4FD3A

Crystal structure of apo-formed ymtoar1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
254
Chain Sequence
MHYLPVAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGLSYQRQCAIAIDFKKWPHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINCAGLTQESLSVRTTASQIQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVNISSILHSGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDSGTSAPAEIAEEVWSLYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of apo-formed ymtOAR1
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 82
structure length 254
sequence length 273
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fd3A00
5ES3A 3CXRA 3NGXA 2GR9A 3E03A 3W8DA 5EQFA 4EEXA 4TRNA 3ZHXA 1U2DA 3QWFA 1JAYA 1YJQA 1DO8A 2IYOA 3AI3A 3C7CB 1PJQA 1I3LA 3I23A 4QO7A 4JJGA 2NM0A 1E7QA 2GERA 4A26A 1OZAA 2ZCVA 4JN6B 5F5LA 4CV2A 1DIRA 1FJHA 1PJ3A 3GFBA 4E5MA 2HUNA 2DM6A 4IDEA 1PU2A 2Y68A 1X0XA 1ZZEA 1P1RA 3JD2A 2IZ0A 4YAGA 4HWKA 3GG2A 3H4VA 2E49A 5C5IA 1XCBA 4MVJA 3D4OA 3ZHBA 3NRCA 4A73A 1GU7A 3EDMA 4XDYA 4DXHA 4OXNA 4CLDA 3IJRA 3UFXA 1VJTA 3DZBA 4II3A 2Q1WA 1TT7A 3G3EA 1EE9A 4N5MA 4XYGA 3GG9A 4MVJH 3KTDA 2VHVA 3VHRA 4ZN6A 2EF1A 3MZ0A 3MCVA 4LCJA 3TPCA 4BKUA 4GKBA 1EUZA 3MWDB 2PA3A 5A9SB 1D3AA 1PZFA 2VWHA 3T4XA 3GNQA 3DHYA 3DFZA 4Q3EA 4NU6A 2YUTA 4RDHA 3FR8A 3HDYA 2W8ZA 3BMOB 3K31A 4FD3A 3U49A 2BHLA 3ZWWA 5CDGA 3JQBA 3RVDA 2JD0A 3U5TA 2D5CA 4XZ3A 1MUUA 3VAZA 3TZCA 3BZUA 2GLXA 3BTSA 4DUPA 3PJGA 3JQ6A 1BXZA 2HCTA 2VOEA 3EZLA 1PR9A 1SOVA 4NBVA 4I5GA 4BNNA 1U5AA 1I2BA 3GRKA 1ZMTA 4KQXA 4DRYA 4HV4A 4YA6A 5DBIA 1J49A 3AOEA 2EW2A 2F00A 1B8VA 1NR1A 4AJEA 2PLAA 1YBAA 4D3DA 1NNUA 4FDAA 1H6DA 3VH1A 3ZN2A 3BMOA 3GPIA 5CEFA 1J4AA 2J5KA 2X9GA 1ZK0A 1SB8A 2V6GA 5ENDA 4OKNA 1JA9A 2GCGA 2NVUB 3H5AA 1P74A 3C1TA 2DPHA 5CG1A 2VRBA 3GN1A 1YQGA 4NJMA 1O89A 1ARZA 3O8QA 3T7EA 1IOLA 1Q1NA 5C7LO 1W0CA 1T2EA 3QE3A 4MKXA 5I9NA 1MFPA 3ADPA 3M2TA 4R3WA 2IZ1A 4C7JA 2DQ4A 3TL2A 3JQ7B 1J0XO 3PEFA 5L4SA 2XAAA 2QRKA 3ORFA 4PIVA 4OXYA 4J0FA 4OQYA 4Z6KA 4J1SA 4TSKA 2XXBA 2NQ8A 4Q3BA 2VOJA 1VJ1A 2X9VA 3B1KA 4WKGA 1NYTA 1NVGA 2FPIA 5CFZA 3OJ0A 2ZQYA 2E37A 1V3TA 1JKJA 4UVGA 1SO8A 1GEGA 1LA2A 3JSAA 2XXJA 2CDBA 3R0IA 1ZXLA 3OECA 1MV8A 1XYGA 1Y8RA 3LLVA 2NUAA 4U0KA 1GQ2A 4ALKA 4FOOA 1OBFO 1C3VA 4FCCA 4OGWA 1DAOA 1PSDA 1U8XX 2C5AA 4P8RA 3QWHA 4GGOA 4MP8A 4BNXA 3ZV4A 4ND1A 3P2OA 3DB2A 2NVUA 4YACA 4XYEA 3BMCB 1K6JA 3WJAA 3QRWA 3JYPA 1XWFA 4I1IA 1PS0A 1UAGA 4KDFA 3C3XA 3RC2A 3OJEA 3PQDA 1MA0A 4IIUA 4IQGA 2OXIA 4D44A 2OBYA 3SC6A 4RPHA 3ITKA 2W2KA 4HY3A 2BRUA 4L4XA 3CSDA 3JQ7A 1U1IA 3OIFA 2Q2WA 3W1VA 4I5FA 4GWGA 3WSVA 1BDMA 1YB4A 2PGJA 4AJOA 1YQXA 4KMSA 4BGIA 2C59A 4LK3A 2NU7A 1YE3A 4I5EA 5A3JA 5BSHA 1ISJA 1C0KA 4A10A 2I66A 3JYQA 5JAIA 3EUWA 4QT0A 4XJTA 5F1OA 5HA5A 2AE1A 4D7AA 3JYOA 3KSUA 1RPNA 1KERA 3B1JA 3RFXA 4Q39A 4BNKA 1O9BA 1P3DA 3NDIA 2UDPA 4CM1A 3HWRA 4LGVA 1M6HA 3WSWA 3U4HA 3VPFA 4CQMD 1Q7GA 1ZW1A 3DR3A 3G1UA 4Y67A 2EKLA 2W2KB 1EVIA 1YQDA 1X14A 1EK5A 3COSA 4OIMA 3NYWA 3NUGA 3OJLA 4MVJI 3JQFA 5I9MA 5JAMA 1EUCA 4E30A 4UVEA 4CLHA 4RPKA 3VDRA 3WNVA 3WS7A 3FCOA 2PR2A 4CLOB 5CDUA 1LLUA 4CMEC 3U09A 2B5WA 3A9WA 5KJ1A 2YJZA 3LZ6A 2HLPA 5EERA 4ZD6A 4UUNA 4CLXA 4Y6PA 1QORA 1Y8QB 4NFSA 1PQPA 5L51A 2HK9A 3L4SO 1LX6A 4CMGA 4AG3A 5C37A 2IRWA 2YHUA 3UF0A 1B8UA 1N5DA 3HFSA 4FFNA 5F5NA 2ZTUA 1DIHA 5B12A 1EFLA 4DLAA 1GYPA 4R54A 1ADFA 4B3HA 5TQVA 3HN7A 4IQ0A 3PFFA 3PYMA 3WQRA 4G2NA 2D59A 1LRLA 2OUIA 4J6FA 1BXGB 3G17A 1LLCA 4INAA 3O4RA 1DRUA 4MOWA 3EY4A 3ZU4A 1E7WA 1S6YA 3HSKA 4O1MA 3ZH2A 5T8KC 1FDSA 1Y5MA 2JFHA 1LSUA 1JN0A 3D0OA 3GVXA 4JLWA 4OM8A 4TKLA 2FWMX 3L6DA 3WTBA 1ZNQO 1AE1A 3WYEA 5ICSA 2VCYA 3HB5X 1A27A 3CIFA 1Z7BA 1WPQA 1PGJA 1Y9EA 1XELA 4CODB 5TJHA 1MXHA 2X8LA 4NH4A 2RIRA 4M87A 4RVUA 1MG5A 4ZQEA 4QUKA 3RU7A 1U9JA 3KRTA 4YRBA 3WOHA 3SVTA 4R51A 4CM3A 2X58A 2B0JA 4R41A 2ZJ1A 1I32A 1HE5A 5BSEA 1HF3A 3EK2A 3GPDG 3VH3A 3VZPA 3QVSA 2HMUA 1YDEA 1XSEA 1WWKA 3NAQA 3WX0A 2O7SA 3DEYX 4B7CA 3RC9A 1O0SA 4I9HA 3TOZA 1QP8A 3JQAA 3RIHA 3PZBA 1DLJA 4JXKA 1HE2A 5IDQA 3K30A 2OHXA 1QRRA 4YEDA 3QJ5A 4F6LA 1KY5A 3LT1A 1JWAB 3GC6A 4LMRA 2HO5A 4DIFA 1M6WA 3HE3A 4IZIA 3VVCA 2C20A 1RM5A 2OMEA 4WLVA 1U7HA 3ZU3A 1X15A 2O50A 3JQGA 2Q2QA 3FRJA 5F1PA 1SZJG 3OETA 3PLRA 1ZJZA 1KVTA 3GUCA 1KS9A 1GEEA 3JQ9C 4NMHA 4UAGA 4DMLA 4PLVA 4DL9A 5B1YA 3DMTA 3AM5A 2OOSA 4UEOA 5ITWA 1DC4A 3ROQA 2AHRA 1FK8A 2AQKA 3OFSA 3NT4A 4IDAA 3ONDA 3TN7A 1E3WB 4H7PA 4PLGA 2PH5A 4HKTA 2B35A 4J1NA 3RD5A 2DTEA 1PGOA 1FDTA 2D4AA 3DZFA 1N7GA 4PRLA 4DPKA 4YAIA 1UUFA 1NASA 1YH3A 3M1AA 3VZSA 4ZICA 1B8PA 2BH9A 4FBGA 1P1KA 4XB1A 1UXGA 1SEVA 1E3SA 2C2XA 4K1LA 3WR5A 3TFOA 2C2YA 2YV2A 5COBA 5G0WA 4A27A 5KVSA 1AHHA 3S2EA 1KVQA 3NT5A 3QSGA 5KNLA 3BHMA 4IJWA 1ENYA 2V65A 3AFMA 1HLPA 1IZ0A 4CMEA 1RYEA 3AK4A 2YQ4A 4YCAA 3PJEA 2POQX 3UUWA 3ETGA 5AQ1A 3MEQA 4RF3A 4IXWA 4LCEA 5DP1A 2X86A 3ZNQA 3TSCA 4AJIA 5KIAA 1U3VA 1HDGO 2YQ5A 3UICA 1SOWA 1IPEA 3RBZA 1XG5A 3NDRA 1P77A 5BSGA 1H2HA 1VSVA 1YWGO 4BV9A 3QWBA 1KY4A 4U0JA 3IDSA 4PLWA 3ZV3A 2AA3A 3OQBA 3VH2A 1I10A 3DXFA 4F46A 1DRVA 3CH6A 