4FCMA

Crystal structure of the ntf2-like domain of human g3bp1 in complex with a peptide
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
132
structure length
132
Chain Sequence
b'SPLLVGREFVRQYYTLLNQAPDMLHRFYGKNSSYVHGGLDSNGKPADAVYGQKEIHRKVMSQNFTNCHTKIRHVDAHATLNDGVVVQVMGLLSNNNQALRRFMQTFVLAPEGSVANKFYVHNDIFRYQDEVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ras GTPase-activating protein-binding protein 1
publication title Crystal Structures of the Human G3BP1 NTF2-Like Domain Visualize FxFG Nup Repeat Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 34
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2012-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.450.50 Alpha Beta Roll Nuclear Transport Factor 2; Chain: A, Nuclear Transport Factor 2; Chain: A, 4fcmA00
1O7PB 4FCJA 4N3VA 3MHEA 3MG2A 2Z77A 3OWUA 4HKVB 3DUKA 3UJMA 1NU3A 1O7NB 5AIHA 2BMQB 4MJDA 3EF8A 3MG3A 7STDA 3NHXA 2HMOB 1ULJB 5DREA 3B4PA 2W2CA 3KKGA 3NM2A 3NUVA 1OGZA 3VSYA 1GYBA 5KP1A 5D81A 3HX8A 5D82A 4OVMA 1W6YA 2YFIB 3JUMA 5DRVA 3F7XA 1O7GB 1ZO2A 3F7SA 3OV4A 3IPTA 5IG4A 5IERA 4R9KA 5AIFA 3I0YA 3EN8A 3G16A 3H51A 2YFJB 4XBTA 1OH0A 1OHOA 1UUWB 5CK6A 5CXOA 5IENA 3GRDA 3E99A 3SEDA 1IDPA 2PZVA 3WMDA 2HMJB 3S5CA 3F9SA 5BXQA 4L7KA 3GZRA 4HM7B 4LGQA 2GBWB 3A76A 4HM4B 3ER7A 3KSPA 1NDOB 5D83A 1TUHA 2XRXB 4HM6B 3HZPA 2BNGA 1OUNA 2Z7AA 1W00A 4FCMA 3FZWA 1C7HA 3EX9A 1OF5B 1E3RA 2I9WA 1SJWA 2QIYA 5IG5A 4OUQA 5FW5A 1QJGA 4STDA 1S5AA 4J9AA 3SOYA 2HMNB 3ECFA 3GWRA 1JN5B 3VGNA 3BB9A 2BMRB 5IEPA 4HM5B 1EA2A 1BUQA 1VZZA 3FSDA 3OXAA 3F8XA 3JUNA 4R1KA 3CNXA 1ISKA 2GEXA 3FF2A 3ROBA 1WQLB 1O7WB 1JB2A 3LYGA 3F8HA 4HM2B 3OX9A 4K1VA 8CHOA 3T8UA 5IEOA 2B24B 1OHSA 1AR0A 2A15A 5AEUB 1TP6A 4ORLA 2XSOB 1Q40B 4R9LA 4WP5A 1Q40A 3OWYA 1JKGB 3FKAA 1K41A 4HM3B 1OPYA 1JKGA 3CPOA 1OCVA 3RGAA 3T8NA 3GZXB 4LEHA 1UUVB 2HMMB 3DZLA 2HMKB 4L8OA 5HGRA 5AEWB 3CU3A 5BVBA 1NWWA 4HM0B 2QGUA 2OWPA 4U13A 2F98A 4L8PA 3EJVA 3JUOA 1OHPA 3NBRA 3STDA 4WYKB 1A2KA 1JB4A 2B1XB 4CDLA 3B7CA 5CF2A 2GXFA 3K7CA 2GBXB 1QMAA 4HJLB 2RFRA 3B8LA 3EBYA 1CQSA 3MKIA 4Q53A 2INXA 1DMMA 5AIGA 4XDWA 5STDA 4H3UA 3DMCA 3G0KA 1W01A 5KP4A 2BMOB 3MYTA 2XR8B 3JUPA 4I4KA 1EG9B 3M8CA 4XBXA 1GS3A 5AI1A 1OF5A 1O7MB 3FLJA 3NV0B 5IG3A 1E97A 4HZBB 4X2OA 1Q42A 3EHCA 2F99A 6STDA 2STDA 3JUQA 2YFLB 1JN5A 3F14A 3FF0A 3Q90A 1E3VA 2CHCA 5TGNA 5IG0A 5CF1A 1HKXA 2F86B 3H3HA 5JPUA 4XB5A 5IF6A 1GY7A 1Z1SA 2CKFB 5AIIA 1DMNA 4PEJA 3LZAA 3KZTA 2R4IA 2JQ5A 1OGXA 1O7HB 2XSHB 2UX0A 3FGYA 2GEYA 3G8ZA 3DM8A 1DMQA 3MSOA 3EC9A 3FH1A 4WWUC 1U5OA 4WYKA 4X2HA 3F40A 1GY5A 3HK4A 3OWSA 1GY6A 2RGQA 3UNLA 1STDA 2Z76A 4GB5A 1W02A 3MG1A 3CNMA 4KVHA 5EVHA 3B4OA 3KE7A 5G2GA 4K1UA 3EQQB 4J8TA 1ZX2A 4HM1B 3D9RA 3EN1B 4IIAA 3GZYB 3RGRA 4XBYA 1ASKA 4HVNA 3DXOA 3K0ZA 2K54A 1ULIB 3NXJA 3BLZA 4HZ9B 5CLKA 2IMJA 4LMIA 4RZMA 3GZBA 2RCDA 3SOAA 4XDVA 2HMLB 4XM4A 3NV0A 5KP3A 3EBTA 1JB5A 5JPPA 4HM8B
chains in the Genus database with same CATH superfamily
1X1XA 1O7PB 2XF3A 3CCV3 4FCJA 1UCLA 5IW9A 2PNCA 2D42A 2E2TA 3S29A 3KN4A 2WGOA 5RNTA 4N3VA 1RGEA 3MHEA 3MG2A 2Z77A 3BNCA 3UL5A 4WFOA 3OWUA 3WHOA 4HKVB 3DUKA 2LQVA 3WDGB 5JBSA 4CJNA 5BIRA 1Q7HA 2BIRA 2ZA4A 3UJMA 1NU3A 1QVF2 1O7NB 1RN1A 5AIHA 3X3ZA 1VQN3 1V74A 2BMQB 1LVNA 3NBJA 3EF8A 1UGHI 4MJDA 1BSCA 1FW7A 1FUSA 3AMOA 4KFDA 2BU4A 3U1WA 3MG3A 7STDA 4LZIA 4LSOA 3LT8A 5A0OB 4IT7A 3NHXA 2HMOB 1Y4KA 3SYUA 2RBIA 1GSPA 1RGGA 1ULJB 5DREA 2KF5A 2CFGA 3B4PA 4HM8B 2P0MA 5AYRB 3ZG0A 2W2CA 3KKGA 1X1YA 3NM2A 3NUVA 1OGZA 1IVXA 4R80A 3OW22 3VSYA 1GYBA 1PU4A 5KP1A 2KAAA 5D81A 3WOFB 1LNIA 1BANA 1K28A 3WODG 1UW1A 3KIIA 4J5KA 1IVWA 3HX8A 5D82A 3PCSA 1EUIC 3LTBA 4OVMA 2P09A 5G1LA 1NO3A 4NHFA 1W6YA 2YFIB 2FXTA 3SXXA 2HOHA 3K5TA 4FMCA 1GOYA 1I0VA 3BNEA 4BL3A 3JUMA 5DRVA 3F7XA 1W7CA 1O7GB 1ZO2A 3F7SA 3FG4A 3OV4A 3UL6A 1WMOA 1N5PA 4GHOA 1BSBA 3IPTA 2W04A 5IG4A 1EQKA 3KSED 5IERA 4R9KA 1UI8A 5AIFA 1BRNL 1FA3A 1D6ZA 3AHSA 1FGQA 3I0YA 4NPBA 3EN8A 1A2VA 3CPW2 1BVIA 3G16A 3H51A 1YIT3 3D5GA 1X1WA 1DETA 2YFJB 4XBTA 1W4NA 1OH0A 4EC6A 2CK3H 1OHOA 3LOYA 1SPUA 4IPBA 3CCE3 1RGKA 1NB5I 1UUWB 5CK6A 5CXOA 3GAXA 3HOHA 1TFOA 1BRSA 3V98A 2CIUA 3RDEA 5IENA 1RGFA 3GRDA 3Q1CA 6GSPA 1FYSA 4ZM8A 3IJEB 1BRIA 1ZS7A 3E99A 4LYLB 3SEDA 1IDPA 2PZVA 3X41A 3ZG5A 2L1SA 1BIRA 2CH9A 1IV7A 3BNBA 3WMDA 3QRDA 