4RHL A;  4MYL A;  3THJ A;  1P8N A;  1T5G A;  1P8R A;  1GQ7 A;  1RLA A;  4Q3P A;  1WOH A;  3NIO A;  3GMZ A;  1T4T A;  1TBL A;  4ITY A;  4RLA A;  1P8O A;  3PZL A;  4Q3V A;  4GSM A;  2PLL A;  4IU4 A;  1HQF A;  1PQ3 A;  4IU1 A;  4Q3S A;  1XFK A;  1CEV A;  4HZE A;  3SL1 A;  3NIQ A;  1T5F A;  1P8S A;  2EIV A;  2PHA A;  4RHJ A;  5CEV A;  1T4P A;  3SL0 A;  1TA1 A;  4DZ4 A;  1R1O A;  3CEV A;  4GWC A;  3MFV A;  3MFW A;  2CEV A;  4MXR A;  1WOG A;  1P8P A;  4IE1 A;  4GWD A;  2EF4 A;  4MYK A;  4MYF A;  1ZPG A;  3E6K A;  3MJL A;  5HJ9 A;  3LP4 A;  4GSV A;  1D3V A;  4IE3 A;  3KV2 A;  3E8Z A;  4Q42 A;  4Q40 A;  1WVB A;  1P8M A;  4RHI A;  3M1R A;  1TBH A;  4CEV A;  1GQ6 A;  4FCI A;  4GSZ A;  3THE A;  3THH A;  4HWW A;  2RLA A;  4Q3R C;  4RHQ A;  3MMR A;  4HXQ A;  3E6V A;  3NIP A;  4RHK A;  3E9B A;  2A0M A;  4Q3U A;  3LHL A;  4G3H A; 
#chains in the Genus database with same CATH topology
 3RLA A;  5LI3 A;  4IE2 A;  5RLA A;  1P8Q A;  2VQV A;  3E8Q A;  4Q3Q A;  4IXV A;  4MYN A;  4RN2 A;  1WVA A;  1T4S A;  1TBJ A;  3C0Z A;  4IU0 A;  1T4R A;  3SJT A;  4BZ8 A;  3GN0 A;  2V5W A;  5G10 A;  5G12 A;  5EFN A;  5DC6 A;  1HQG A;  4Q3T A;  5IX0 A;  4I06 A;  5EEK A;  3TH7 A;  1WOI A;  2EF5 A;  1HQX A;  4LXZ A;  2VQO A;  5EFB D;  5FCW A;  5HJA A;  3F80 A;  3DJ8 A;  2AEB A;  4BZ7 A;  4Q3R A;  5ICN B;  5EFK B;  3EZP A;  1ZZ0 A;  5EEM A;  4QA2 A;  4FCK A;  1ZPE A;  2ZAV A;  3TF3 A;  4Q41 A;  4RHM A;  4A69 A;  4ZUN A;  2PHO A;  3F06 A;  2VCG A;  4IXU A;  5G0Y A;  4BZ9 A;  4ZUR A;  1HQH A;  5EFJ D;  5G1C A;  5THS A;  3SKK A;  3LP7 A;  1HQ5 A;  4IU5 A;  5G0X A;  5EEF A;  5EFH A;  4RHL A;  4MYL A;  5FUE A;  3THJ A;  1P8N A;  1T5G A;  1P8R A;  1GQ7 A;  1RLA A;  3MZ4 A;  1WOH A;  4Q3P A;  3MZ3 A;  3SFF A;  4ZUP A;  3NIO A;  3GMZ A;  4QA6 A;  3SFH A;  1T4T A;  1TBL A;  4ITY A;  3MAX A;  4RLA A;  1T64 A;  1P8O A;  3PZL A;  3Q9E A;  4QA5 A;  4CQF A;  4BZ6 A;  4Q3V A;  4QA7 A;  5THT A;  4GSM A;  2PLL A;  4IU4 A;  3Q9B A;  1HQF A;  1PQ3 A;  4LY1 A;  4IU1 A;  4QA1 A;  4Q3S A;  1XFK A;  5D1C A;  1CEV A;  4CBT A;  4BKX B;  4QA4 A;  4HZE A;  3SL1 A;  3NIQ A;  5G3W A;  1T5F A;  1P8S A;  2EIV A;  3MZ7 A;  2PHA A;  4RHJ A;  5CEV A;  1T4P A;  1C3R A;  5THV A;  1ZZ3 A;  3F0R A;  5EEN A;  3EWF A;  3SL0 A;  4QA3 A;  1VKG A;  1TA1 A;  1T69 A;  4DZ4 A;  1R1O