1M75A 2TMGA 3FD8A 1HDYA 3LT0A 4E6PA 4DMMA 5LDGA 3O9ZA 1OOEA 2VHWA 1QR6A 2B4RO 2VHZA 2ZCUA 1PJTA 2CSUA 3T4EA 3QV1A 4J9VA 2HU2A 1PZGA 3NV9A 1LEHA 3V2HA 4BV8A 2AG8A 3JD1A 1QSGA 4YJHB 5L4LA 3C85A 2EERA 2O7QA 3RUFA 1MXFA 3PLNA 3RSHA 1W73A 2O3TA 4IBOA 4YVFA 4B7UA 3BIOA 4R1NA 4PFJA 3ZNOA 4IMRA 2AEJA 1ENPA 4IDGA 4GVXA 3C8MA 1UAYA 4QSMA 4WK6A 1NHWA 1I01A 4EBFA 1I2CA 1R12A 3DZIA 5G4KB 2EGGA 4RPJA 4YB8A 5L9AA 1ADCA 3U62A 4J1QA 4WCFB 3BTUA 4BNGA 4TVBA 4AJ4A 3Q6IA 4DTIA 3LSYA 3L9WA 3DOCA 3MJSA 2NTVA 1QLHA 2X7HA 3TZHA 4A5OA 4ALJA 3ZDFA 4K6FA 3UVEA 3RAJA 2QX7A 3FTNA 5CHEA 4RL6A 4NK4A 4WECA 1ZEMA 1GY8A 4ZQBA 1LTHR 2IYPA 4O0LA 1Z75A 5JCJD 4XCVA 2WMDA 3H9JA 3WGHA 1GDHA 4E13A 3ENKA 5JO0A 5BT9A 4J4HA 2PTGA 3OA2A 1UZLA 3KV3O 2GSDA 3DZKA 1IE3A 1TLTA 2ZB7A 3B70A 3ON5A 5DP2A 1EMDA 2I6TA 6LDHA 1Z74A 2A92A 4M86A 4BNZA 4CM9A 4WEOA 3FN4A 5FWNA 2NVBA 2Q4EA 1GAEO 1QKIA 4B8WA 3D4NA 3ZHZA 4CLRA 1GZ3A 3OQ6A 5DBGA 1C1XA 2NNLD 3QW2A 1B14A 3LU1A 1LSSA 4IDCA 2IXAA 3QWAA 5CEEA 5DOZA 2ZATA 4RPGA 2YV1A 4NNJA 4MP6A 2ZYGA 5BNIA 1N7HA 3UW3A 3QY9A 4QECA 3RUDA 3GZNB 1YO6A 5DF1A 3ITDA 4HUJA 3UXYA 5HWSA 4EI2A 3H9QA 2Q1SA 2X5KO 1DRWA 3Q9UA 3VTZA 4GMGA 4W7IA 3JD3A 1YBMA 1KEWA 4AJ2A 3L9XA 3BHJA 3V1UA 2FN7A 3VPHA 3HDQA 3DOOA 4XQGA 5H83A 1Y7TA 2JD2A 3ZW8A 1KEPA 1M66A 4B4UA 3UKOA 3E1KA 4FFLA 4AJHA 2PZLA 5K6AC 3RROA 2DUWA 1WMAA 2WD7B 1PGQA 3SLKA 3D3WA 1MC4A 2JJYA 1Z73A 1HXHA 1JKFA 2EHDA 3CMMA 3RCBA 1N1GA 2CMDA 3WIEA 4WCDA 4YR9A 1XIVA 3OP4A 3O26A 2OFPA 1GZ6A 2YDYA 3GDOA 2B69A 3TFQA 4CL3A 3DTTA 1EVZA 4M49A 4CMAA 2E82A 3GEGA 3JQDA 4N18A 3W4KA 1BGVA 4KTTE 1F0YA 3X2EA 4PZEA 3QIVA 3B20A 5A03A 1HETA 4JBHA 5A02A 2AXQA 4IMPA 5AXDA 2DVMA 2FR8A 1KC3A 3MJEA 4FPXA 1NPYA 1ZCJA 2BMAA 1OI7A 1T4BA 1K2WA 1VPDA 1GYRA 4RCVA 3WWZA 2VZ0A 5ER9A 1I24A 5IXYA 5DCUA 2NSDA 4DLBA 1C1DB 4RF2A 2J6IA 2VWPA 3RC1A 4ALMA 3KM0A 3PPIA 3JQ8A 2IEDA 2QRLA 3AU8A 4KP7A 2W2LA 1ZK1A 2GASA 1V9LA 3HQ4O 2RHCA 4FFRA 2I76A 3ZWOA 4CV0A 1IZ9A 1HKUA 1DLIA 1KIFA 1NXQA 1XKQA 1FMCA 2AQIA 1Z7EA 3ENNA 3WGGA 3PQFA 4G65A 3ZWAA 1EE2A 4IZHA 5I7FA 4XQCA 2V6BA 3OEWA 4TWRA 1ZK2A 4M55A 4U7WA 3R3JA 4RV9A 4C7KA 3VH4A 1SMKA 4FFOA 2O23A 1DJNA 3WICA 4ZQGA 3BXXA 2FZEA 5U1PA 2P9CA 4MPDA 3DZGA 2LDBA 4WLNA 4EZBA 1L7DA 2BD0A 4XX0A 2HMVA 3PIDA 4CMIA 3GEDA 1GQQA 1R4MB 4G5HA 4IQ8A 3JD4A 2H9IA 1QV7A 3ASVA 3QVOA 1EDOA 3GAFA 4NQZA 1JU9A 3P19A 4UUOA 1KYQA 1E1KA 1HZJA 3ASUA 1K6IA 5B4TA 4OAQA 5JMWA 3V1YA 1FDUA 2AMFA 1X7HA 1YONA 2G82A 3LLSA 3EVNA 4YQZA 2YDXA 3PI7A 5KJCA 1YL6A 1I2ZA 2CVZA 4D46A 1YB5A 4R1SA 3D64A 3GN2A 1P9LA 2JHFA 1R4NB 4Y6SA 4BO8A 1RM3A 1IHXA 2VTDA 3H5RA 2WE8A 1U3UA 4L75A 4ND5A 3UCXA 2ET6A 3M2PA 3DQPA 3PP8A 1T2CA 3DC2A 2DU8A 4HX5A 2A9FA 2QQ5A 3UH1A 4EUEA 3PYLA 4FJ0A 2HKIA 5GMOA 2JFFA 4BKQA 3Q2IA 4J16A 4FGWA 3MTGA 4W4TA 3KSZO 3WB9A 3FHLA 5CEJA 4BNWA 2DBVO 1LU9A 2P9GA 5IDYA 1SC6A 3RJ9A 3FI9A 4CM8A 1MGOA 2PKRA 3VZRA 4PLYA 2O3RA 3RUAA 4A03A 3VKVA 2PD4A 4BQRA 5C3MA 2QYTA 4GMFA 5G2OA 2D8AA 5JC8A 4FC6A 4CQLA 2ZB3A 5I8WA 5JAZA 1N8KA 1LLQA 3OMLA 1E5LA 1P1JA 2J3KA 1LLDA 1ISGA 1ZBQA 4A0SA 3K96A 4R69A 4UEKA 1LQUA 3F4BA 4RZIA 4RVDA 2X1HA 4YRAA 1HL3A 3CINA 3ROMA 2I5PO 3NTRA 1NTOA 2NQTA 4B4VA 2E4AA 4OKIA 4HFJA 4I08A 1BG6A 2RHRA 4H15A 1YJ8A 3R6DA 4WUVA 5IDXA 4GL4A 4M54A 2VT2A 3S55A 5IFLA 1MX3A 1DB3A 4DREA 5JC1A 1V0JA 2B4TO 3AW9A 2X0IA 2NTJA 3GMDA 4WNCA 5EESA 1WP4A 1FDVA 4BNUA 1BSVA 4Z0TA 5JDCA 4L4RA 1ENZA 2HRZA 4GX2A 3MJTA 4DYDA 2CVOA 3L4BC 1SAYA 4YAJA 3ZWCA 4CR8A 3W8EA 4TRJA 4QX6A 1QLJA 2Y0CA 4WJZA 5EMHA 4D42A 3PYXA 4ZRNA 4BO9A 1F12A 5A9RA 4DBVO 1ISHA 3WJ7A 3ZV5A 3ZWYA 2PZKA 4PGFA 5COQA 4YQYA 3KYBA 3FPLA 2AEMA 2Y1DA 5IF3A 5CP8A 1QYXA 2BFMA 2VZ9A 5FYDA 4AL4A 4HXYA 2W4QA 2QG4A 3F4LA 1GUZA 4PG5A 4JBGA 5H81A 1YBVA 1SEPA 1C1XB 2RBEA 3LK7A 1CF2O 3PHJA 1JKIA 2YHIB 4KQWA 1SNYA 1GL3A 1A9YA 4E2WA 3V1TC 3RUEA 1Z82A 2EGHA 2X0RA 4D43A 3ZU2A 4CL8A 1BMDA 4B7XA 1B15A 1I3MA 3B1FA 2VYNA 1WMBA 3JQBC 3KOUA 2C0CA 1UR5A 4FJ1A 3PGXA 1AHIA 1DFIA 1R0SA 1I8TA 2Y67A 3WGTA 1HTBA 3D3WB 3GVHA 3MOIA 4FOSA 1DXYA 1CEQA 3H9GA 5JY6A 4IS3A 4WASA 1VSUA 3JYLA 4ND3A 1LJ8A 1BXGA 3RU9A 1YRLA 1AXGA 1U2GA 3RWBA 5A05A 4CMBA 4BNYA 4NJMB 3LC7O 3IOYA 3FF4A 3QP9A 3DHEA 1LDMA 2C29D 3F3SA 4GLOA 1NWCA 2OGUA 3ADOA 3HDJA 4BNMA 4HP8A 4ZQHA 1DFGA 4NFHA 4E3ZA 4OOEA 4PLPA 4IGFA 3AY7A 4BIIA 2JD1A 1B7GO 3WG9A 2EEZA 2YFQA 2GN6A 4YT2A 2YFHA 3F5SA 2NU8A 5TGDA 1ADGA 1MB4A 5TNXA 3I9LA 1B2LA 1BXKA 2DLDA 3OICA 1I3KA 3E5RA 2HDHA 3JQFC 2PFGA 4KOAA 2IE0A 5JNLA 1NVTA 4U8GA 4XR4A 4Z3DA 4YJGA 4BB5A 4UVIA 2VHXA 5B4UA 5JBIA 2PD6A 3DBRB 1J5PA 2CDCA 1NFRA 4BMNA 1BWSA 1G0NA 3A1NA 3FWZA 2CF5A 2WJPA 1RKXA 1ZIDA 2CF6A 1GUYA 1B0AA 5HBRA 2HK8A 4WPGA 4CPDA 3WLEA 5HTOA 2GF2A 3SBOA 3RKRA 2ZYAA 4HADA 1XQ6A 4OMUA 4L4SA 4R01A 4R5HA 1BVRA 3S1LA 1CDOA 2IDZA 3WQSB 2C7GA 4AJPA 4HFRA 4B3IA 4O6VA 4U6SA 2VRCA 3IKTA 3TNLA 1QG6A 1E6EA 4N54A 3K5PA 1PTJA 4MO2A 2NTNA 3R3SA 1IB6A 3W6ZA 4PLHA 5T8KA 5I7EA 4BO0A 1M2WA 1UXIA 3D5QA 1JWBB 1OC2A 4J0EA 1MP0A 1XGKA 1V8BA 2WYVA 5EIOA 5F21A 3RQSA 3GA0A 3ZV6A 1EVJA 3GR6A 3KYCA 3GNTA 4Q3AA 2E6UX 5CDYA 1ISIA 2WEKA 3W6UA 4R9RA 3L0DA 3L07A 