1IT8A 2HMJB 1F8NA 2KF3A 2ML5A 2GU3A 2WOFA 4K61A 1FGRA 1CEWI 3S5CA 3F9SA 4GL6A 1VQK3 5BXQA 3LTDA 1AVKA 1BRKA 4L7KA 3HIGA 1TU5A 3GZRA 1SARA 3TDGA 4HM7B 1LOVA 4BTWA 5HOHA 1CYVA 2K0MA 4KFEA 3CC73 1GOUA 4LGQA 2KCDA 4MEIA 4MMYB 1Q814 2KXGA 3DGLA 2GBWB 3A76A 2W6JH 4FMDA 1ROAA 2J8XB 4HM4B 1LRAA 3ER7A 5ELJA 2ZDJA 1PY3A 3KSPA 4N6LA 3A5EA 2CWUA 1YNVX 1C54A 1AV4A 1NDOB 2C4BA 5D83A 1TUHA 1N5HA 2IY2A 2XRXB 4HM6B 1W5ZA 3HI7A 3LMLA 3HZPA 2W9PA 4N6TA 2BNGA 1OUNA 2Z7AA 4O3VA 1W00A 2P38A 1W2B2 1VQM3 4FR9A 2CFDA 4KT3B 1RGCA 4FCMA 1IVVA 3K9MC 4EW5A 3FZWA 4N6UA 3X3XA 3G4S3 1I70A 1I0XA 3G713 1LQMB 3U97A 1C7HA 3EX9A 1OF5B 1TFKA 1JBRA 1BNSA 3PXMA 1NB3I 1KC84 1E3RA 2I9WA 4OK0A 3ALAA 1I3FA 1SJWA 1UI7A 2E2UA 1IQXA 2QIYA 3D79A 1G0TA 5IG5A 8RNTA 4OUQA 5FW5A 1QJGA 3PYJA 4STDA 1S5AA 4J9AA 3SOYA 5AYSC 1RNBA 2UGIA 2ZHXB 3AHWA 2HMNB 3ECFA 4I5QA 4R4KA 3GWRA 1JN5B 2W03A 2K3DA 3BB9A 3VGNA 1JBSA 3NBBA 1PYLA 1YJW3 2BMRB 1JZDA 1RMSA 5IEPA 4HM5B 1EA2A 1UUGB 1VZZA 1BUQA 3CCQ3 3FSDA 3SX1A 3OXAA 1DYUA 3F8XA 1VQ43 2ML6A 3JUNA 2SBLA 3FCSB 4R1KA 4FMBA 3CNXA 1ISKA 5LC7A 3CXC2 1M1XB 3SLUA 5FGOA 1I2FA 2XGLA 3UB1A 2W0QA 1YHQ3 1D6UA 2GEXA 2WOHA 1RN7A 1JZOA 1T2IA 3LTCA 1BRHA 2CFLA 3FF2A 3LH4A 3ROBA 5LC6A 3LXUX 1WQLB 1YGEA 1O7WB 1EEJA 1JB2A 4KZ1A 1LOYA 3LYGA 1TRPA 3F8HA 2W56B 3NM7A 4HM2B 2LYXA 1L5GB 3OX9A 3T0UA 4K1VA 2CX0A 1AVLA 2ZL8A 5EQLA 5IEOA 2B24B 3T8UA 8CHOA 1OHSA 4N6V0 1GMRA 2BT3A 1AR0A 2A15A 5AEUB 1IU7A 1MNLA 1TP6A 3X40A 1BOXA 4EV2A 4ORLA 3PS8A 2XSOB 4EXRA 4EV5A 1Q40B 2CWTA 4R9LA 4RNZA 4WP5A 1JV2B 1RRHA 1VQP3 3CC23 1RNTA 3CMA3 1Q40A 3K63A 3WR2A 3OWYA 2IUJA 1JKGB 3FKAA 5GSPA 2QA43 2JDIH 1K41A 4HM3B 1OPYA 1W2ZA 1B2SA 2KRTA 2O9UX 3LT9A 4BU4A 1JKGA 3CPOA 1OCVA 3RGAA 1FGOA 2MC8A 3T8NA 3GZXB 4CCVA 4LEHA 2OTL3 2Q07A 1A90A 4FCZA 2GSPA 1V58A 1UUVB 2HMMB 4G1MB 4RBNA 2F56A 3DZLA 2HMKB 1VQQA 4L8OA 5HGRA 3CU3A 5AEWB 5BVBA 1NWWA 2H0HA 4HM0B 1RCLA 2QGUA 2OWPA 4MMZB 1NNVA 2F98A 1RSNA 4U13A 2CWVA 2WGQA 1B20A 1HYFA 1YVSA 3EJVA 1WTHA 4L8PA 2P0XA 1RCKA 1OHPA 3D4AA 3JUOA 3NBRA 4WYKB 1IVUA 3STDA 1CYUA 1A2KA 2D1WA 1RGHA 1JB4A 3QK9A 1G02A 1UCKA 2CX1A 2Y74A 3N54B 4K90B 2B1XB 4N6MA 1FZUA 1GD4A 4ILFA 4CDLA 3B7CA 3KCHA 5CF2A 7GSPA 1VQO3 1MWUA 1QAKA 2H0GA 1W6CA 2OQEC 2Z6BA 1VQ73 2GXFA 3CCR3 1K8A4 3K7CA 2OOVA 2OCTA 2WO0A 2GBXB 2XH9A 1ZGXA 1QMAA 2RNTA 4HJLB 1VQ93 2RFRA 1I2GA 1MGRA 1N9EA 3B8LA 3EB8A 4BL2A 3EBYA 1CQSA 1B2UA 1AY7A 1WNHA 3S28A 3MKIA 3G6E3 1FUWA 4Q53A 5M1AA 2INXA 3CME3 1M1K4 1JRQA 3EE1A 1DMMA 2H0IA 2YX9A 2IUKA 5AIGA 4XDWA 2F4YA 4H3UA 1LNHA 5STDA 3DMCA 4MMXB 3CCM3 2XGNA 1R4YA 3G0KA 1W01A 5KP4A 1I2EA 2AADA 5G1KA 2BMOB 3MYTA 1UGIA 2FNQA 1YGWA 2Y73A 1US1A 2XR8B 2F5WA 1CH0A 1JJ22 1LQGC 3JUPA 1IK3A 1GOVA 3RNTA 1IT7A 2M7OA 1GD3A 4I4KA 1YVBI 3DH2A 1EG9B 3WA2X 3M8CA 4XBXA 1FGTA 1RTUA 1GS3A 5AI1A 4NREA 1RKYA 3N9HA 1BU4A 1T3BA 1TTOA 1TRQA 1OF5A 1YIJ3 1O7MB 3DY5A 3FLJA 3NV0B 5BU4A 5IG3A 1IQ8A 1E97A 4HZBB 1FGMA 2O3OA 3D5IA 4FMAA 1KSIA 1X1UA 4X2OA 4WHAA 9RNTA 3V92A 1Q824 1K734 1FUTA 1QALA 2P05A 3Q3FA 3I553 3X42A 1W6GA 1Q42A 3L0RA 3EHCA 2F99A 6STDA 2F5MA 2STDA 3JUQA 2YFLB 1B21A 2UUGC 1JN5A 2CW9A 3F14A 1U8CB 3PZWA 1ROVA 4J5GA 1VQL3 2MF7A 3FG3A 3HIIA 3FF0A 3Q90A 1E3VA 1WMPA 2BO9B 2CHCA 3DGOA 4TX4A 5TGNA 1MWRA 1RGLA 2OTJ3 4BIRA 4HOHA 2QEX3 1UCIA 5IG0A 1RHLA 5CF1A 1HKXA 2L4VA 1QAFA 1I8VA 2F86B 3H3HA 1MWTA 1BNIA 2IYJA 4N6OB 5JPUA 4XB5A 3AMOB 3V99A 2FGTA 4EYCA 7RNTA 3WOEB 5IF6A 1RLSA 1GY7A 1MGWA 1Z1SA 1S723 1IQYA 5EEOA 3BNDA 1B2MA 2CKFB 2C11A 5AIIA 4BTYA 3CCS3 2IA7A 2W56A 1DMNA 4JRFA 3NQYA 4RNYA 1DE3A 2CG0A 5M19A 1BSEA 1UDII 4PEJA 3N8BA 1YI23 4HBRA 3LZAA 3KZTA 3MWZA 4AKZA 4BTXA 4GSPA 2R4IA 2JQ5A 3X3YA 1OGXA 1BSDA 1O7HB 2XSHB 5M18A 3J7Yd 2UX0A 2KF4A 1HU9A 1VQ83 1LXEA 1EKMA 3FGYA 4DKIA 2CFKA 1Q864 3Q2PA 3S27A 2V1LA 1RDSA 1SIHA 2GEYA 2OQEA 1N9JA 3G8ZA 3DM8A 1TIJA 1B3SA 1T5YA 1M904 1VQ53 3NX0A 3VF1A 2R41A 1STFI 2XFTA 1DMQA 1B2ZA 3MSOA 3SVAA 5I97A 1Q9EA 1NJI4 1I3IA 3DGNA 5ELUA 1BNFA 1B27A 1G96A 3CD63 3EC9A 3CCL3 1QVG2 1BNEA 3S67A 3FH1A 1LOWA 4WWUC 1M9GA 1U5OA 4WYKA 3BU4A 4QWTA 4X2HA 3F40A 1JBTA 3NQZA 4HAAA 2GU1A 2CFWA 2SARA 1GY5A 1T2HA 3HK4A 3OWSA 1GY6A 2RGQA 1GMQA 3DGYA 3UNLA 4RNTA 1AQZA 1STDA 1A67A 1MOLA 3JVCA 1RN4A 2Z76A 1K9M4 1DVDA 1BNGA 1RJOA 3AGOA 4GB5A 4O02B 4O2HA 3PGBA 2KF6A 3IMAB 1W02A 3MG1A 1V57A 3CNMA 4KVHA 5EVHA 3ZFZA 