A;  3CEV A;  3Q9C A;  4GWC A;  3MFV A;  5EF7 A;  3F07 A;  3MFW A;  2CEV A;  4MXR A;  3RQD A;  1WOG A;  1P8P A;  4IE1 A;  4GWD A;  5EEI A;  3MEN A;  4ZUQ A;  2EF4 A;  4MYK A;  5DC7 A;  4MYF A;  1ZPG A;  3E6K A;  3MJL A;  4ZUM A;  5HJ9 A;  5THU A;  1C3S A;  4BZ5 A;  5JI5 A;  3EW8 A;  1ZZ1 A;  3LP4 A;  5IWG A;  3ZNS A;  3EZT A;  4GSV A;  2VQM A;  1D3V A;  4IE3 A;  3KV2 A;  5G0G A;  3MZ6 A;  5BWZ A;  3E8Z A;  5EFG A;  4Q42 A;  5G0J A;  4Q40 A;  1WVB A;  3ZNR A;  5G1A A;  5D1D A;  5EF8 A;  1P8M A;  1T67 A;  4RHI A;  5G1B A;  3M1R A;  3Q9F A;  1TBH A;  4CEV A;  5G11 A;  5DC8 A;  1GQ6 A;  4FCI A;  4GSZ A;  2VQJ A;  5G13 A;  4RN0 A;  3THE A;  3C0Y A;  3THH A;  4HWW A;  2RLA A;  4Q3R C;  4RHQ A;  5A2S A;  3MMR A;  1W22 A;  4RN1 A;  5G0H A;  5DC5 A;  2V5X A;  3C10 A;  2GH6 A;  4HXQ A;  2VQQ A;  2VQW G;  5G17 A;  3E6V A;  3NIP A;  4RHK A;  3E9B A;  2A0M A;  4Q3U A;  3LHL A;  1C3P A;  4ZUO A;  4G3H A;  5G0I A;  4QA0 A;  4CBY A;  5D1B A; 
#chains in the Genus database with same CATH homology
 3RLA A;  4IE2 A;  5RLA A;  1P8Q A;  3E8Q A;  4Q3Q A;  4IXV A;  4MYN A;  1WVA A;  1T4S A;  1TBJ A;  4IU0 A;  1T4R A;  3SJT A;  3GN0 A;  1HQG A;  4Q3T A;  4I06 A;  3TH7 A;  1WOI A;  2EF5 A;  1HQX A;  5HJA A;  3F80 A;  3DJ8 A;  2AEB A;  4Q3R A;  3TF3 A;  4FCK A;  1ZPE A;  2ZAV A;  4Q41 A;  4RHM A;  2PHO A;  4IXU A;  1HQH A;  3SKK A;  3LP7 A;  1HQ5 A;  4IU5 A;  4RHL A;  4MYL A;  3THJ A;  1P8N A;  1T5G A;  1P8R A;  1GQ7 A;  1RLA A;  4Q3P A;  1WOH A;  3NIO A;  3GMZ A;  1T4T A;  1TBL A;  4ITY A;  4RLA A;  1P8O A;  3PZL A;  4Q3V A;  4GSM A;  2PLL A;  4IU4 A;  1HQF A;  1PQ3 A;  4IU1 A;  4Q3S A;  1XFK A;  1CEV A;  4HZE A;  3SL1 A;  3NIQ A;  1T5F A;  1P8S A;  2EIV A;  2PHA A;  4RHJ A;  5CEV A;  1T4P A;  3SL0 A;  1TA1 A;  4DZ4 A;  1R1O A;  3CEV A;  4GWC A;  3MFV A;  3MFW A;  2CEV A;  4MXR A;  1WOG A;  1P8P A;  4IE1 A;  4GWD A;  2EF4 A;  4MYK A;  4MYF A;  1ZPG A;  3E6K A;  3MJL A;  5HJ9 A;  3LP4 A;  4GSV A;  1D3V A;  4IE3 A;  3KV2 A;  3E8Z A;  4Q42 A;  4Q40 A;  1WVB A;  1P8M A;  4RHI A;  3M1R A;  1TBH A;  4CEV A;  1GQ6 A;  4FCI A;  4GSZ A;  3THE A;  3THH A;  4HWW A;  2RLA A;  4Q3R C;  4RHQ A;  3MMR A;  4HXQ A;  3E6V A;  3NIP A;  4RHK A;  3E9B A;  2A0M A;  4Q3U A;  3LHL A;  4G3H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...