4PLTA 5JO9A 4F6CA 4RQUA 2X0JA 3WBFA 3BMCA 1F8GA 2B4QA 5AVOA 5COAA 3GUYA 1C14A 1DIGA 4M89A 3GHYA 2RCYA 1O8CA 3SXPA 5HRUA 3GQVA 4R9SA 1ZH8A 4EDFA 9LDBA 1JVSA 1A4IA 4DC0A 1XA0A 5LDHA 4HFMA 5IZCC 1E7RA 3G79A 4NBWA 5I7SA 3STHA 2GZ3A 5I9LA 3KO8A 4RVFA 1I3NA 1NWHA 1J6UA 4P4NA 1KEUA 5B37A 1YS4A 3T7CA 3SLGA 4FB5A 4U5QA 4A2CA 1UDBA 4UULA 4YXFA 1VJ0A 1N9GA 2FR0A 4O5OA 4AVYA 1WAMA 4CM8B 3AM4A 1O6ZA 2O3QA 4MKZA 3PQEA 1ULUA 3I9NA 3OA0A 3M6IA 4P4GA 3H3JA 4XA8A 7ADHA 1FXSA 4BQPA 2VUTA 1NPDA 1DC3A 2VWGA 3GMSA 4GKVA 2BGKA 1E3EA 4JBIA 5THKA 3P2YA 4PLCA 4CQMA 1KETA 5H82A 4XB2A 3VPGA 4J7CA 2PZJA 2W90A 5CPFA 3I9OA 3ZHYA 2DAPA 3A06A 4OYRA 2Y66A 1I30A 3NTQA 3ZWXA 1N92A 4ND4A 3AOGA 5TT1A 4BNLA 1WDLA 2YW9A 3K8ZA 4GAEA 4E4YA 5A1TA 1N2SA 1DAPA 3P5SA 3SX2A 5KVQA 4WE3A 1VC2A 3UHAA 5JDIC 2JKVA 1DC5A 5DZSA 4ALNA 2WDZA 3H2SA 2DT5A 2J3IA 2BGLA 3DL2A 4AFNA 5JLAA 3VKUA 1UP7A 4KUHA 1U7TA 1ZSVA 3DHNA 3E5MA 1X7DA 3HUDA 4FW8A 1Y8RB 1UXJA 1KBZA 2PKQP 2AW5A 2F1KA 4FJ2A 2BI7A 4MVJM 3N7UA 4MIEA 1UP4A 3GFGA 4J9UE 4Y8VA 1P0FA 5IJZA 4MVJG 3UCEA 3D4PA 1T24A 1VM6A 2Y0DA 4H16A 1U8FO 2WD7A 5CG2A 3OEYA 1UDCA 3DBHB 2NVWA 1HT0A 1SB9A 5JFOA 4R4JA 1LRKA 4IY1A 1SBYA 1GV1A 1PS9A 2BFPA 3CPSA 4BO3A 5TT0A 1CQJA 2JCYA 4TMFA 4BKOA 1B16A 1XR3A 5T57A 3ZWMA 1YGYA 3ZWPA 2O3UA 2C54A 8ADHA 1TEHA 1ZEJA 3Q9NA 1CETA 1DBVO 2DC1A 3QVTA 4HBGA 4ROSA 1RJWA 1LC0A 2DFDA 4J7XA 4AJKA 2HMTA 3VZQA 1WNTA 5AXCA 1DHRA 5LCXA 2G17A 1V3VA 4KWIA 2EKQA 3WGZA 1JAXA 1YVEI 1A4UA 2IZZA 4JGBA 4TQGA 3ZU5A 1E3LA 2ZTVA 4JIGA 1GTMA 3GOHA 4J49A 1DSSG 2NWQA 1PL8A 3V8BA 5U9CA 2R2GA 3DAPA 3N58A 4R3NA 4E5NA 5IDWA 5TX7A 2B83A 3CTMA 4DBZA 1NX6A 4RO0A 1ZSYA 4D0SA 4LVUA 3GVCA 4GI2A 4PCVA 3ROPA 2ZKLA 4CM5A 3IMFA 1ONPA 4FN4A 1W8DA 5G0SA 1NFQA 3ICPA 3CUKA 3AI1A 5IN5A 5KJEA 2Q4BA 4YJFB 3IP1A 3GGGA 5L95A 3BYZA 1Q0LA 3PIIA 4CUKA 1B3BA 4GLLA 3IAHA 3I9MA 4EGFA 1D8AA 3U3XA 2FSSA 4GSLA 1DHTA 3GT0A 2H1SA 3FBGA 4BGUA 4EJ0A 3Q1LA 3M1LA 1E77A 5A5FA 4LMPA 4IJVA 1NP3A 2FHSA 1NQ5A 2HJSA 3HZZA 4NFYA 1ISFA 4BNFA 3I4FA 1K5HA 1ZFNA 1YXMA 4RGBA 4WNIA 2WTBA 1ZMOA 4RQTA 4BNVA 3E82A 2BGMA 1IL0A 2J8ZA 4CM4B 2V6MA 4WLEA 1I36A 2Z95A 5T5QA 2I3GA 3OJFA 2Q3EA 3IUPA 3RBVA 4PN3A 3KYDB 1GCOA 1NVMB 3JD0A 2J3HA 3JQ9A 5BSFA 4CMKA 2VHYA 4DQVA 3ZWVA 3H5NA 3FWNA 3IS3A 3QQPA 1YB1A 3KHUA 2Q45A 4DQXA 2Z1MA 4NG5A 4GSKA 3ONFA 1EEHA 1ZK3A 1RM0A 1E7MA 2VUSA 4E32A 1OMOA 5JS6A 2J5QA 1E7YA 4LSMA 1IHYA 4IDDA 2W2LD 4PG7A 3PZRA 2Q2VA 3CE6A 4LSWA 1GPJA 4BGVA 5JPIA 1R15A 3WXBA 4NBUA 3QLJA 1EQUA 2YY7A 2Q1TA 3JYNA 4ID9A 4BL5A 5JDIA 4J90A 2DFVA 3A14A 2A4KA 2P68A 3UCFA 4BO7A 4NU5A 4B4WA 1EFKA 4ESOA 4QTZA 4PG6A 1ZJYA 2E48A 2X5OA 1X7GA 4R1UA 3TWOA 3S2GA 1GADO 2OO5A 4L9RA 4Q9NA 4D79A 5DDIP 2Y1EA 4J91A 3RJ5A 4BVAA 1F8FA 3WYBA 4FS3A 4XGIA 5ITVA 2VQ3A 4N5LA 2EP7A 2NU9A 2R6JA 5HS6A 4DIBA 7MDHA 2DKNA 1Q2XA 3IL2A 1LDYA 2HK7A 2BF7A 5L45A 1BTOA 2Q99A 1UDAA 2X4GA 1H6AA 5BQFA 1KVSA 1GUFA 2RAFA 3IQDB 3RBXA 3RFVA 1F17A 2FY8A 4MVJE 4BOYA 4CMHA 3FR7A 4LRSB 1P31A 4NBRA 4R1TA 1NQTA 1TA4A 4URFA 2BI8A 1U4OA 1L1FA 3U4DA 1OFGA 4BNIA 2BLLA 1CERA 3JQ8B 3GK3A 4J43A 2Y1GA 2PV7A 3UN1A 1T2AA 3ABIA 3IC5A 1PEDA 3OJOA 4JP2A 5G0VA 5ILOA 4XQ9A 5K9ZA 2EJVA 4HNHA 2JCXA 2CFCA 1D4FA 1NAHA 4RPLA 2YYYA 4OL9A 1HLDA 2O2YA 3V5NA 4AJNA 3D3EA 3OSUA 4HFNA 3DOJA 5AOVA 4NK5A 2VNAA 2RH8A 3I5MA 4GWKA 4IJUA 3GVPA 4CR7A 1PGPA 5AYVA 1PJCA 2GUGA 3LC1O 5G0TA 1BHSA 2D0IA 1LNQA 3INTA 4XYBA 3ETEA 1QV6A 4XDZA 3PDJA 4CM9D 1BW9B 1R37A 1N9GB 1DIBA 1JLLA 1R6DA 1LDNA 2CVQA 3G0OA 3BMNA 3TQHA 4RVHA 3DBLA 4BB6A 1R4MA 2CUKA 3NT2A 4MVJF 5EJ2A 3RC7A 1WZEA 1PWZA 3F1KA 3NDJA 3OH8A 3Q3CA 1LI4A 2JCVA 3KBOA 4XJSA 3DBLB 3X2FA 1JVBA 5TF4A 2GYYA 2I99A 3I83A 4OJNA 4S1VA 4DLLA 4E2XA 4JQCA 4E5KA 3WTCA 5GZ1A 3INGA 3KEOA 4UREA 3LYLA 2AG5A 3PTZA 2DBZA 1MC5A 1PGNA 2Y99A 4NHEA 4J7UA 1TVEA 2EV9A 2G76A 3EHEA 1R66A 2G5CA 3FSRA 1DFHA 4PVDA 3JQEA 2XPCA 4XIYA 2QZ9A 1P1HA 3KYDA 4DWVA 1NBOA 1U28A 1LBEA 4WOJA 5A3VA 3WMXA 1R0LA 1W6UA 2GN9A 2GZ2A 3U0BA 5U4QA 3HN2A 1F14A 4TVOA 4PG8A 1C0LA 3WMWA 4QXMA 4D3SA 3H2ZA 2WSBA 4S3MA 3K92A 1EQ2A 3WLFA 4D0RA 2C07A 4Z9XA 4LRTB 5I8ZA 2GGSA 1DIAA 1KC1A 4E2ZA 1YKFA 2VNSA 1NR7A 5A9SA 5KVVA 3EZYA 1ENOA 1LDGA 1IPFA 1R0KA 3Q11A 3OQ1A 1XU7A 4E5YA 1FF9A 4LISA 2BFAA 2G0TA 1D7OA 1PS8A 1WDMA 3JQAB 4J3FA 4HNGA 4Z9YA 4KTVE 1JDJA 4WLUA 2IXBA 3LF2A 3BAZA 5GZ3A 4E5PA 1GZ4A 2P9EA 1E1MA 1R16A 5TC4A 1HDCA 2PGDA 1CYDA 2VYVA 5FEUA 4F45A 1K89A 1K6XA 3GY0A 4OSOA 1VKOA 1C0IA 1Y6JA 1LSJA 1HDZA 3DO5A 1R4NA 4M8SA 1G0OA 4L74A 1EBFA 2AE2A 3IIEA 4P22A 5DBFA 5C7IO 3AOEC 4GX5A 5AXAA 4IINA 3WYCA 2DPGA 2VZ8A 1E3IA 3E18A 3PHLA 4NBTA 1HYEA 4J2HA 5L3ZA 4E33A 1GR0A 3DONA 3O38A 2DUUA 4WCFA 1P45A 3QA9A 4BUCA 3AY6A 1DPGA 1GPDG 5DOVA 1JQBA 5JYDA 1P33A 1QXSA 1P0CA 3ETDA 3OIDA 5JY1A 2GZ1A 3F1LA 5KTKA 1PL7A 1VL8A 4RVSA 1D1SA 5A06A 5FFFA 5ENVA 5K6AA 1Y5RA 4NJOA 3H3FA 3I9KA 1LDEA 4JP3A 5GZ6A 3RUIA 4BNHA 3HADA 2C7VA 3CZRA 3K2BA 4YBZA 2Y1CA 4LVCA 5AXBA 4KDEA 1S7CA 1TT5B 2DBQA 1BVUA 4I9NA 4Y9DA 5DULA 4Z0HO 4QFCA 2UYYA 5C7OO 1VE9A 2FMUA 4BO1A 2O3JA 2VYVD 3Q2KA 3SEFA 3PDUA 2HMSA 1T26A 5EL0A 3E9MA 1MFZA 1PIWA 2FR1A 