2XEPA 1YJN3 3B4OA 3KE7A 5G2GA 1OACA 3AGNA 4K1UA 3DGMA 3O8YA 4H61A 1BNJA 6RNTA 3EQQB 4J8TA 1GMPA 1ZX2A 4AEQA 1D6YA 4HM1B 1DVCA 1BSAA 1R4CA 1UCJA 1N8QA 3D9RA 3I563 4JF8A 3EN1B 3FG1A 4IIAA 1J2BA 3GZYB 4CPKA 1BNRA 3GSPA 3RGRA 1IV9A 1ASKA 3KFQC 4HVNA 2AAEA 4XBYA 3DXOA 1Q7Y4 1B2XA 1A2PA 1BRGA 3K0ZA 2K54A 1N8R4 1ULIB 4EBGA 3NXJA 1WMNA 3BLZA 1PFPA 1KD14 4HZ9B 5CLKA 2IMJA 4LMIA 3PCRA 1TJDA 2BHMA 4O8SA 4AKYA 4RZMA 3GZBA 1BAOA 4N6NB 2RCDA 4KFFA 2C10A 3URPA 3D3LA 3SOAA 1BUJA 3CC43 2CC3A 3WA3A 1IYYA 1SIIA 1HZ1A 1JNQA 4XDVA 2HMLB 4HYZA 1VQ63 2RSXA 1YJ93 3CCJ3 1BRJA 4XM4A 1KWIA 2XFSA 1BGSA 2OOVC 3NV0A 2E2VA 1MWSA 3BIRA 5KP3A 1RRLA 3EBTA 2W9QA 3LTAA 1LOXA 1JB5A 1RGAA 3MPHA 3CCU3 1KQS2 2CG1A 5JPPA 1SQWA
chains in the Genus database with same CATH topology
1O7PB 2XF3A 3CCV3 4FCJA 2PNCA 2D42A 2E2TA 3S29A 3KN4A 2WGOA 4N3VA 3MHEA 3MG2A 2Z77A 3BNCA 3UL5A 4WFOA 3OWUA 4HKVB 3DUKA 2LQVA 3WDGB 5JBSA 3UJMA 1NU3A 1QVF2 1O7NB 1VQN3 5AIHA 3X3ZA 1V74A 2BMQB 1LVNA 3NBJA 3EF8A 4MJDA 3AMOA 4KFDA 3U1WA 3MG3A 7STDA 4LZIA 4LSOA 3LT8A 5A0OB 4IT7A 3NHXA 2HMOB 1Y4KA 1ULJB 5DREA 2CFGA 3B4PA 4HM8B 2P0MA 5AYRB 2W2CA 3KKGA 3NM2A 3NUVA 1OGZA 1IVXA 4R80A 3OW22 3VSYA 1GYBA 1PU4A 5KP1A 5D81A 3WOFB 3WODG 1K28A 1UW1A 3KIIA 1IVWA 3HX8A 5D82A 3PCSA 3LTBA 4OVMA 2P09A 1NO3A 4NHFA 1W6YA 2YFIB 2FXTA 3SXXA 3K5TA 4FMCA 3BNEA 3JUMA 5DRVA 3F7XA 1W7CA 1O7GB 1ZO2A 3F7SA 3FG4A 3OV4A 3UL6A 1WMOA 1N5PA 3IPTA 2W04A 5IG4A 1EQKA 3KSED 5IERA 4R9KA 1UI8A 5AIFA 1FA3A 1D6ZA 3I0YA 1FGQA 3EN8A 1A2VA 3CPW2 3G16A 3H51A 1YIT3 2YFJB 4XBTA 1W4NA 1OH0A 4EC6A 2CK3H 1OHOA 3LOYA 1SPUA 4IPBA 3CCE3 1NB5I 1UUWB 5CK6A 5CXOA 3GAXA 1TFOA 3V98A 2CIUA 3RDEA 5IENA 3GRDA 3Q1CA 4ZM8A 3IJEB 3E99A 3SEDA 1IDPA 2PZVA 3X41A 2CH9A 1IV7A 3BNBA 3WMDA 3QRDA 1IT8A 2HMJB 1F8NA 2ML5A 2WOFA 2GU3A 4K61A 3S5CA 1FGRA 1CEWI 3F9SA 4GL6A 1VQK3 5BXQA 3LTDA 1AVKA 4L7KA 3HIGA 1TU5A 3GZRA 3TDGA 4HM7B 4BTWA 3CC73 1CYVA 2K0MA 4KFEA 4LGQA 2KCDA 4MEIA 4MMYB 1Q814 2KXGA 3DGLA 2GBWB 3A76A 2W6JH 4FMDA 1ROAA 4HM4B 3ER7A 5ELJA 2ZDJA 3KSPA 4N6LA 2CWUA 1AV4A 1NDOB 5D83A 1TUHA 1N5HA 2XRXB 4HM6B 1W5ZA 3HI7A 3LMLA 3HZPA 2W9PA 4N6TA 2BNGA 1OUNA 2Z7AA 4O3VA 1W00A 2P38A 1W2B2 1VQM3 4FR9A 2CFDA 4FCMA 1IVVA 3K9MC 3FZWA 4N6UA 3X3XA 3G4S3 3G713 3U97A 1C7HA 3EX9A 1OF5B 1TFKA 3PXMA 1NB3I 1KC84 1E3RA 2I9WA 4OK0A 3ALAA 1SJWA 1UI7A 2E2UA 1IQXA 2QIYA 5IG5A 4OUQA 5FW5A 1QJGA 3PYJA 4STDA 1S5AA 4J9AA 3SOYA 5AYSC 2HMNB 3ECFA 4R4KA 3GWRA 1JN5B 2W03A 3VGNA 3BB9A 3NBBA 1YJW3 2BMRB 5IEPA 4HM5B 1EA2A 1BUQA 1VZZA 3CCQ3 3FSDA 3SX1A 3OXAA 1DYUA 3F8XA 1VQ43 2ML6A 3JUNA 2SBLA 3FCSB 4R1KA 4FMBA 3CNXA 1ISKA 5LC7A 3CXC2 1M1XB 3SLUA 5FGOA 2XGLA 3UB1A 2W0QA 1YHQ3 1D6UA 2GEXA 2WOHA 1RN7A 3LTCA 2CFLA 3FF2A 3LH4A 3ROBA 5LC6A 3LXUX 1WQLB 1YGEA 1O7WB 4KZ1A 1JB2A 3LYGA 3F8HA 2W56B 3NM7A 4HM2B 2LYXA 1L5GB 3OX9A 3T0UA 4K1VA 2ZL8A 1AVLA 5EQLA 5IEOA 2B24B 3T8UA 8CHOA 1OHSA 4N6V0 2BT3A 1AR0A 2A15A 5AEUB 1IU7A 1MNLA 1TP6A 3X40A 4EV2A 4ORLA 3PS8A 2XSOB 4EXRA 4EV5A 1Q40B 2CWTA 4R9LA 4RNZA 4WP5A 1JV2B 1RRHA 1VQP3 3CC23 3CMA3 1Q40A 3K63A 3OWYA 2IUJA 1JKGB 3FKAA 2QA43 2JDIH 1K41A 4HM3B 1OPYA 1W2ZA 2KRTA 2O9UX 3LT9A 1JKGA 3CPOA 1OCVA 3RGAA 1FGOA 2MC8A 3T8NA 3GZXB 4CCVA 4LEHA 2OTL3 2Q07A 1A90A 4FCZA 1UUVB 2HMMB 4G1MB 4RBNA 3DZLA 2HMKB 4L8OA 5HGRA 5AEWB 3CU3A 5BVBA 1NWWA 4HM0B 2QGUA 2OWPA 4MMZB 4U13A 2F98A 2CWVA 2WGQA 4L8PA 3EJVA 1WTHA 2P0XA 3JUOA 1OHPA 3NBRA 3STDA 4WYKB 1IVUA 1CYUA 1A2KA 2D1WA 1JB4A 3QK9A 4K90B 2Y74A 3N54B 2B1XB 4N6MA 1GD4A 4CDLA 3B7CA 5CF2A 1VQO3 1QAKA 1W6CA 2OQEC 2Z6BA 1VQ73 2GXFA 3CCR3 1K8A4 3K7CA 2OOVA 2OCTA 2WO0A 2GBXB 2XH9A 1QMAA 4HJLB 1VQ93 2RFRA 1N9EA 3B8LA 3EB8A 3EBYA 1CQSA 1WNHA 3S28A 3MKIA 1FUWA 4Q53A 2INXA 3CME3 1M1K4 1JRQA 3EE1A 1DMMA 2YX9A 2IUKA 5AIGA 4XDWA 5STDA 4H3UA 1LNHA 3DMCA 4MMXB 3CCM3 2XGNA 3G0KA 1W01A 5KP4A 2BMOB 3MYTA 2FNQA 2Y73A 1US1A 2XR8B 1JJ22 1IK3A 3JUPA 1IT7A 2M7OA 1GD3A 4I4KA 1YVBI 3WA2X 1EG9B 3M8CA 4XBXA 1FGTA 1GS3A 5AI1A 4NREA 1RKYA 3N9HA 1OF5A 1YIJ3 1O7MB 3DY5A 3FLJA 3NV0B 5IG3A 1IQ8A 1E97A 4HZBB 1FGMA 2O3OA 4FMAA 4WHAA 1KSIA 4X2OA 3G6E3 1Q824 3V92A 1K734 1QALA 2P05A 3I553 3X42A 1W6GA 1Q42A 3L0RA 3EHCA 2F99A 6STDA 2STDA 3JUQA 2YFLB 1JN5A 2CW9A 3F14A 1U8CB 3PZWA 1ROVA 1VQL3 2MF7A 3FG3A 3HIIA 3FF0A 3Q90A 1E3VA 1WMPA 2BO9B 2CHCA 3DGOA 4TX4A 5TGNA 2OTJ3 2QEX3 5IG0A 5CF1A 1HKXA 2L4VA 1QAFA 2F86B 3H3HA 4N6OB 5JPUA 4XB5A 3AMOB 3V99A 2FGTA 4EYCA 5IF6A 3WOEB 1GY7A 1Z1SA 1S723 1IQYA 5EEOA 3BNDA 2CKFB 2C11A 5AIIA 4BTYA 3CCS3 2IA7A 2W56A 1DMNA 4JRFA 3NQYA 4RNYA 2CG0A 4PEJA 3N8BA 1YI23 4HBRA 3LZAA 3KZTA 3MWZA 4AKZA 4BTXA 2R4IA 2JQ5A 3X3YA 1OGXA 1O7HB 2XSHB 3J7Yd 1VQ83 2UX0A 1HU9A 1LXEA 1EKMA 3FGYA 2CFKA 1Q864 3Q2PA 3S27A 2V1LA 1SIHA 2GEYA 2OQEA 1N9JA 3G8ZA 3DM8A 1TIJA 1T5YA 1M904 1VQ53 3NX0A 3VF1A 1STFI 2XFTA 1DMQA 3MSOA 5I97A 3SVAA 1NJI4 3DGNA 5ELUA 1G96A 3CD63 3EC9A 3CCL3 1QVG2 3S67A 3FH1A 4WWUC 1M9GA 1U5OA 4WYKA 4QWTA 4X2HA 3F40A 3NQZA 2GU1A 2CFWA 1GY5A 3HK4A 3OWSA 1GY6A 2RGQA 3UNLA 1A67A 1STDA 1MOLA 3JVCA 1K9M4 2Z76A 1DVDA 1RJOA 4GB5A 4O02B 4O2HA 3PGBA 3IMAB 1W02A 3MG1A 3CNMA 4KVHA 5EVHA 2XEPA 1YJN3 3B4OA 3KE7A 5G2GA 1OACA 4K1UA 3DGMA 3O8YA 4H61A 3EQQB 4J8TA 5IW9A 1ZX2A 4AEQA 1D6YA 4HM1B 1DVCA 1R4CA 1N8QA 3D9RA 3I563 4JF8A 3EN1B 3FG1A 4IIAA 1J2BA 3GZYB 3RGRA 1IV9A 1ASKA 3KFQC 4HVNA 4XBYA 1Q7Y4 3DXOA 3K0ZA 2K54A 1N8R4 1ULIB 4EBGA 3NXJA 1WMNA 3BLZA 1PFPA 1KD14 4HZ9B 5CLKA 2IMJA 4LMIA 3PCRA 2BHMA 4O8SA 4AKYA 4RZMA 3GZBA 4N6NB 2RCDA 4KFFA 2C10A 3D3LA 3SOAA 3CC43 2CC3A 3WA3A 1SIIA 4XDVA 1JNQA 2HMLB 4HYZA 1VQ63 2RSXA 1YJ93 3CCJ3 4XM4A 1KWIA 2XFSA 2OOVC 3NV0A 2E2VA 5KP3A 1RRLA 3EBTA 2W9QA 3LTAA 1LOXA 1JB5A 3MPHA 3CCU3 1KQS2 2CG1A 5JPPA 1SQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O7P B;  4FCJ A;  4N3V A;  3MHE A;  3MG2 A;  2Z77 A;  3OWU A;  4HKV B;  3DUK A;  3UJM A;  1NU3 A;  1O7N B;  5AIH A;  2BMQ B;  4MJD A;  3EF8 A;  3MG3 A;  7STD A;  3NHX A;  2HMO B;  1ULJ B;  5DRE A;  3B4P A;  2W2C A;  3KKG A;  3NM2 A;  3NUV A;  1OGZ A;  3VSY A;  1GYB A;  5KP1 A;  5D81 A;  3HX8 A;  5D82 A;  4OVM A;  1W6Y A;  2YFI B;  3JUM A;  5DRV A;  3F7X A;  1O7G B;  1ZO2 A;  3F7S A;  3OV4 A;  3IPT A;  5IG4 A;  5IER A;  4R9K A;  5AIF A;  3I0Y A;  3EN8 A;  3G16 A;  3H51 A;  2YFJ B;  4XBT A;  1OH0 A;  1OHO A;  1UUW B;  5CK6 A;  5CXO A;  5IEN A;  3GRD A;  3E99 A;  3SED A;  1IDP A;  2PZV A;  3WMD A;  2HMJ B;  3S5C A;  3F9S A;  5BXQ A;  4L7K A;  3GZR A;  4HM7 B;  4LGQ A;  2GBW B;  3A76 A;  4HM4 B;  3ER7 A;  3KSP A;  1NDO B;  5D83 A;  1TUH A;  2XRX B;  4HM6 B;  3HZP A;  2BNG A;  1OUN A;  2Z7A A;  1W00 A;  4FCM A;  3FZW A;  1C7H A;  3EX9 A;  1OF5 B;  1E3R A;  2I9W A;  1SJW A;  2QIY A;  5IG5 A;  4OUQ A;  5FW5 A;  1QJG A;  4STD A;  1S5A A;  4J9A A;  3SOY A;  2HMN B;  3ECF A;  3GWR A;  1JN5 B;  3VGN A;  3BB9 A;  2BMR B;  5IEP A;  4HM5 B;  1EA2 A;  1BUQ A;  1VZZ A;  3FSD A;  3OXA A;  3F8X A;  3JUN A;  4R1K A;  3CNX A;  1ISK A;  2GEX A;  3FF2 A;  3ROB A;  1WQL B;  1O7W B;  1JB2 A;  3LYG A;  3F8H A;  4HM2 B;  3OX9 A;  4K1V A;  8CHO A;  3T8U A;  5IEO A;  2B24 B;  1OHS A;  1AR0 A;  2A15 A;  5AEU B;  1TP6 A;  4ORL A;  2XSO B;  1Q40 B;  4R9L A;  4WP5 A;  1Q40 A;  3OWY A;  1JKG B;  3FKA A;  1K41 A;  4HM3 B;  1OPY A;  1JKG A;  3CPO A;  1OCV A;  3RGA A;  3T8N A;  3GZX B;  4LEH A;  1UUV B;  2HMM B;  3DZL A;  2HMK B;  4L8O A;  5HGR A;  5AEW B;  3CU3 A;  5BVB A;  1NWW A;  4HM0 B;  2QGU A;  2OWP A;  4U13 A;  2F98 A;  4L8P A;  3EJV A;  3JUO A;  1OHP A;  3NBR A;  3STD A;  4WYK B;  1A2K A;  1JB4 A;  2B1X B;  4CDL A;  3B7C A;  5CF2 A;  2GXF A;  3K7C A;  2GBX B;  1QMA A;  4HJL B;  2RFR A;  3B8L A;  3EBY A;  1CQS A;  3MKI A;  4Q53 A;  2INX A;  1DMM A;  5AIG A;  4XDW A;  5STD A;  4H3U A;  3DMC A;  3G0K A;  1W01 A;  5KP4 A;  2BMO B;  3MYT A;  2XR8 B;  3JUP A;  4I4K A;  1EG9 B;  3M8C A;  4XBX A;  1GS3 A;  5AI1 A;  1OF5 A;  1O7M B;  3FLJ A;  3NV0 B;  5IG3 A;  1E97 A;  4HZB B;  4X2O A;  1Q42 A;  3EHC A;  2F99 A;  6STD A;  2STD A;  3JUQ A;  2YFL B;  1JN5 A;  3F14 A;  3FF0 A;  3Q90 A;  1E3V A;  2CHC A;  5TGN A;  5IG0 A;  5CF1 A;  1HKX A;  2F86 B;  3H3H A;  5JPU A;  4XB5 A;  5IF6 A;  1GY7 A;  1Z1S A;  2CKF B;  5AII A;  1DMN A;  4PEJ A;  3LZA A;  3KZT A;  2R4I A;  2JQ5 A;  1OGX A;  1O7H B;  2XSH B;  2UX0 A;  3FGY A;  2GEY A;  3G8Z A;  3DM8 A;  1DMQ A;  3MSO A;  3EC9 A;  3FH1 A;  4WWU C;  1U5O A;  4WYK A;  4X2H A;  3F40 A;  1GY5 A;  3HK4 A;  3OWS A;  1GY6 A;  2RGQ A;  3UNL A;  1STD A;  2Z76 A;  4GB5 A;  1W02 A;  3MG1 A;  3CNM A;  4KVH A;  5EVH A;  3B4O A;  3KE7 A;  5G2G A;  4K1U A;  3EQQ B;  4J8T A;  1ZX2 A;  4HM1 B;  3D9R A;  3EN1 B;  4IIA A;  3GZY B;  3RGR A;  4XBY A;  1ASK A;  4HVN A;  3DXO A;  3K0Z A;  2K54 A;  1ULI B;  3NXJ A;  3BLZ A;  4HZ9 B;  5CLK A;  2IMJ A;  4LMI A;  4RZM A;  3GZB A;  2RCD A;  3SOA A;  4XDV A;  2HML B;  4XM4 A;  3NV0 A;  5KP3 A;  3EBT A;  1JB5 A;  5JPP A;  4HM8 B; 