4BKPA 2WWRA 3AUTA 1OAAA 4JX8A 4GPD1 4BO6A 5TS3A 3ZNPA 2TMDA 4EW6A 2OBNA 1I0ZA 3PWKA 4ALLA 4Z3KA 3LT2A 1QMGA 3PFWO 4K9DA 2P91A 4UVDA 2O4CA 3NEPX 4WEQA 4IM7A 4DIOA 4U6QA 4A7PA 3CZMA 3ZWNA 3MJ4A 4NZ9A 5JYEA 2BELA 2PH3A 1GD1O 1ZO8A 2Y05A 2O3SA 5KJ6A 1CJCA 3ROKA 4CV3A 1KEVA 5L53A 4DGSA 1NPTO 2EG9A 4FQ8A 1ZKMA 3BHIA 1IYZA 3IP3A 4XQEA 3GGOA 4I8XA 2Q49A 1TB4A 4GVLA 1H9BA 1ZXBA 1TT5A 3H8VA 4RLHA 1A7AA 3GGPA 2D1YA 4CV1A 4DPMA 3BTVA 2ILTA 4GQAA 4YJHA 5DCWA 5JXWA 3TOXA 4PZDA 4D41A 3NTOA 3DWFA 4PZCA 1AN9A 1LDBA 1HWYA 2YZ7A 4JCOA 1D1TA 1X13A 5G0UA 3L77A 3PVZA 3E6AA 2BKAA 3WIDA 3KB6A 4AICA 3WGOA 3ICCA 5ICMA 1V6AA 5IAAA 1NAIA 3SJUA 2HJRA 3DFUA 5A4DA 4F3YA 2HMWA 3DAFA 1Q0HA 1T1RA 2V7PA 3WBBA 2VUUA 2I67A 2Q50A 2QHXA 4UVHA 1MLDA 1X1TA 1ZK4A 4EUFA 3U9LA 3BMNB 3OIGA 1N1EA 4QEDA 5L7YA 2CY0A 4W7HA 1LQTA 2EWMA 2QIOA 3H6KA 1ZUD1 4FFMA 1XU9A 3AFNA 2HQ1A 4Q3CA 3OM9A 3ZI0A 5A9TA 1Y9AA 3LVFO 2ZB8A 1E6WA 2FP4A 4W6ZA 4J4BA 1ID1A 2Z1NA 4QFDA 4GX0A 1ULSA 3EMKA 3GLQA 3QVXA 2X6TA 2R00C 3B6ZA 2EW8A 4IJKA 5K0ZA 1HZZA 2JAHA 3ZZNA 3JQCA 5JDCC 3VVBA 3NJ4A 3PGJA 4WGGA 5FF9A 3KZVA 1U3WA 3K9QO 2UUPA 3LDHA 4ZGWA 2NADA 1HDOA 2P4QA 1OC4A 2AQ8A 2XOXA 1VLLA 1DEHA 2ZK7A 3EGOA 3PHGA 4E31A 5L7WA 3K2EA 5EN4A 4ZHSA 1QYVA 5BNTA 2LDXA 1IUKA 1IULA 1FDWA 1CIVA 1O95A 3WNQA 3A28A 4ONEA 3V2GA 3DTYA 2UAGA 1LRJA 4GBJA 3IJPA 4YWJA 1UZNA 4J2OA 3N74A 1UP6A 3C1AA 3H65A 4BGEA 1H5QA 2AEFA 4CM6A 3OF2A 4EEZA 3L6EA 4XRGA 2CNBA 3KSDO 1V35A 3F46A 3BTOA 1WDKA 3WDSA 3WFJA 3V2UA 2RH4A 3E9NA 3RFTA 5T67A 1VKNA 1ZVMA 4MIYA 1T1SA 4W99A 2JFGA 5G4LA 4TZTA 1SCUA 2GN4A 3ULKA 1YL5A 1SPXA 5EQDA 4YPOA 1V3UA 3KLMX 3AU9A 3P7MA 4Z0PA 5KCZA 2OZPA 2X0NA 3PHIA 1NHGA 5BR7A 1CQIA 4RVGA 1PWXA 4RDIA 4XRRA 1NQAO 4RORA 5KVCA 2Y93A 5TRTA 3HFGA 2DBRA 4ILKA 5ER6A 1KOLA 3Q0EA 4B79A 2DTDA 3WGYA 2X5JO 3C7DB 2FOIA 4X54A 3FNHA 4CUZA 4MKRA 2X9NA 4XEHA 3WGIA 4ZJUA 2OORA 3DBHA 2NACA 1H9AA 4E0BA 1P1IA 3AWDA 2I3AA 3CKYA 3JCZA 1T25A 4CMJA 5ILGA 2I65A 3LF1A 3HB4X 4R5MA 4CLRB 1PX0A 4PLZA 1Z45A 3TJRA 2HRBA 1PZEA 2GRAA 2P5UA 2H63A 1BDBA 4YT5A 4GX1A 1BRMA 3I6IA 3O8QB 4AJJA 4DA9A 3OBBA 4WOKA 1HSZA 5FI5A 2GO1A 2GPTA 1B26A 4DYVA 4TZKA 1WVGA 3GZNA 4ZA2A 2VT3A 4FSHA 5JW6A 1HEUA 1HSOA 2WD8A 4CMCA 3TL3A 2Q46A 2I9PA 1E1NA 5THQA 3JQGB 1UXHA 3IUSA 1M67A 1UZMA 2P5YA 1WLYA 4IIVA 3KYCB 1AUPA 1PJ2A 1XHLA 2R00A 3GNSA 1EBUA 4CLEA 1HRDA 1VI2A 2V6FA 3ZGYA 4R68A 3RUHA 4ITUA 3DMTC 1HE4A 2EIHA 3D5TA 3K6JA 4MIOA 3MJVA 3F47A 1UJMA 4TRRA 1DJQA 1E7SA 5ADHA 2O2SA 3E8XA 1A71A 5LC1A 2P2SA 1E5QA 3WQQA 4IDBA 3ANNA 4YAKA 2WE7A 4ZU3A 1NM5A 1GV0A 1Q7CA 2Y1FA 2PK3A 4LW8A 4MJLA 2ZJ0A 3MOGA 2Y1OA 3G49A 4RZHA 1QYCA 2PWZA 3D7LA 1YL7A 4I9UA 4BKRA 3C7AA 2GD1O 2ZYDA 1GYQA 2VTEA 3QVWA 2UV8A 3LQFA 2PNFA 3ZWBA 2ZTMA 5I7VA 1JW9B 2PKQO 3INRA 1E3JA 4ZRMA 3O03A 3BMQA 4BO4A 4CM4A 4NI5A 1H93A 4RF4A 2OL4A 1A9ZA 5IN4A 4NPCA 5MDHA 3AM3A 3CMCO 3FNEA 3VPXA 3PJFA 1UH5A 4Z9FA 4DPLA 3GZ4A 4UEJA 4K6CA 1YOVA 4IDFA 3VTFA 2OP1A 3VDQA 2D2IA 2HSDA 4O63O 5DT9A 4O59O 1E0DA 1XDWA 1CWUA 5EINA 4BO5A 3H9EO 5TSDA 4E2YA 4BMSA 1M76A 4BO2A 5JE8A 1L7EA 1Y8QA 4XIJA 4NIMA 4XR9A 3RKUA 3NX4A 5B4VA 3U4CA 3W8FA 3BMQB 5BNFA 1Q7BA 3AI2A 4CLOA 2UUOA 2EJWA 2O48X 3MJCA 4ND2A 4ZQFA 3EVTA 5DN9A 2ZTLA 4OH1A 2XF8A 3I6QA 4CUJA 2H5LA 2ZB4A 2Z5LA 3ST7A 3GDGA 2GN8A 2WYWA 3F6YA 4FC7A 3VPSA 3WFIA 3JTMA 3EC7A 4ZVVA 3NJ8A 5T64A 3ONEA 5IZCA 3F5QA 4XD2A 4RJTA 3KETA 2ZQZA 3C24A 4MVJD 1F06A 2O4UX 2J5RA 3K73O 3GEMA 1EDZA 1H94A 3KEQA 2JL1A 4JROA 1EUDA 4UUMA 1K0UA 4E12A 2EKPA 4IPTA 2D3TA 1PZHA 4R16A 4KWHA 2J3JA 2C82A 1X1EA 3R1IA 3KLPX 3KUXA 4OQZA 1E92A 3HG7A 4RLSA 1NQOA 4RF5A 2YV3A 1HYGA 3GRPA 5TJ9A 2CZCA 1Y81A 1I33A 3GDFA 1H6BA 3DZHA 1GFSA 1O5IA 3JV7A 3PK0A 4W9NC 1ML3A 3DMYA 4TRMA 4P4LA 4XGKA 1U3TA 1KVRA 4PRKA 1O94A 4EJMA 3L6OO 4FIZA 3TZKA 1EK6A 3SJ7A 1AXEA 1GCUA 3I9JA 5CAEA 4D3FA 3UGKA 3I1JA 1TI7A 3AUUA 4W82A 4XGNA 1H6CA 4DQUA 2QYSA 3QHAA 3HDHA 5IZ4A 4NR0A 5JMPA 1C0PA 4IGEA 4TROA 3DBVO 2VRCD 1PJ4A 2A35A 5L40A 1E1LA 1A72A 1T2DA 4QO8A 2NLOA 3PXXA 3E9QA 4C4OA 2AQHA 1MG0A 4II2A 3A4VA 2D5AA 5L4NA 3EAGA 5DNAA 5MGBA 4CMIB 3ANLA 3SC4A 4G81A 4EITA 2GNAA 3LT4A 4BS9A 4YJFA 4B3JA 1WXDA 4CJXA 1X0VA 1H2BA 1H0KA 1YDWA 1Q0QA 4L8VA 5JCJA 3DBRA 4YTEA 5F3RA 3GVIA 3NGLA 2WM3A 4EJ6A 1U5CA 5DCYA 1EVYA 4YDRA 1Z6ZA 2DTXA 1XEAA 5EPOA 4BMVA 2X23A 2B36A 1NFFA 4MP3A 4AJ1A 4BNTA 4DC1A 4JJFA 1DOHA 1DC6A 3PWSA 1XLTA 3HNPA 3VC7A 4CM7A 1B3RA 3UAGA 1E6UA 5HS4A 3EYWA 1QYWA 1HDRA 4MINA 2FPGA 2FRDA 4OXKA 5T6BA 3ZCXA 3TDKA 1LSOA 5JSFA 1Y1PA 1BW9A 1HE3A 1RYDA 2A94A 4M1QA 3CEAA 4YJGB 1EZ4A 3PRJA 2QRJA 2HAEA 4JNKA 3JQAD 4YT4A 4N5NA 2Q1UA 1ADBA 3KVOA 4YAEA 5KOIA 4I5DA 1ZSNA 2JHGA 1A7KA 4FFPA 3FNFA 4EYEA 5F1KA 4PVCA 1ONNA 9LDTA 1DDOA 4UUPA 4CR6A 5A04A 1C1DA 3FPCA 4H3VA 2PY6A 3MWEB 4WLOA 2FZWA 5CDSA 3DAGA 2EP5A 4B4OA 1ORRA 4YT8A 1P1FA 3I3OA 3TF5A 1XQ1A 4OOFA 3NKLA 4B8ZA 1I5RA 2JAPA 2VWQA 5FI3A 3UOGA 2VYND 2WYUA 3OHSX 3ZW9A 5KWEA 2PZMA 1RWBA 1G1AA 3DDNA 2GDZA 4K26A 4E21A 2IEBA 5KKAA 4L73A 4XYLA 2W98A 3TZ6A 3QWIA 3RI3A 3GH3A 2QZZA 5GY7A 4GGPA 1A5ZA 4OSPA 2FSVA 2CD9A 5TLSA 1UXKA 2SCUA 4XWYA 2EXXA 3MTJA 