#chains in the Genus database with same CATH topology
 1X1X A;  1O7P B;  2XF3 A;  3CCV 3;  4FCJ A;  1UCL A;  5IW9 A;  2PNC A;  2D42 A;  2E2T A;  3S29 A;  3KN4 A;  2WGO A;  5RNT A;  4N3V A;  1RGE A;  3MHE A;  3MG2 A;  2Z77 A;  3BNC A;  3UL5 A;  4WFO A;  3OWU A;  3WHO A;  4HKV B;  3DUK A;  2LQV A;  3WDG B;  5JBS A;  4CJN A;  5BIR A;  1Q7H A;  2BIR A;  2ZA4 A;  3UJM A;  1NU3 A;  1QVF 2;  1O7N B;  1RN1 A;  5AIH A;  3X3Z A;  1VQN 3;  1V74 A;  2BMQ B;  1LVN A;  3NBJ A;  3EF8 A;  1UGH I;  4MJD A;  1BSC A;  1FW7 A;  1FUS A;  3AMO A;  4KFD A;  2BU4 A;  3U1W A;  3MG3 A;  7STD A;  4LZI A;  4LSO A;  3LT8 A;  5A0O B;  4IT7 A;  3NHX A;  2HMO B;  1Y4K A;  3SYU A;  2RBI A;  1GSP A;  1RGG A;  1ULJ B;  5DRE A;  2KF5 A;  2CFG A;  3B4P A;  4HM8 B;  2P0M A;  5AYR B;  3ZG0 A;  2W2C A;  3KKG A;  1X1Y A;  3NM2 A;  3NUV A;  1OGZ A;  1IVX A;  4R80 A;  3OW2 2;  3VSY A;  1GYB A;  1PU4 A;  5KP1 A;  2KAA A;  5D81 A;  3WOF B;  1LNI A;  1BAN A;  1K28 A;  3WOD G;  1UW1 A;  3KII A;  4J5K A;  1IVW A;  3HX8 A;  5D82 A;  3PCS A;  1EUI C;  3LTB A;  4OVM A;  2P09 A;  5G1L A;  1NO3 A;  4NHF A;  1W6Y A;  2YFI B;  2FXT A;  3SXX A;  2HOH A;  3K5T A;  4FMC A;  1GOY A;  1I0V A;  3BNE A;  4BL3 A;  3JUM A;  5DRV A;  3F7X A;  1W7C A;  1O7G B;  1ZO2 A;  3F7S A;  3FG4 A;  3OV4 A;  3UL6 A;  1WMO A;  1N5P A;  4GHO A;  1BSB A;  3IPT A;  2W04 A;  5IG4 A;  1EQK A;  3KSE D;  5IER A;  4R9K A;  1UI8 A;  5AIF A;  1BRN L;  1FA3 A;  1D6Z A;  3AHS A;  1FGQ A;  3I0Y A;  4NPB A;  3EN8 A;  1A2V A;  3CPW 2;  1BVI A;  3G16 A;  3H51 A;  1YIT 3;  3D5G A;  1X1W A;  1DET A;  2YFJ B;  4XBT A;  1W4N A;  1OH0 A;  4EC6 A;  2CK3 H;  1OHO A;  3LOY A;  1SPU A;  4IPB A;  3CCE 3;  1RGK A;  1NB5 I;  1UUW B;  5CK6 A;  5CXO A;  3GAX A;  3HOH A;  1TFO A;  1BRS A;  3V98 A;  2CIU A;  3RDE A;  5IEN A;  1RGF A;  3GRD A;  3Q1C A;  6GSP A;  1FYS A;  4ZM8 A;  3IJE B;  1BRI A;  1ZS7 A;  3E99 A;  4LYL B;  3SED A;  1IDP A;  2PZV A;  3X41 A;  3ZG5 A;  2L1S A;  1BIR A;  2CH9 A;  1IV7 A;  3BNB A;  3WMD A;  3QRD A;  1IT8 A;  2HMJ B;  1F8N A;  2KF3 A;  2ML5 A;  2GU3 A;  2WOF A;  4K61 A;  1FGR A;  1CEW I;  3S5C A;  3F9S A;  4GL6 A;  1VQK 3;  5BXQ A;  3LTD A;  1AVK A;  1BRK A;  4L7K A;  3HIG A;  1TU5 A;  3GZR A;  1SAR A;  3TDG A;  4HM7 B;  1LOV A;  4BTW A;  5HOH A;  1CYV A;  2K0M A;  4KFE A;  3CC7 3;  1GOU A;  4LGQ A;  2KCD A;  4MEI A;  4MMY B;  1Q81 4;  2KXG A;  3DGL A;  2GBW B;  3A76 A;  2W6J H;  4FMD A;  1ROA A;  2J8X B;  4HM4 B;  1LRA A;  3ER7 A;  5ELJ A;  2ZDJ A;  1PY3 A;  3KSP A;  4N6L A;  3A5E A;  2CWU A;  1YNV X;  1C54 A;  1AV4 A;  1NDO B;  2C4B A;  5D83 A;  1TUH A;  1N5H A;  2IY2 A;  2XRX B;  4HM6 B;  1W5Z A;  3HI7 A;  3LML A;  3HZP A;  2W9P A;  4N6T A;  2BNG A;  1OUN A;  2Z7A A;  4O3V A;  1W00 A;  2P38 A;  1W2B 2;  1VQM 3;  4FR9 A;  2CFD A;  4KT3 B;  1RGC A;  4FCM A;  1IVV A;  3K9M C;  4EW5 A;  3FZW A;  4N6U A;  3X3X A;  3G4S 3;  1I70 A;  1I0X A;  3G71 3;  1LQM B;  3U97 A;  1C7H A;  3EX9 A;  1OF5 B;  1TFK A;  1JBR A;  1BNS A;  3PXM A;  1NB3 I;  1KC8 4;  1E3R A;  2I9W A;  4OK0 A;  3ALA A;  1I3F A;  1SJW A;  1UI7 A;  2E2U A;  1IQX A;  2QIY A;  3D79 A;  1G0T A;  5IG5 A;  8RNT A;  4OUQ A;  5FW5 A;  1QJG A;  3PYJ A;  4STD A;  1S5A A;  4J9A A;  3SOY A;  5AYS C;  1RNB A;  2UGI A;  2ZHX B;  3AHW A;  2HMN B;  3ECF A;  4I5Q A;  4R4K A;  3GWR A;  1JN5 B;  2W03 A;  2K3D A;  3BB9 A;  3VGN A;  1JBS A;  3NBB A;  1PYL A;  1YJW 3;  2BMR B;  1JZD A;  1RMS A;  5IEP A;  4HM5 B;  1EA2 A;  1UUG B;  1VZZ A;  1BUQ A;  3CCQ 3;  3FSD A;  3SX1 A;  3OXA A;  1DYU A;  3F8X A;  1VQ4 3;  2ML6 A;  3JUN A;  2SBL A;  3FCS B;  4R1K A;  4FMB A;  3CNX A;  1ISK A;  5LC7 A;  3CXC 2;  1M1X B;  3SLU A;  5FGO A;  1I2F A;  2XGL A;  3UB1 A;  2W0Q A;  1YHQ 3;  1D6U A;  2GEX A;  2WOH A;  1RN7 A;  1JZO A;  1T2I A;  3LTC A;  1BRH A;  2CFL A;  3FF2 A;  3LH4 A;  3ROB A;  5LC6 A;  3LXU X;  1WQL B;  1YGE A;  1O7W B;  1EEJ A;  1JB2 A;  4KZ1 A;  1LOY A;  3LYG A;  1TRP A;  3F8H A;  2W56 B;  3NM7 A;  4HM2 B;  2LYX A;  1L5G B;  3OX9 A;  3T0U A;  4K1V A;  2CX0 A;  1AVL A;  