3VOSA 2IODA 1ISMA 3AY3A 4QQRA 4YJDA 5J23A 1TXGA 1PJSA 2NV6A 1PJBA 5KKCA 4Y6RA 3D1LA 3WWYA 3U4IA 3I52A 3BA1A 4JK3A 8LDHA 4Y98A 1RM4A 1E3WA 3W4IA 6ADHA 1HDXA 4CQMB 5IG2A 3S2FA 3WGQA 4EUHA 1ONOA 2ZIZA 3RASA 3PHHA 5CDTA 4GH5A 4W9NA 1T2FA 1VL0A 3PJDA 4MDHA 3AUSA 1PR3A 3DZJA 4FR5A 2Y0EA 1VL6A 1PL6A 1LXCA 4XYMA 3RUCA 4N7RA 1AGNA 2H6EA 2FPPA 5CPBA 1W4ZA 1VRWA 1LC3A 2CDAA 3EW7A 3F9IA 4PG4A 4L0QA 2QW8A 1WW8A 3FBTA 5IXSA 4P38A 4NDNE 4OO3A 3AUAA 3ANMA 3GF4A 2VN8A 2BFOA 3IKVA 5TIIA 4K28A 4KUEA 3HJAA 3PWZA 4DVJA 3FNGA 4Q3DA 5A5EA 3W4JA 2UVDA 4J4TA 4TKMA 1WZIA 4IUYA 1T4DA 1G6KA 4PLFA 4IXTA 4JJIA 3TRIA 4WCFC 1LUAA 3C1OA 4OHUA 3S8MA 4MVJP 4YYZA 5JAQA 4KUGA 2NU6A 2PD3A 3GHHA 4YRDA 3H7AA 1KVUA 4KZPA 5JCXA 4FGSA 4BHTA 4J1TA 2B5VA 3HHPA 1HYHA 2X22A 3ZNNA 5HM8A 1CRWG 4L76A 4WLFA 1U4SA 1PQUA 2P4HX 3GAZA 1YOVB 3LC2O 3S2IA 2G1UA 3AJRA 1K3TA 1JTVA 4AJLA 2B37A 2YHIA 5G4KA 1QYDA 1P44A 4D45A 1PJLA 1GQYA 3L4BA 4IS2A 3H9UA 4XKJA 3G1TA 5KJFA 2PGLA 5L7TA 4Q3NA 1PQWA 4LN1A 3I4CA 2C5EA 4ALIA 1IY8A 2OP0A 3E48A 3FTPA 3TZQA 3KXDA 4BNJA 4CQLB
chains in the Genus database with same CATH superfamily
3A11A 4FHCA 3C98A 2PJUA 4L72A 1H4QA 5EQFA 1VI5A 3MF4A 2JFBA 1S3FA 3TLBA 1UXOA 4L3WA 1QRDA 4E4TA 3FPBA 1DO8A 1II8A 1NJGA 4G4SO 2EBWA 2WKSA 1TK9A 4G86A 4RD6A 1W8IA 4Q9HA 1XNRB 3DNPA 4WZAE 3VTAA 3M6WA 3DEZA 4UOZA 3TD2A 2X0EA 2ZP1A 3W9UA 4IH9A 2Z0MA 1T2UA 2J7KA 2GJSA 4PPGA 1FJHA 1PJ3A 3GFBA 5A4FS 3EH2A 4EI8A 3BPSA 4R9NA 2REQB 2DM6A 9ATCA 2WQ6A 3ZD7A 5EJ9A 2H3HA 1IDOA 4KB5A 3ET5A 5SYAA 8GPBA 3OPYA 1W4RA 2P4EA 1BHO1 1KEEB 1WCYA 2P9BA 2IP2A 3E3NA 4KO3S 3USZA 3D2LA 4I36A 4NHOA 2XB9A 2ID7A 3CLRD 4EG5A 2VSYA 1M8FA 5AW6A 1CRQA 4XWWA 4F5DA 4FKZA 1JT9A 2AXPA 5K3SA 4AY6A 1SRRA 3H18A 4BDTA 4QBKA 3EDMA 4B84A 1A9XB 2QN8A 3IJRA 2F9MA 1VJTA 3DZBA 4DMUB 1X8JA 2Q1WA 3T3OA 3W9SA 2NXJA 5AVWA 2WOOA 1G3IA 1Z2NX 5FUBA 1IBCA 3GG9A 4MVJH 3VHRA 3UUGA 4TGLA 1PT7A 3H05A 4B7AA 4LCJA 4ATNA 3TPCA 4GKBA 2QORA 1FP4B 2PA3A 5ERGB 1PZFA 1UMCB 3D0RA 3T4XA 3CE9A 2BMWA 2C94A 1T4MA 3C39A 4BVEA 2BYTA 1OGIA 2EL9A 3INNA 3LUBA 4RDHA 1W34A 4YDSA 4F1JA 4RZQA 5BRAA 2JAWA 1U9ZA 4MRRA 1UK9A 4AW9A 3KCQA 2XYQA 2PXAA 1X1SA 3K0CA 4CF4A 4R2IA 1JU4A 3K31A 5AW0A 3L84A 3RLFA 4IW3B 2BHLA 3ZWWA 3EXFB 1UDXA 3LDGA 4H7FA 2X1VA 4GHWA 4L95C 4OA8A 3VO8A 4C4RA 5CDGA 2LZ0A 2R44A 4FU0A 1XEWX 5CYFA 5H1YA 1PNVA 1NU6A 4YCCA 3FFBA 2A7XA 3BTSA 2PL3A 4DUPA 4EG3A 2VPQA 4JP5A 1RE0A 3D8HA 4TWZA 3PJGA 1ZHFA 2YWXA 4M9SA 4YRKA 2HCTA 4RKRA 2JASA 4U7FA 4Z1MA 4QATA 3G9XA 4BNNA 2FPMA 1HLGA 5HTKA 4DT1B 5JYBA 4AX4A 1ZMTA 3KLBA 1VI6A 1IC6A 4HAUA 4MUXA 3SOPA 1ICIA 1J49A 3BGIA 5CA0F 3OQMA 1U1DA 5C31A 3BXOA 4LYYA 5B2ZA 4F5ZA 1YJBA 2JGJA 4ZVQA 4G07A 5CVTA 3RS4A 1M1XB 3WLPA 1EFRA 1UEJA 1H6DA 1ZD4A 2XSZD 1BH2A 4OY3A 3UANA 2F64A 3AEXA 3BMOA 5D01A 3RVSA 1KYXA 3F5FA 5LWHA 1IXSB 1Q84A 5ENDA 1ZM3A 4RPCA 4OKNA 4UMVA 2UUCB 1U7PA 3CB2A 1P74A 2SHKA 2OXFA 3W9YA 4CN8A 1NURA 4C3OB 5J2UA 3WBJA 2WHQA 1GL6A 2WIBA 1TFUA 4FHDA 3O8QA 2VZLA 3ZDQA 1IOLA 3B1XA 3QQ5A 4U02A 1SIBE 2J9FB 2QSUA 3A2NA 3PQ5A 4U3JA 3RK1A 1L4BA 1T2EA 1BQ3A 4TUYF 3HYCA 1MFPA 7ABPA 1YZKA 3W5VA 2A59A 3JQ7B 1J0XO 1JMVA 5L4SA 3G1WA 4KQJA 4YJ3A 3KFLA 1X94A 2IYFA 4UAJA 1UWVA 2OWDA 3ORFA 5HKLA 1ZM2A 2FZVA 1GPKA 4AB1A 2VF5X 4TSKA 3ZBUA 2R87A 1YRBA 5K3FB 3QHPA 4Q16A 3F96A 5BP7A 2IZ5A 5JLJA 2DEUA 1DCKA 1Z36A 3L0OA 2F9FA 1NVGA 4BUZA 3AKYA 3AR6A 4KPGA 4K1XA 1JF8A 4TKUB 1JKJA 3LQYA 4IWYA 1EFTA 4UVGA 1BCRB 2RHLA 3RTGA 4QGFA 5DI3A 5F1YA 2DWCA 2CDBA 4DDHA 3DZ8A 3OECA 2UZAA 2QI9C 4U0KA 1GQ2A 4PNHA 1SR8A 3DV0B 4FGLA 1T0IA 2EKDA 1Y6RA 4EG0A 1DAOA 2YRWA 1R8XA 3FWHA 4KXMA 4GGOA 4MP8A 4P5DA 5TQ0A 3ZV4A 1R1DA 3DB2A 2NVUA 1XTBA 3TVYA 3UV3A 4XYEA 3G8YA 3PUYA 3K8QA 1MZVA 5FBKA 1P2GA 3K2QA 4PQRA 2EZ8A 4RV4A 4F9TA 5IM4A 4FE4A 1YZYA 4JC0A 4GMXA 4KDFA 4B71A 4YMTA 4EHAA 2PEYA 3ETHA 5ECDA 1KQPA 2HHLA 4YP9A 3C74A 5FTWA 1Y4AE 2BT4A 1J97A 3UT5B 4ZOQI 1XN4A 3TKYA 5H80A 2YWGA 2W0MA 2G1JA 3FCEA 4DLNA 4E6EA 2HI0A 1BMFA 2XWSA 3EF0A 3WSVA 2Q2WA 3W1VA 3ZXXA 3TQCA 4FT2A 2BI4A 1Y3AA 3V55A 4AJOA 5LQRA 2IHKA 1JJFA 4LK3A 4WCVA 1LPOA 2NU7A 4I5EA 4GFDA 3RHZA 1SOAA 1C0KA 4K6MA 2I66A 1AUOA 4JODA 4WOBA 4EKNB 3CTPA 1F0PA 5F1OA 5HA5A 5LMNB 1QFJA 1Z2EA 1TTTA 2Z6VA 1H66A 4UJ3A 1IY0A 1D8TA 5JFGA 3PC7A 1QF6A 2IOFK 3RFXA 5IABA 3OQIB 1Z15A 4M1ZA 1JLRA 1KJ8A 4BNKA 1N6OA 2R6GA 4L7VA 1S4MA 1EWYA 1XZKA 5H0IA 5HQTA 1X86B 2JLBA 1J56A 1RAIA 3DL0A 3QUTA 4CCWA 1SQ6A 2UDPA 4Z1MD 4GD3Q 1AY0A 5FJJA 5HZMA 3NP7A 3WSWA 1LBSA 2VAVA 3CKMA 3LUKA 2JVKA 2XGSA 4ILEA 2BEUB 1W9MA 2C3PA 2W2KB 2GRJA 5A3SA 1EK5A 1V16B 1L3BA 1NQVA 1JIUA 3NXSA 3S2YA 3I5XA 1IBKB 2HGZA 5C5CA 2JHPA 2ZT6A 3CG0A 4OB8A 3NUGA 5C8YA 1JPJA 5LQMA 3NB0A 2CMGA 5AWFC 3U3OA 2Z57A 4RPKA 5HGJA 3D81A 1AKTA 4OVKA 3K0CC 5TGTA 3TE7A 3W3AD 2PR2A 3D02A 5I4IA 3W5AA 2Q0XA 4IDHA 4B80A 1LLUA 1S8AA 1CRPA 3KSRA 3U09A 3KXPA 5KJ1A 1I14A 2PKYX 3CFYA 4QELA 4JT8A 2HLPA 3TQRA 1L3IA 2Z9BA 2HBYA 2IIVA 4C4AA 1QORA 1ZWKA 1P1BA 1Y8QB 5GVSA 4NFSA 4BMXA 4IKOA 4BC0A 2HK9A 3L4SO 2GVDC 2BWJA 3A9RA 3L6RA 5CITA 3HVRA 1H4SA 3FPEA 3A1TA 2VQDA 5EOVA 1NVXQ 1POWA 3GLHA 3FUCA 2MYPA 