2ZL8 A;  5EQL A;  5IEO A;  2B24 B;  3T8U A;  8CHO A;  1OHS A;  4N6V 0;  1GMR A;  2BT3 A;  1AR0 A;  2A15 A;  5AEU B;  1IU7 A;  1MNL A;  1TP6 A;  3X40 A;  1BOX A;  4EV2 A;  4ORL A;  3PS8 A;  2XSO B;  4EXR A;  4EV5 A;  1Q40 B;  2CWT A;  4R9L A;  4RNZ A;  4WP5 A;  1JV2 B;  1RRH A;  1VQP 3;  3CC2 3;  1RNT A;  3CMA 3;  1Q40 A;  3K63 A;  3WR2 A;  3OWY A;  2IUJ A;  1JKG B;  3FKA A;  5GSP A;  2QA4 3;  2JDI H;  1K41 A;  4HM3 B;  1OPY A;  1W2Z A;  1B2S A;  2KRT A;  2O9U X;  3LT9 A;  4BU4 A;  1JKG A;  3CPO A;  1OCV A;  3RGA A;  1FGO A;  2MC8 A;  3T8N A;  3GZX B;  4CCV A;  4LEH A;  2OTL 3;  2Q07 A;  1A90 A;  4FCZ A;  2GSP A;  1V58 A;  1UUV B;  2HMM B;  4G1M B;  4RBN A;  2F56 A;  3DZL A;  2HMK B;  1VQQ A;  4L8O A;  5HGR A;  3CU3 A;  5AEW B;  5BVB A;  1NWW A;  2H0H A;  4HM0 B;  1RCL A;  2QGU A;  2OWP A;  4MMZ B;  1NNV A;  2F98 A;  1RSN A;  4U13 A;  2CWV A;  2WGQ A;  1B20 A;  1HYF A;  1YVS A;  3EJV A;  1WTH A;  4L8P A;  2P0X A;  1RCK A;  1OHP A;  3D4A A;  3JUO A;  3NBR A;  4WYK B;  1IVU A;  3STD A;  1CYU A;  1A2K A;  2D1W A;  1RGH A;  1JB4 A;  3QK9 A;  1G02 A;  1UCK A;  2CX1 A;  2Y74 A;  3N54 B;  4K90 B;  2B1X B;  4N6M A;  1FZU A;  1GD4 A;  4ILF A;  4CDL A;  3B7C A;  3KCH A;  5CF2 A;  7GSP A;  1VQO 3;  1MWU A;  1QAK A;  2H0G A;  1W6C A;  2OQE C;  2Z6B A;  1VQ7 3;  2GXF A;  3CCR 3;  1K8A 4;  3K7C A;  2OOV A;  2OCT A;  2WO0 A;  2GBX B;  2XH9 A;  1ZGX A;  1QMA A;  2RNT A;  4HJL B;  1VQ9 3;  2RFR A;  1I2G A;  1MGR A;  1N9E A;  3B8L A;  3EB8 A;  4BL2 A;  3EBY A;  1CQS A;  1B2U A;  1AY7 A;  1WNH A;  3S28 A;  3MKI A;  3G6E 3;  1FUW A;  4Q53 A;  5M1A A;  2INX A;  3CME 3;  1M1K 4;  1JRQ A;  3EE1 A;  1DMM A;  2H0I A;  2YX9 A;  2IUK A;  5AIG A;  4XDW A;  2F4Y A;  4H3U A;  1LNH A;  5STD A;  3DMC A;  4MMX B;  3CCM 3;  2XGN A;  1R4Y A;  3G0K A;  1W01 A;  5KP4 A;  1I2E A;  2AAD A;  5G1K A;  2BMO B;  3MYT A;  1UGI A;  2FNQ A;  1YGW A;  2Y73 A;  1US1 A;  2XR8 B;  2F5W A;  1CH0 A;  1JJ2 2;  1LQG C;  3JUP A;  1IK3 A;  1GOV A;  3RNT A;  1IT7 A;  2M7O A;  1GD3 A;  4I4K A;  1YVB I;  3DH2 A;  1EG9 B;  3WA2 X;  3M8C A;  4XBX A;  1FGT A;  1RTU A;  1GS3 A;  5AI1 A;  4NRE A;  1RKY A;  3N9H A;  1BU4 A;  1T3B A;  1TTO A;  1TRQ A;  1OF5 A;  1YIJ 3;  1O7M B;  3DY5 A;  3FLJ A;  3NV0 B;  5BU4 A;  5IG3 A;  1IQ8 A;  1E97 A;  4HZB B;  1FGM A;  2O3O A;  3D5I A;  4FMA A;  1KSI A;  1X1U A;  4X2O A;  4WHA A;  9RNT A;  3V92 A;  1Q82 4;  1K73 4;  1FUT A;  1QAL A;  2P05 A;  3Q3F A;  3I55 3;  3X42 A;  1W6G A;  1Q42 A;  3L0R A;  3EHC A;  2F99 A;  6STD A;  2F5M A;  2STD A;  3JUQ A;  2YFL B;  1B21 A;  2UUG C;  1JN5 A;  2CW9 A;  3F14 A;  1U8C B;  3PZW A;  1ROV A;  4J5G A;  1VQL 3;  2MF7 A;  3FG3 A;  3HII A;  3FF0 A;  3Q90 A;  1E3V A;  1WMP A;  2BO9 B;  2CHC A;  3DGO A;  4TX4 A;  5TGN A;  1MWR A;  1RGL A;  2OTJ 3;  4BIR A;  4HOH A;  2QEX 3;  1UCI A;  5IG0 A;  1RHL A;  5CF1 A;  1HKX A;  2L4V A;  1QAF A;  1I8V A;  2F86 B;  3H3H A;  1MWT A;  1BNI A;  2IYJ A;  4N6O B;  5JPU A;  4XB5 A;  3AMO B;  3V99 A;  2FGT A;  4EYC A;  7RNT A;  3WOE B;  5IF6 A;  1RLS A;  1GY7 A;  1MGW A;  1Z1S A;  1S72 3;  1IQY A;  5EEO A;  3BND A;  1B2M A;  2CKF B;  2C11 A;  5AII A;  4BTY A;  3CCS 3;  2IA7 A;  2W56 A;  1DMN A;  4JRF A;  3NQY A;  4RNY A;  1DE3 A;  2CG0 A;  5M19 A;  1BSE A;  1UDI I;  4PEJ A;  3N8B A;  1YI2 3;  4HBR A;  3LZA A;  3KZT A;  3MWZ A;  4AKZ A;  4BTX A;  4GSP A;  2R4I A;  2JQ5 A;  3X3Y A;  1OGX A;  1BSD A;  1O7H B;  2XSH B;  5M18 A;  3J7Y d;  2UX0 A;  2KF4 A;  1HU9 A;  1VQ8 3;  1LXE A;  1EKM A;  3FGY A;  4DKI A;  2CFK A;  1Q86 4;  3Q2P A;  3S27 A;  2V1L A;  1RDS A;  1SIH A;  2GEY A;  2OQE A;  1N9J A;  3G8Z A;  3DM8 A;  1TIJ A;  1B3S A;  1T5Y A;  1M90 4;  1VQ5 3;  3NX0 A;  3VF1 A;  2R41 A;  1STF I;  2XFT A;  1DMQ A;  1B2Z A;  3MSO A;  3SVA A;  5I97 A;  1Q9E A;  1NJI 4;  1I3I A;  3DGN A;  5ELU A;  1BNF A;  1B27 A;  1G96 A;  3CD6 3;  3EC9 A;  3CCL 3;  1QVG 2;  1BNE A;  3S67 A;  3FH1 A;  1LOW A;  4WWU C;  1M9G A;  1U5O A;  4WYK A;  3BU4 A;  4QWT A;  4X2H A;  3F40 A;  1JBT A;  3NQZ A;  4HAA A;  2GU1 A;  2CFW A;  2SAR A;  1GY5 A;  1T2H A;  3HK4 A;  3OWS A;  1GY6 A;  2RGQ A;  1GMQ A;  3DGY A;  3UNL A;  4RNT A;  1AQZ A;  1STD A;  1A67 A;  1MOL A;  3JVC A;  1RN4 A;  2Z76 A;  1K9M 4;  1DVD A;  1BNG A;  1RJO A;  3AGO A;  4GB5 A;  4O02 B;  4O2H A;  3PGB A;  2KF6 A;  3IMA B;  1W02 A;  3MG1 A;  1V57 A;  3CNM A;  4KVH A;  5EVH A;  3ZFZ A;  2XEP A;  1YJN 3;  3B4O A;  3KE7 A;  5G2G A;  1OAC A;  3AGN A;  4K1U A;  3DGM A;  3O8Y A;  4H61 A;  1BNJ A;  6RNT A;  3EQQ B;  4J8T A;  1GMP A;  1ZX2 A;  4AEQ A;  1D6Y A;  4HM1 B;  1DVC A;  1BSA A;  1R4C A;  1UCJ A;  1N8Q A;  3D9R A;  3I56 3;  4JF8 A;  3EN1 B;  3FG1 A;  4IIA A;  1J2B A;  3GZY B;  4CPK A;  1BNR A;  3GSP A;  3RGR A;  1IV9 A;  1ASK A;  3KFQ C;  4HVN A;  2AAE A;  4XBY A;  3DXO A;  1Q7Y 4;  1B2X A;  1A2P A;  1BRG A;  3K0Z A;  2K54 A;  1N8R 4;  1ULI B;  4EBG A;  3NXJ A;  1WMN A;  3BLZ A;  1PFP A;  1KD1 4;  4HZ9 B;  5CLK A;  2IMJ A;  4LMI A;  3PCR A;  1TJD A;  2BHM A;  4O8S A;  4AKY A;  4RZM A;  3GZB A;  1BAO A;  4N6N B;  2RCD A;  4KFF A;  2C10 A;  3URP A;  3D3L A;  3SOA A;  1BUJ A;  3CC4 3;  2CC3 A;  3WA3 A;  1IYY A;  1SII A;  1HZ1 A;  1JNQ A;  4XDV A;  2HML B;  4HYZ A;  1VQ6 3;  2RSX A;  1YJ9 3;  3CCJ 3;  1BRJ A;  4XM4 A;  1KWI A;  2XFS A;  1BGS A;  2OOV C;  3NV0 A;  2E2V A;  1MWS A;  3BIR A;  5KP3 A;  1RRL A;  3EBT A;  2W9Q A;  3LTA A;  1LOX A;  1JB5 A;  1RGA A;  3MPH A;  3CCU 3;  1KQS 2;  2CG1 A;  5JPP A;  1SQW A; 
#chains in the Genus database with same CATH homology
 1O7P B;  2XF3 A;  3CCV 3;  4FCJ A;  2PNC A;  2D42 A;  2E2T A;  3S29 A;  3KN4 A;  2WGO A;  4N3V A;  3MHE A;  3MG2 A;  2Z77 A;  3BNC A;  3UL5 A;  4WFO A;  3OWU A;  4HKV B;  3DUK A;  2LQV A;  3WDG B;  5JBS A;  3UJM A;  1NU3 A;  1QVF 2;  1O7N B;  1VQN 3;  5AIH A;  3X3Z A;  1V74 A;  2BMQ B;  1LVN A;  3NBJ A;  3EF8 A;  4MJD A;  3AMO A;  4KFD A;  3U1W A;  3MG3 A;  7STD A;  4LZI A;  4LSO A;  3LT8 A;  5A0O B;  4IT7 A;  3NHX A;  2HMO B;  1Y4K A;  1ULJ B;  5DRE A;  2CFG A;  3B4P A;  4HM8 B;  2P0M A;  5AYR B;  2W2C A;  3KKG A;  3NM2 A;  3NUV A;  1OGZ A;  1IVX A;  4R80 A;  3OW2 2;  3VSY A;  1GYB A;  1PU4 A;  5KP1 A;  5D81 A;  3WOF B;  3WOD G;  1K28 A;  1UW1 A;  3KII A;  1IVW A;  3HX8 A;  5D82 A;  3PCS A;  3LTB A;  4OVM A;  2P09 A;  1NO3 A;  4NHF A;  1W6Y A;  2YFI B;  2FXT A;  3SXX A;  3K5T A;  4FMC A;  3BNE A;  3JUM A;  5DRV A;  3F7X A;  1W7C A;  1O7G B;  1ZO2 A;  3F7S A;  3FG4 A;  3OV4 A;  3UL6 A;  1WMO A;  1N5P A;  3IPT A;  2W04 A;  5IG4 A;  1EQK A;  3KSE D;  5IER A;  4R9K A;  1UI8 A;  5AIF A;  1FA3 A;  1D6Z A;  3I0Y A;  1FGQ A;  3EN8 A;  1A2V A;  3CPW 2;  3G16 A;  3H51 A;  1YIT 3;  2YFJ B;  4XBT A;  1W4N A;  1OH0 A;  4EC6 A;  2CK3 H;  1OHO A;  3LOY A;  1SPU A;  4IPB A;  3CCE 3;  1NB5 I;  1UUW B;  5CK6 A;  5CXO A;  3GAX A;  1TFO A;  3V98 A;  2CIU A;  3RDE A;  5IEN A;  3GRD A;  3Q1C A;  4ZM8 A;  3IJE B;  3E99 A;  3SED A;  1IDP A;  2PZV A;  3X41 A;  2CH9 A;  1IV7 A;  3BNB A;  3WMD A;  3QRD A;  1IT8 A;  2HMJ B;  1F8N A;  2ML5 A;  2WOF A;  2GU3 A;  4K61 A;  3S5C A;  1FGR A;  1CEW I;  3F9S A;  4GL6 A;  1VQK 3;  5BXQ A;  3LTD A;  1AVK A;  4L7K A;  3HIG A;  1TU5 A;  3GZR A;  3TDG A;  4HM7 B;  4BTW A;  3CC7 3;  1CYV A;  2K0M A;  4KFE A;  4LGQ A;  2KCD A;  4MEI A;  4MMY B;  1Q81 4;  2KXG A;  3DGL A;  2GBW B;  3A76 A;  2W6J H;  4FMD A;  1ROA A;  4HM4 B;  3ER7 A;  5ELJ A;  2ZDJ A;  3KSP A;  4N6L A;  2CWU A;  1AV4 A;  1NDO B;  5D83 A;  1TUH A;  1N5H A;  2XRX B;  4HM6 B;  1W5Z A;  3HI7 A;  3LML A;  3HZP A;  2W9P A;  4N6T A;  2BNG A;  1OUN A;  2Z7A A;  4O3V A;  1W00 A;  2P38 A;  1W2B 2;  1VQM 3;  4FR9 A;  2CFD A;  4FCM A;  1IVV A;  3K9M C;  3FZW A;  4N6U A;  3X3X A;  3G4S 3;  3G71 3;  3U97 A;  1C7H A;  3EX9 A;  1OF5 B;  1TFK A;  3PXM A;  1NB3 I;  1KC8 4;  1E3R A;  2I9W A;  4OK0 A;  3ALA A;  1SJW A;  1UI7 A;  2E2U A;  1IQX A;  2QIY A;  5IG5 A;  4OUQ A;  5FW5 A;  1QJG A;  3PYJ A;  4STD A;  1S5A A;  4J9A A;  3SOY A;  5AYS C;  2HMN B;  3ECF A;  4R4K A;  3GWR A;  1JN5 B;  2W03 A;  3VGN A;  3BB9 A;  3NBB A;  1YJW 3;  2BMR B;  5IEP A;  4HM5 B;  1EA2 A;  1BUQ A;  1VZZ A;  3CCQ 3;  3FSD A;  3SX1 A;  3OXA A;  1DYU A;  3F8X A;  1VQ4 3;  2ML6 A;  3JUN A;  2SBL A;  3FCS B;  4R1K A;  4FMB A;  3CNX A;  1ISK A;  5LC7 A;  3CXC 2;  1M1X B;  3SLU A;  5FGO A;  2XGL A;  3UB1 A;  2W0Q A;  1YHQ 3;  1D6U A;  2GEX A;  2WOH A;  1RN7 A;  3LTC A;  2CFL A;  3FF2 A;  3LH4 A;  3ROB A;  5LC6 A;  3LXU X;  1WQL B;  1YGE A;  1O7W B;  4KZ1 A;  1JB2 A;  3LYG A;  3F8H A;  2W56 B;  3NM7 A;  4HM2 B;  2LYX A;  1L5G B;  