2XJ4A 2RK3A 4ENQA 4J1TC 5F5NA 1T3LA 2RC6A 1K4YA 1C9EA 1DIHA 2K5UA 2ZTUA 3SAJA 5DXAA 1CSEE 2ODWA 2JLUA 2HB6A 1ADYA 2YUIA 4I4LA 5JROA 4EYQA 1IZ7A 1KFEB 1DP4A 1LRLA 2OUIA 3AVVA 4ZCSA 1E64A 3G5TA 2XX3A 1WQ1R 5LQSA 3UYLA 1DRUA 2BR3A 2I2XB 3KFXA 3U7GA 5KOYA 2CNOA 1S6YA 5F2KA 4G89A 2VTBA 2NYUA 5ALXA 2O8EA 4NMMA 2Q4RA 4TKLA 5JYEA 5K8TA 4JLWA 1ANKA 4L5AA 4RFVA 3KQPA 4M0KA 1CIPA 4KSYA 2PXHA 1EPUA 1ZIYA 5F4ZA 3CIFA 3RS8A 1CQJB 1D7AA 2GEVA 1TQ6A 3W77A 1WPQA 4COKA 3HS3A 3KQKA 1Y9EA 4CODB 5TJHA 1G5TA 1MXHA 4EJSC 1M2OB 4NH4A 4GPAA 1NX9A 4FX5A 4MAFA 4RVUA 3WV4A 3E3OA 1MG5A 5HCUA 2JFQA 4G67A 3RU7A 3W34A 3PV0A 4QPCA 1X77A 4LBYA 5AVKA 1FB5A 3CRVA 2ZJ1A 4I6EA 3BIFA 1UMBA 4QRHA 3EK2A 1SCJA 2EKZA 4FYKA 2AJCA 2Q5QA 4ETNA 2GM5A 2GO7A 1WWKA 2Z3ZA 3DEYX 4UBOA 3VNUA 4LDQA 2QOEA 4B7CA 4CFZA 1CZHA 4YMIA 3TOZA 3CRRA 4LXUA 3BJIC 3LG2A 3VYRB 4N3CA 3CT4A 8ABPA 4DLWA 1DLJA 4BMZA 1JEAA 5C0OE 4Y1RB 4LIPD 5LR6A 2WAMA 1PN3A 4MI3A 4RIEA 4F6LA 3D6NB 3LT1A 1JWAB 2EFEB 1LV7A 1VG8A 2GBGA 4HDRA 4LMRA 2FW8A 1WV0A 4AO6A 4CZ2A 2PX4A 1H2XA 3EA5A 1MENA 4G8BA 5EZQA 3OLQA 1UMDA 3G8BA 4HQRA 5E2BA 4EHFA 3ZVRA 1QTNA 3PTLA 3TQQA 1D4AA 1JG7A 1LK5A 2WYHA 2O50A 3H1FA 3N2YA 1XRSB 1Z83A 2V54A 3JQGA 1V1JA 4M9RA 3QW4B 4YI3A 3FRJA 3A4TA 5GV8A 3R6GA 4J3NA 2FW1A 2W4IA 4RACA 3WKAA 1WKBA 3LBAA 5EHGA 1GEEA 3JQ9C 4DMLA 4PLVA 5H3CA 1F6BA 2FUKA 1M2EA 2ZUBA 3DMTA 1WEKA 3I64A 4QG7A 2OOSA 4XSHA 1DC4A 4P7KA 4DLXA 1VLQA 2AHRA 5E0OA 3TRFA 3OKFA 4HB4A 1Q7EA 1XZEA 3UT0A 3OFSA 3VO2A 2QJWA 4KV9A 2BGIA 3T3PB 3F78A 1E3WB 1XCGB 4PLGA 4S1NA 1GTJ1 1SULA 2EYUA 2DHCA 4YIHA 1J0BA 1SJ9A 4J1NA 3OOJA 1WRBA 1XZPA 1Y7HA 2DTEA 5F5XA 3BIJA 1MTZA 1FDTA 4D02A 3ND5A 4WMLA 1ECGA 1AKEA 2P2YA 2X14A 1Z4NA 1B0UA 1EU1A 1JALA 3W1EA 4DPKA 3OQOA 4TMVA 1UUFA 4K8OA 1T5HX 3FGPA 4ZICA 1GNQA 2HUPA 3RIXA 4WY2A 4FBGA 3L4KA 1X19A 4L9SA 4DCPA 3TYXA 3HGMA 4IIJF 1UXGA 2Z2XA 5HKOA 1NN0A 1NBWB 4EMSA 3SSNA 5FWAA 2PUAA 1W4LA 2PRJA 4KSBA 4PBTA 4Q93A 4D9JA 1QHYA 1B4DA 4RHEA 5EYPB 2W58A 3FMVA 5EZSA 3T9BA 1IXKA 4CE6A 3CUVA 2IU4A 2HV8A 1DEAA 3CVJA 3NHZA 3L7MA 1GU0A 4L16A 5FOUA 3QSGA 3PI6A 5KNLA 4MA0A 2IZOA 1NE2A 4YRMA 1LS1A 3AFMA 3GLGE 2ZSHA 4NOJA 4CKXA 1QB8A 3QFFA 5KDDA 4PGHA 4CMEA 3RRMA 1HEYA 3V4OA 3I6YA 4TYQA 3IODA 3B6JA 4YUAA 1OH5A 1T9GS 1UJ2A 1SWVA 2CEKA 1WLSA 3KWMA 5K4AA 2PRZA 5F4BA 1P2SA 4LCEA 3BEOA 5DP1A 2X86A 4G36A 1OUMA 4ZXFA 2R1VA 3TSCA 3Q9SA 5KIAA 3MRTA 3UICA 4AULA 3AM1A 1JQJC 4V0SA 2KMLA 5LNK6 3RBZA 3V6MA 2VNKA 4RBNA 3VISA 1P77A 5BSGA 3Q15C 2Q9UA 2J6HA 1XTKA 1H2HA 1OW3B 1VSVA 2QTGA 3P9PA 4MYTA 5BN1A 2NIPA 2VNJA 4PCLA 5AW4A 1DEOA 1PVVA 1M2VA 3RRNA 4AYTA 3ZHTA 1EE1A 1SFRA 5JH7B 1NIJA 1XMOB 3O8LA 3IDSA 3ZV3A 3OQBA 1L5QA 4DEYA 3RIYA 3ZCVA 3EEFA 1I10A 1Y3IA 3EJ6A 4FHFA 5I3ZA 3ZOKA 1MC1A 2BMJA 3OWHA 2H0RA 3W8RA 4F06A 4C30A 3LT0A 4X6XA 2GNPA 5JXJA 1OV6A 3B2EA 1OOEA 2A0WA 2RGDA 1QR6A 2AG6A 5CLHA 2ZCUA 3AFHA 4WXPA 3RNLA 3SNHA 1AV6A 2JA2A 1SUAA 3N0TA 1NMQA 3H2BA 5EY5B 1OIVA 4UZSA 5E4YA 5DX8A 1SU6A 2VJYA 1PZGA 1S9HA 3NV9A 3KOWA 3UIEA 4LSGA 2ORYA 1H3EA 3CJQA 1KYWA 2CL7X 2AG8A 3JD1A 1QSGA 1F48A 1XUOA 3LUGA 4OHFA 4YJHB 5L4LA 5LMUB 2FSUA 2O7QA 4XVUA 1MXFA 4D8UA 1WHTB 2C4TA 3BL8A 4ZV7A 1VKRA 4YCJA 2O3TA 1E2FA 5BYAA 1M6VB 1NJ8A 3AVPA 3BIOA 5IYZA 3SHWA 4BRSA 3X2SA 4IMRA 4DA6A 1FTQA 1ENPA 1Z13A 2ZSIA 4GVXA 1FFAA 2QUHA 4QSMA 3P9XA 4WK6A 3U16A 4EBFA 3C6KA 2XRZA 4YB8A 3HCDA 4M7OA 4X3PA 1ADCA 3D8BA 3IBTA 3OZ7A 5BWOA 4OI1A 3BTUA 2HPHA 5AKYA 1R9JA 2Y92A 4AJ4A 1H8HA 5F7XA 1AHNA 3LSYA 4B3MB 1E66A 1NJ2A 3IAS6 1PWEA 1IIRA 2BZSA 3OY2A 2J08A 3WHLA 1EXNA 2X7HA 4B34A 4JC5A 4LV8B 4K6FA 3UVEA 5SZJA 3MM4A 1H0RA 4EKIA 4RL6A 1KZ1A 1ZEMA 3EOBI 1GY8A 4UNNA 4ZQBA 4ZIRA 3MLEA 5IKEA 1QK5A 2E4UA 4E13A 1T2NA 4TMKA 3ENKA 1N6RA 3VVMA 3I8XA 4MW4A 2CUZA 1ZHOA 4COOA 4J4HA 2P2DA 1NVVQ 3OO0A 3OA2A 2G9QA 3GXOA 5KQSA 2IUEA 3OZUA 3UB2A 4E7OA 6LDHA 1CZNA 2IYNA 4M86A 4IQFA 4Z4CA 2W9XA 4G8CA 3FN4A 3DVAA 1A97A 1QKIA 1TCCA 1IN4A 4TQUS 5D3MB 3LRTA 4FZVA 3GLGB 5DBGA 1NLZA 4IMJB 3PPXA 4OLAA 4LOIA 3FOAA 2WR8A 3UWSA 1QZ3A 2UXCB 5J4YA 1N33B 2XTJA 3D6HA 1ESZA 1JIKA 3AERB 2B82A 3QWAA 3EPRA 5B3LA 5CEEA 3VR6D 3BA6A 3V1KA 2NXEA 2YV1A 4DMHA 1YS9A 3RR2A 2QL7A 3SQDA 3GZNB 3S1AA 1KJYA 2WYIA 2C84A 3UXYA 4MS1B 3NAZA 1DRWA 3VTZA 1V8FA 2ADFA 2Q3MA 3GYGA 3TPFA 2Z5GA 3CURA 2XCLA 3QUSA 3VR4D 1U9CA 3GRZA 2QP9X 5DN6A 3QHQA 3HDQA 1Z68A 3DOOA 1OWPA 3PKZA 4L6IA 3V33A 4ZOAA 1Y7TA 3WGUA 4RWEA 1HFEL 1SKAA 1CS0A 1UBCA 3IAUA 2J45A 4LDPA 3ROZA 3TBHA 4EB3A 1M66A 4B4UA 5LKRA 3VJRA 3HKCB 3RROA 1QZTA 3CLVA 5LB4A 4JEHA 3UG6A 1WMAA 1IK4A 1TVKA 2PX3A 2WD7B 1MC4A 1M6VA 2APJA 4G37A 5DISB 2AN1A 3N87A 3SQMA 3AVQA 3T7TA 4DWOA 1CQPA 4YR9A 3WIEA 1F7UA 2HBZA 3WHIA 4GO1A 1XIVA 2RKOA 4AUEA 3PX3A 3O26A 1ZN9A 2OFPA 4J94A 4URXR 1QFMA 1ZIPA 2X8AA 3THWB 1OFVA 1VBNA 3TFQA 3R41A 2YYSA 3L01A 4O5AA 3PFIA 1EVQA 4M49A 1G3QA 4U5XA 2ZRIA 3X2EA 4B73A 4PZEA 1Z9BA 2WABA 4ZDJA 4GC9A 3ELBA 4JBHA 2NUTA 1NLYA 1GU1A 2BDEA 2FU5C 3I12A 3DE4X 3MJEA 3IR5A 3FDZA 4MYCA 3OJCA 4JVOA 1U31A 2BMAA 1PT9A 3HUEA 4Y2JA 1OI7A 1VPDA 1K2WA 4L5CA 3PG5A 5KWVA 4MYHA 1GYRA 1U0LA 3EIWA 5ER9A 2MINB 3KKOA 