3OX9 A;  3T0U A;  4K1V A;  2ZL8 A;  1AVL A;  5EQL A;  5IEO A;  2B24 B;  3T8U A;  8CHO A;  1OHS A;  4N6V 0;  2BT3 A;  1AR0 A;  2A15 A;  5AEU B;  1IU7 A;  1MNL A;  1TP6 A;  3X40 A;  4EV2 A;  4ORL A;  3PS8 A;  2XSO B;  4EXR A;  4EV5 A;  1Q40 B;  2CWT A;  4R9L A;  4RNZ A;  4WP5 A;  1JV2 B;  1RRH A;  1VQP 3;  3CC2 3;  3CMA 3;  1Q40 A;  3K63 A;  3OWY A;  2IUJ A;  1JKG B;  3FKA A;  2QA4 3;  2JDI H;  1K41 A;  4HM3 B;  1OPY A;  1W2Z A;  2KRT A;  2O9U X;  3LT9 A;  1JKG A;  3CPO A;  1OCV A;  3RGA A;  1FGO A;  2MC8 A;  3T8N A;  3GZX B;  4CCV A;  4LEH A;  2OTL 3;  2Q07 A;  1A90 A;  4FCZ A;  1UUV B;  2HMM B;  4G1M B;  4RBN A;  3DZL A;  2HMK B;  4L8O A;  5HGR A;  5AEW B;  3CU3 A;  5BVB A;  1NWW A;  4HM0 B;  2QGU A;  2OWP A;  4MMZ B;  4U13 A;  2F98 A;  2CWV A;  2WGQ A;  4L8P A;  3EJV A;  1WTH A;  2P0X A;  3JUO A;  1OHP A;  3NBR A;  3STD A;  4WYK B;  1IVU A;  1CYU A;  1A2K A;  2D1W A;  1JB4 A;  3QK9 A;  4K90 B;  2Y74 A;  3N54 B;  2B1X B;  4N6M A;  1GD4 A;  4CDL A;  3B7C A;  5CF2 A;  1VQO 3;  1QAK A;  1W6C A;  2OQE C;  2Z6B A;  1VQ7 3;  2GXF A;  3CCR 3;  1K8A 4;  3K7C A;  2OOV A;  2OCT A;  2WO0 A;  2GBX B;  2XH9 A;  1QMA A;  4HJL B;  1VQ9 3;  2RFR A;  1N9E A;  3B8L A;  3EB8 A;  3EBY A;  1CQS A;  1WNH A;  3S28 A;  3MKI A;  1FUW A;  4Q53 A;  2INX A;  3CME 3;  1M1K 4;  1JRQ A;  3EE1 A;  1DMM A;  2YX9 A;  2IUK A;  5AIG A;  4XDW A;  5STD A;  4H3U A;  1LNH A;  3DMC A;  4MMX B;  3CCM 3;  2XGN A;  3G0K A;  1W01 A;  5KP4 A;  2BMO B;  3MYT A;  2FNQ A;  2Y73 A;  1US1 A;  2XR8 B;  1JJ2 2;  1IK3 A;  3JUP A;  1IT7 A;  2M7O A;  1GD3 A;  4I4K A;  1YVB I;  3WA2 X;  1EG9 B;  3M8C A;  4XBX A;  1FGT A;  1GS3 A;  5AI1 A;  4NRE A;  1RKY A;  3N9H A;  1OF5 A;  1YIJ 3;  1O7M B;  3DY5 A;  3FLJ A;  3NV0 B;  5IG3 A;  1IQ8 A;  1E97 A;  4HZB B;  1FGM A;  2O3O A;  4FMA A;  4WHA A;  1KSI A;  4X2O A;  3G6E 3;  1Q82 4;  3V92 A;  1K73 4;  1QAL A;  2P05 A;  3I55 3;  3X42 A;  1W6G A;  1Q42 A;  3L0R A;  3EHC A;  2F99 A;  6STD A;  2STD A;  3JUQ A;  2YFL B;  1JN5 A;  2CW9 A;  3F14 A;  1U8C B;  3PZW A;  1ROV A;  1VQL 3;  2MF7 A;  3FG3 A;  3HII A;  3FF0 A;  3Q90 A;  1E3V A;  1WMP A;  2BO9 B;  2CHC A;  3DGO A;  4TX4 A;  5TGN A;  2OTJ 3;  2QEX 3;  5IG0 A;  5CF1 A;  1HKX A;  2L4V A;  1QAF A;  2F86 B;  3H3H A;  4N6O B;  5JPU A;  4XB5 A;  3AMO B;  3V99 A;  2FGT A;  4EYC A;  5IF6 A;  3WOE B;  1GY7 A;  1Z1S A;  1S72 3;  1IQY A;  5EEO A;  3BND A;  2CKF B;  2C11 A;  5AII A;  4BTY A;  3CCS 3;  2IA7 A;  2W56 A;  1DMN A;  4JRF A;  3NQY A;  4RNY A;  2CG0 A;  4PEJ A;  3N8B A;  1YI2 3;  4HBR A;  3LZA A;  3KZT A;  3MWZ A;  4AKZ A;  4BTX A;  2R4I A;  2JQ5 A;  3X3Y A;  1OGX A;  1O7H B;  2XSH B;  3J7Y d;  1VQ8 3;  2UX0 A;  1HU9 A;  1LXE A;  1EKM A;  3FGY A;  2CFK A;  1Q86 4;  3Q2P A;  3S27 A;  2V1L A;  1SIH A;  2GEY A;  2OQE A;  1N9J A;  3G8Z A;  3DM8 A;  1TIJ A;  1T5Y A;  1M90 4;  1VQ5 3;  3NX0 A;  3VF1 A;  1STF I;  2XFT A;  1DMQ A;  3MSO A;  5I97 A;  3SVA A;  1NJI 4;  3DGN A;  5ELU A;  1G96 A;  3CD6 3;  3EC9 A;  3CCL 3;  1QVG 2;  3S67 A;  3FH1 A;  4WWU C;  1M9G A;  1U5O A;  4WYK A;  4QWT A;  4X2H A;  3F40 A;  3NQZ A;  2GU1 A;  2CFW A;  1GY5 A;  3HK4 A;  3OWS A;  1GY6 A;  2RGQ A;  3UNL A;  1A67 A;  1STD A;  1MOL A;  3JVC A;  1K9M 4;  2Z76 A;  1DVD A;  1RJO A;  4GB5 A;  4O02 B;  4O2H A;  3PGB A;  3IMA B;  1W02 A;  3MG1 A;  3CNM A;  4KVH A;  5EVH A;  2XEP A;  1YJN 3;  3B4O A;  3KE7 A;  5G2G A;  1OAC A;  4K1U A;  3DGM A;  3O8Y A;  4H61 A;  3EQQ B;  4J8T A;  5IW9 A;  1ZX2 A;  4AEQ A;  1D6Y A;  4HM1 B;  1DVC A;  1R4C A;  1N8Q A;  3D9R A;  3I56 3;  4JF8 A;  3EN1 B;  3FG1 A;  4IIA A;  1J2B A;  3GZY B;  3RGR A;  1IV9 A;  1ASK A;  3KFQ C;  4HVN A;  4XBY A;  1Q7Y 4;  3DXO A;  3K0Z A;  2K54 A;  1N8R 4;  1ULI B;  4EBG A;  3NXJ A;  1WMN A;  3BLZ A;  1PFP A;  1KD1 4;  4HZ9 B;  5CLK A;  2IMJ A;  4LMI A;  3PCR A;  2BHM A;  4O8S A;  4AKY A;  4RZM A;  3GZB A;  4N6N B;  2RCD A;  4KFF A;  2C10 A;  3D3L A;  3SOA A;  3CC4 3;  2CC3 A;  3WA3 A;  1SII A;  4XDV A;  1JNQ A;  2HML B;  4HYZ A;  1VQ6 3;  2RSX A;  1YJ9 3;  3CCJ 3;  4XM4 A;  1KWI A;  2XFS A;  2OOV C;  3NV0 A;  2E2V A;  5KP3 A;  1RRL A;  3EBT A;  2W9Q A;  3LTA A;  1LOX A;  1JB5 A;  3MPH A;  3CCU 3;  1KQS 2;  2CG1 A;  5JPP A;  1SQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...