2W6ID 1VSTA 3LECA 3UEOA 4PAWA 2BHSA 2VWPA 4RF2A 3RC1A 4ALMA 1XMIA 2WAYA 2Q4TA 3NU1A 2R47A 2SNIE 3SJBA 1WXQA 2A0XA 2W2LA 1H0SA 1ZK1A 2IPXA 2HV9A 1V9LA 1JA1A 1OT5A 1R00A 2WVHA 4FFRA 2WP0A 4FILA 4DR2B 4I55A 1G291 3H87A 1HKUA 3HB1A 3F8WA 2XOKA 2QM7A 1FRZA 4MUHA 2P9TA 2JFXA 1B23P 4M88A 1EE2A 4IZHA 2Z4RA 3AVTA 4C0AC 2WTMA 3IOBA 3FSGA 1V5IA 2E85A 1JHOA 2XKKA 4U7WA 3R3JA 4FMDF 4H35A 4RV9A 1RXEA 3HCWA 3KPUA 4UM8B 1SMKA 3TW6A 3VH4A 2XAUA 3ASYA 4ZQGA 3D8RA 1XCLA 3PGLA 2I7VA 4BX0A 2AFRA 4MPDA 2DG2A 3TH5A 4QUBA 4NP6A 3K0KA 1UDRA 4WLNA 4EZBA 3UJCA 2AUMA 8MHTA 4IICA 2NT3A 2HMVA 1GUAA 2ONKA 4CMIA 2C58A 1U0JA 4AS2A 4UFPA 5DX0A 3IAM1 3U17A 2HXGA 2I6QA 2VF8A 3FYTA 3IHKA 4X20A 3JD4A 4OUDA 3SEQA 3SGLA 3HCCA 4EGSA 2BH2A 1E79D 3FW1A 4KOEC 3LFTA 4CFYA 5K8IA 3GAFA 4NQZA 4RIIA 5E4JA 4NCXA 1JTFA 3TCNA 1CR1A 1JU9A 3QXCA 3T12A 1VQ1A 2GARA 4P93A 3JATB 3TI9A 1A7UA 4KPUA 1DAEA 3M6UA 4M6WA 4UUOA 1P75A 2P27A 1KQNA 1OWNA 3UMSA 3PPVA 2PO7A 2XJ9A 1SQFA 3L8FA 3ORSA 2UYGA 3SEZA 2QN6A 4B44A 4REOA 1CJSA 4CT0A 4AY5A 4XWTA 3HYRA 1UKVY 3H1BA 2BFFA 4PC6A 4QE3A 1YL6A 5LM3A 3FNBA 4D46A 1V1MB 2WF9A 1TVKB 3R3XA 4I99A 4F4HA 1KI8A 1R4NB 1J99A 2Q3CA 1C29B 3DW3X 3GT7A 4FE7A 3U3DA 2PLFA 4A36A 2ONZA 3T34A 3LQ4A 3DMPA 4AN1A 1U3UA 4ETWA 3WYGA 2QS9A 1JR3A 2ET6A 1RQNA 3LLUA 3NTLA 3MCUA 1E5TA 4BECA 4WZBB 1SK9A 1XLUA 1VCOA 2AK2A 2FQXA 2QQ5A 2I4TA 3Q40A 3QGMA 3TW0A 2ATEA 1G8MA 2NYVA 4V0KA 1SVUA 3Q2IA 2X3YA 5LVAA 3DV0A 4UNPA 4FGWA 4EF5A 2ZG6A 5AVXA 3KSZO 4GF5A 1D03A 3R8FA 3MOSA 4IUCS 4HNRA 1LU9A 2P9GA 5IDYA 4RA6A 3ZQJA 1MGOA 4AO8A 1X8KA 3EFBA 5CX1A 3RUAA 1KI1A 2N42A 4FM9A 4ZU1X 2W0SA 2YS6A 5G2OA 3RTEA 3S0JA 1TTQB 4X45A 2XUQA 3U4AA 1FXWF 5LYJF 3LVRE 2C9BA 1LLQA 2D5LA 3OPYI 2HA5A 1P1JA 3H5TA 3QKTA 4OQDA 1G42A 1EG2A 1ZLYA 2J3KA 1PR1A 2QM8A 5FBLB 3HBJA 3Q3EA 4R69A 5A2QA 4RZIA 2UYQA 3A2LA 5AHXA 2JJ8A 1NJ1A 3L7NA 4YRAA 1C4WA 1D0VA 1GN8A 1KA9H 3HVKA 2ZWOA 4C6SA 3NTRA 1GKUB 5UKDA 1L5FA 2E4AA 2I4IA 4HFJA 5M7EA 4GR5A 5ECGC 5EXSA 5AW2A 1USGA 3R8XA 1Q2UA 3PUWA 1HT1E 1YJ8A 4US0R 3LDUA 3LRPA 4M76B 3RIMA 2HA6A 3PNBA 2ZJ6A 1A8QA 1Z38A 4M54A 5JCOA 1P8AA 1AZLA 3S55A 3TTWA 1DAHA 3V7FA 5IUNC 4HQKA 1DB3A 4EA6A 2EX4A 2FUG1 2PDAA 4TVSA 3AW9A 1IUNA 3GMDA 2MR5A 3E2MA 4LYAA 2P78A 1WP4A 5EESA 4ZXPA 1EFHA 4BNUA 2WUGA 5JDCA 1GAXA 4KAJA 5FUYA 4G8DA 2FFAA 2G07A 3JQPA 3TQSA 4DYDA 2CVOA 4YAJA 1KJ9A 3RSQA 4WXEA 1OX4B 2WDPA 3K09A 3NRBA 2P9JA 1D2RA 3O0TA 4NBLA 1ORHA 5KCMA 5C4GB 4CDRA 3S27A 4ABTA 4WJZA 3M3HA 3MTDA 4TZ0A 3CWZA 2EIXA 1F12A 5FR1A 4KRGA 2GZDA 1ISHA 3T3NA 3WJ7A 4I50B 3G23A 1II8B 3H9CA 4M3NA 4NE9A 4PGFA 5COQA 3KYBA 5DLDA 5HQ3A 1OB5A 4BLQA 2AEMA 2Y1DA 4NSNA 4LXIA 5CP8A 2XYVA 1QYXA 2VZ9A 4F04A 3PF8A 5FYDA 3IVRA 4BJ5A 4MCHA 4NCBA 2HYDA 4AL4A 3BH7A 2B1GA 3FHCB 3ROEA 1YDHA 4BLOA 4GMDA 4KO8A 1K88A 4L50A 1P61B 1L5OA 1U8AA 1UT5A 3QITA 1TCAA 4FX2A 1DWPA 4LZOA 3ZIUA 2JAOA 1Z5GA 4IGKA 1NULA 5DTRA 2ISCA 5HE9A 4DIEA 1R7RA 1VHQA 3PHJA 1QHFA 4NV3A 2YOFA 4G1MB 4QGGA 4CTJA 2BY4A 1ZGBA 4S2UA 1D2AA 1GL3A 2NXCA 1A9YA 1MDBA 5FO1A 1N2XA 3RUEA 4AP6A 5IWAB 2X0RA 3L8ZA 1QIGA 1W5EA 1BMDA 4LRWA 4N0QA 1OXBB 2ZR8A 3NIWA 1I3MA 2J07A 5JMTA 3UMRA 4B9AA 2P35A 1WMBA 1DWUA 5FCDA 1SG9A 1BE6A 3PGXA 3FFXA 2CDRA 2F8MA 2VTBB 3FKSD 4HJXA 1OCEA 1RAAA 3GVHA 3AILA 3LHDA 4FOSA 3BOSA 4AUMA 1OB2A 3ZE7A 2LUOA 1VSUA 2G09A 3JYLA 4IKEA 4LC0A 4ND3A 3U81A 5CBPA 1XAHA 3RU9A 4QDZA 1YRLA 4YH1A 3SHOA 3IURA 3EGDB 3UPDA 2E4YA 3CRQA 3L8HA 1PR6A 1V2HE 4MGKR 4BNYA 4Z4IA 4FYYA 1TL7C 3FF4A 4IKPA 1R27A 1RVV1 1LDMA 2C29D 4GLOA 2IH2A 3ADOA 4HP8A 2OCAA 4IJ5A 4JUFA 2ZUCA 4MGYR 4P86A 3AHDA 1CNFA 1PFQA 2DT8A 4TWBA 1L7RA 4H1UA 4PAMA 1E1QD 4QDXA 4IIEA 4GS5A 2JD1A 1WCV1 4CQJA 2JATA 4JVLA 2WJ3A 2QRHA 5CK4A 3RVMA 2ERCA 2YFHA 3F5SA 3KP1A 5TGDA 1XKTA 3REGA 4AC9A 3TI7A 2WUWE 4BP9A 4MRMA 4DLVA 1AO0A 2CUTA 3MB8A 1C30B 1AF7A 1XRMA 3BWCA 1B2LA 1H3NA 3OICA 3PFHA 4GLBA 2X1MA 1E61A 4YS6A 2HDHA 1XAJA 1N0UA 4OK3A 2BPOA 4OFBA 3E9ZA 5ADVA 2C9OA 1PDOA 1ZVJA 3KUKA 1N2BA 4INPA 4LUCA 3GDHA 4XR4A 3ILXA 2QVXX 3L46A 5KDLA 4Z3DA 1UBNA 1WV1A 1FPMA 4AWXA 3PRKE 5A7GA 2GLTA 1JLHA 3C8UA 5K0SA 1CD5A 2PD6A 3PICA 1ODLA 3KOMA 2BEVB 3BFXA 5CVVA 1KRXA 1NFRA 3GV0A 3VBEA 4R8LA 1BWSA 1A82A 4G23A 2PIAA 4U7GA 2I7XA 3V8RA 1XZCA 5E7MA 4BLPA 2HGSA 2ZR0A 3HJGA 4RU1A 5GWXA 2RONA 4JJ7A 1TAHA 1D2EA 2GPWA 4CPDA 4GM1A 4QA9A 4EHLA 2QWXA 1G3MA 5LZ8A 4H31A 3CY6A 3KQLA 4R01A 4KGZA 1OBCA 4Q9KA 2C78A 1QKJA 1CDOA 2IDZA 5IARA 2H2HA 2QSJA 2QY6A 4UZFA 3D8SA 3VUFA 2WF5A 4U2FA 5FJIA 1Z4JA 4B3IA 1NDHA 2JGMA 2VCHA 2D0PB 3V8QA 1URPA 3F6CA 5KNBD 2GKSA 3ESBA 5L3QA 3JWHA 3KE9A 4WESA 3T1TA 4BMOB 4M0EA 4MYUA 5FFMA 3R3SA 5ANRB 4S24A 4GUDA 3W6ZA 3FI0A 4JJ8A 2LPMA 1ISRA 5T8KA 5I7EA 4BO0A 1M2WA 2XDWA 4HDSB 3K9CA 4QQFA 3D5QA 5G41A 4MDFA 3GFFA 3HU5A 1JKJB 1KI2A 2PV0A 1HE8B 4LGYA 1EVJA 5HR5A 1PT8A 4QFBA 1U7OA 2GS9A 4PANA 3CM0A 1QK4A 2E2WA 1ISIA 1OI3A 2AC7A 1XVUA 5I5EA 1QVZA 5K1ZA 1CULC 2VP3A 2WNSA 4MUFA 3L0DA 4FOTA 4PLTA 1L7VC 1K86A 4F6CA 1EESA 1NYRA 4EW3A 1D5WA 3R0QA 1Z17A 2B4QA 4N3AA 3GUYA 5DHUA 1C14A 1DIGA 1RCTE 5D87A 4K3UA 3GQVA 3JW8A 2I3DA 4EDFA 2C2KA 4IH1A 9LDBA 2ZBEA 1A4IA 1PI3A 2IX9A 2ZBRA 1TX4B 4ND7A 1IU9A 2YHSA 4OSEA 1N8SA 1P9RA 4AY2A 1J22A 2EBUA 1YFZA 2IXTA 4R0MA 1L5GB 3I1YA 5B58C 3DJYA 1U28C 3KO8A 4CEIB 1I3NA 3NYQA 5ALRA 2C88A 1BS1A 3QFTA 5BQOA 2CXSA 1U8YA 1N75A 3P0RA 4OI2A 5F52A 1Z22A 1KE2A 2D3WA 1VJ0A 1ZI8A 4PR3A 3I2HA 1SPBS 4TOIA 4ZP1A 4YMSA 4OGFA 1FFDA 2VSQA 4ZDKA 4PF1A 4I4IA 2VP4A 2NT4A 3AM4A 4KK3A 1YOBA 2PJDA 4P4GA 4I3GA 4XA8A 3H3JA 2A5DA 5EZYA 3OX4A 2O54A 4OHBA 1W4CA 1YB2A 3OHPA 4F9GA 4CI9A 4C4ZA 2VUHB 1OBHA 2O1SA 1M5UA 3EZ7A 4GW3A 5K0FA 1T1GA 2P7HA 1WXEA 3EBOA 4L7QA 5TVKA 3ZHYA 1D4ZA 5FUWA 3QX3A 2IITA 4LOJA 4BLRA 1SOMA 2Y66A 4ZAFA 3ZWXA 4Z4HA 4KQ1A 3R23A 3AOGA 3A31A 3ZJVA 3IUQA 3P5SA 1DAPA 4DZZA 3G2KA 2LR0A 3L6BA 3QE0A 3SX2A 1CDZA 1DKPA 4F21A 3HDTA 3AFGA 4GZMA 4JC4A 4FW9A 5M5BA 2ZLBA 2H2WA 2PYDA 1U2TA 2QLBA 2WDZA 2BJWA 4F7WA 2J3IA 2IWHA 2BGLA 3EG5A 4GG1A 3WK7A 4IVNA 1UP7A 2VJAA 1VHDA 4KUHA 3WIOA 4JLMA 1GSOA 2VKTA 3AJ8A 3HO8A 1JZTA 5I4BA 5CH5A 3LZCA 1XMJA 2C4HA 1RFGE 2CC2A 2PLWA 2Q3DA 3LPAA 16PKA 4LHYA 4OQQA 4QOGA 4BBZA 2CB9A 4ZJPA 1NM5C 3PX7A 3LBIA 2R3SA 2PKEA 3DLBA 3IIIA 3N7UA 2F3RA 3UV6A 4AYWA 3Q8XB 2WK1A 2X3UA 3WRXC 2HX1A 5DNCA 3V7WA 2HH9A 4H16A 2A1TR 3OEYA 1TYDE 5FUXA 1H1TA 3DBHB 3W79A 3O8RA 4G56A 1FQWA 3WSTA 1C7QA 5J2UF 1KGDA 1U9IA 1W93A 2Z2KA 1A50B 1SBYA 2ZJAA 3CPSA 3USCS 4DG8A 5KPJA 3QG1A 1F3OA 3CPHA 4C0XA 2VQEB 1CQJA 3L7AA 1X2EA 1JX6A 1U0FA 1TLLA 4X8OA 1GLVA 4TMFA 2FCAA 2IYSA 5CFZA 1X74A 1YZ3A 1XR3A 2IOQA 2PRSA 4V3CA 5T57A 3JVIA 3ZWMA 2XGOA 1YGYA 1Z26A 1BWPA 2HHAA 1J8MF 3CZAA 3V48A 5E7QA 2O3UA 1NVWQ 2C54A 3ZWPA 3MTQA 4JUBA 8ADHA 2XVXA 4EM6A 4HBGA 3ZHQA 1DBVO 4ROSA 2DC1A 4UEWA 1TAUA 4HQ6A 2MSCB 2DFDA 2WKPA 4LVOA 2ZYHA 1KH2A 3BIWA 1OREA 4P6VF 2ODBA 3EC2A 2JGKA 1XLVA 3O4VA 4PSAA 5LCXA 3T4PA 3ZZUA 5CYGA 1EXVA 1GSHA 4D8WA 4KWIA 2DJIA 4Y2GA 5FBWB 2RHMA 1HOXA 3NM6B 3Q85A 4KC0A 3C4JA 2IZZA 3EAQA 4QKQA 3TGLA 2YL2A 1L5HB 1T29A 2BE7A 2H06A 2EGUA 2IPAB 3O2QB 4A6EA 1QZZA 3QG5A 4E14A 2R66A 4BMYA 3GOHA 2IK8A 1DSSG 2QLJA 3V8BA 3PQCA 5U9CA 1EJBA 1OH7A 2HQSA 1WPGA 2PGAA 2GA9A 4H0NA 4W9RA 5TX7A 4E5NA 1XLTC 4LGCA 1ZU5A 4RO0A 4F11A 3LA8A 1OZFA 3G9TA 2KB0A 2W6JA 2FPXA 1WPXA 2QBYA 1OR8A 2G0AA 3GVCA 1JS1X 3MJDA 4GI2A 1P4JA 4E33A 4PCVA 3ROPA 1CHNA 3W2HA 4ZZIA 2PUFA 4UM5A 3MXOA 4QNRA 1NFQA 5I4KA 3ICPA 1N4DA 1PFKA 3AKDA 1QGED 2G9UA 3BF8A 4K8RB 4ZDWA 3T3DA 3IQWA 3LP5A 1H2FA 4IOKA 3PL5A 3GGGA 3X1KA 1E2DA 2VXYA 3R3ZA 3BYZA 3QLVA 1Z07A 1U0GA 1YCDA 2QY9A 3KKEA 3NATA 1AJEA 2R48A 1WHSB 1KFCB 4H1HA 1XO1A 4EECA 3LQ2A 3FBGA 1U8TA 4MB2A 5DSZA 4BGUA 2GPAA 3J81A 2B9EA 2R0QC 3DV2A 3GOQA 4K9RA 4PNPA 1DMSA 4QDTA 4P98A 2HJSA 1U11A 5A5VA 3BK7A 5HPYB 1SU7A 3ZDDA 4BNFA 3I4FA 1VMKA 5KUTA 5FD8A 1X7YB 2A1IA 1G21E 2QYHA 1I7NA 4B33A 4TV8B 5L8VA 4RQTA 1GL7A 1WHTA 2CNWD 5IM4F 3N75A 2FETA 3TG2A 3MW8A 4I1YA 4XPZA 1L4UA 4ZPXA 4DANA 1RTKA 2V98A 2Q3EA 2ZUVA 4PCUA 1RR6A 6GPBA 4EENA 1EA7A 3C7TA 3K1AA 3LY7A 3Q0IA 5C8XA 2G6TA 1KMQA 3K9HA 4Z2AA 1ZUNB 2QG9A 3ZWVA 3NOQA 3BAFA 3QLUC 3LO5A 4L5YA 2EFCB 2O5CA 1BQEA 2G80A 2Z1MA 1S1MA 4Q6WA 1EGAA 3X1WA 1SXJE 2GM3A 1Z8NA 1M7HA 1ZXXA 4LY6A 1JI0A 1E79A 1ZK3A 2VUSA 2XHEA 3QUCA 4EYOA 1JDPA 4H6XA 4OEHA 3EVGA 2CNLA 2WD9A 3BXFA 4IDDA 4DY4A 4CIXA 1WCXA 4WZBE 2VPZA 4PG7A 2BFEB 4MLCA 5AJUA 4P83A 2Q2VA 3CE6A 4LSWA 1NKVA 2FH5B 3ESZA 4MV8A 4JI5B 4W5OA 1FLDA 1QDEA 2CXNA 1PFUA 1EQUA 4YO7A 3DE3X 2WJJA 4G5RA 4J90A 3OUUA 2Q6LA 2DFVA 4JR0A 2P68A 3R7BA 2LGJA 2WMOB 3BZWA 3B52X 3OLWA 4TUYA 2DHEA 4B4WA 1RMTA 4ESOA 1I0IA 3ND9A 1VGRA 4PG6A 3TTXA 1E1QA 2YZKA 2X5OA 5KNDH 3KELA 4FYMA 4R1UA 5LD2C 4H4CA 1XZQA 3TWOA 4RKWA 3A6LA 1Y34E 4RD1A 1XF1A 2QRMA 3L0SA 4I46A 2OGSA 4D79A 1POXA 3SKVA 1DBWA 4RD0A 1YS2X 4P33A 2G0NA 4AKEA 5JZMA 2FLWA 1KMHB 2I4LA 3KXIA 1BYIA 3KZ1E 4QYTA 3VSCA 1LF5A 2XTZA 3C4VA 5C5EA 1FLAA 1IY9A 1I6KA 4FS3A 2AEEA 1BFUA 2ACEA 4MWEA 2EP7A 4MB6A 4N5LA 2NU9A 2P3OA 2R6JA 1DJMA 2QL5A 7MDHA 3PEVA 5JSUA 2HF2A 3PGA1 5L45A 3OFNA 4LOHA 4NS1A 2F1JA 1N0IA 4RDCA 1H05A 1ORVA 2A5GA 3K4HA 2RAFA 3ZIAD 4CMHA 4P3XA 2FZ4A 2CLIB 2GDJA 2WG0A 3G82C 3EQ6A 4KPUB 1P31A 4NBRA 4EP1A 5IC5A 3PT5A 2F7SA 1MGPA 1SN7A 2BI8A 3FOWA 3QU9A 4PQFA 4EW2A 4F4JA 2OSVA 3EPKA 4G0OA 4BX8A 2IEAA 3VFDA 4Q1VA 1SD1A 3JPWA 1OFGA 4BNIA 5GGXA 1P5RA 2B4KA 2AWNA 4KO4S 3K1TA 4TQAA 3KSBC 3ZOZA 3WYFA 1Q22A 5AFSA 1IMOA 4V1CB 1UDWA 1FTGA 3IDFA 2KW5A 2J3EA 2N75A 1I7LA 2B1RA 3NEJA 4LMAA 3IERA 2YOGA 3LX6A 3ZWQA 1IAVA 1HC7A 1MJGM 5G0VA 2E6KA 1HT3A 2FR8C 3BFKA 4N8SA 5SZHB 2RGNC 4XQ9A 3RSOA 3WDMA 2ZZNA 5BURA 1EWQA 2ZRMA 1SZDA 2WVGA 4LS3A 3E9EA 3OMXA 1PE0A 1D4FA 4UU0A 2Z58A 5SY6A 4C4TA 2VDKB 1DJPA 2AC2A 1BE1A 2JFUA 4OL9A 3V5NA 2V3CC 2Q0SA 3D3EA 3Q1KA 2C9CA 1ZGZA 1GZVA 3MS4A 1C4OA 4GWKA 6CHYA 1O6BA 1RWQA 3MPUA 4AQ7A 1GPWB 2JDIA 4HAZA 1PJCA 3GMTA 5M04A 2AI1A 2QRQA 2ZIVB 1BHSA 1I4LD 4BJ1A 4ROTA 1QV6A 1VJGA 3PDJA 1ST3A 7REQA 4RTKA 2AF4C 1SXPA 1R37A 1CUVA 1TM7E 3HU3A 1N9GB 4FXOA 1DQPA 5BN4A 1SA0A 1R6DA 3G0OA 5E9WA 1YR6A 1NLMA 1V11B 3VDXA 3UKDA 3BMNA 1ZD3A 3NT2A 2FVYA 3ZY6A 4X90A 3FPKA 5MFZA 1VFNA 1U5BB 2WSSD 3BX1A 1PWZA 1TKRA 3HUFA 2MU1A 3OH8A 3Q3CA 3WWCA 3KBOA 2FZCA 1PYOA 1O08A 3OIUA 5TF4A