4FD3A

Crystal structure of apo-formed ymtoar1
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
273
structure length
254
Chain Sequence
MHYLPVAIVTGATRGIGKAICQKLFQKGLSCIILGSTKESIERTAIDRGQLQSGLSYQRQCAIAIDFKKWPHWLDYESYDGIEYFKDRPPLKQKYSTLFDPCNKWSNNERRYYVNLLINCAGLTQESLSVRTTASQIQDIMNVNFMSPVTMTNICIKYMMKSQRRWPELSGQSARPTIVNISSILHSGKMKVPGTSVYSASKAALSRFTEVLAAEMEPRNIRCFTISPGLVKGTDSGTSAPAEIAEEVWSLYSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of apo-formed ymtOAR1
rcsb
source organism Saccharomyces cerevisiae
molecule tags Oxidoreductase
molecule keywords 3-oxoacyl-[acyl-carrier-protein] reductase
total genus 82
structure length 254
sequence length 273
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2012-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fd3A00
2Q99A 4A10A 1LDMA 1YH3A 3AOEC 2FOIA 3HE3A 1DOHA 3U4DA 1LTHR 4AJ1A 4BO6A 3GN2A 1RM3A 3DBHA 4WLUA 1X7GA 2NVUA 5CG2A 1S6YA 1X7DA 4RGBA 3IL2A 3DBVO 1V8BA 2AA3A 2Q2QA 3LZ6A 3STHA 3HZZA 1YWGO 3JQAB 1OOEA 3GPIA 3JYOA 3OF2A 4QEDA 1SCUA 4QFCA 2WYUA 1C1DA 4M86A 2CMDA 5JMPA 4E6PA 4R4JA 4BB5A 4R54A 2ZCVA 5JAQA 2C7VA 2W2LA 4IDGA 3RC1A 5C5IA 4U0KA 1I30A 3A06A 4RVHA 3B20A 5GY7A 3WWZA 3W4JA 2Q49A 1LC3A 1NTOA 4GSKA 4J0EA 1QLJA 5JYDA 4TRMA 1KIFA 1HDGO 5DZSA 4CR6A 2QYSA 4J16A 5TT1A 1SC6A 3JQBC 4O5OA 3WG9A 4E4YA 1T2DA 4C7JA 4Y98A 1ADGA 1M2WA 1Y8QB 5C3MA 3LK7A 1E3IA 4NBWA 1A9YA 4PRKA 4TWRA 5TJHA 2DC1A 3GEGA 7MDHA 1PJBA 5BNFA 3JYQA 2X0RA 1I3NA 2IZ0A 2G5CA 2VNSA 2B36A 4FR5A 4OSPA 4BIIA 2I67A 4XIJA 3WSVA 4Q3NA 1NQTA 3QIVA 2B83A 1TVEA 3DFUA 4HV4A 4FSHA 3HG7A 4WLVA 1WDKA 3WS7A 4U8GA 1M6HA 2NM0A 1DB3A 2A92A 2FSVA 3JQAA 1HDZA 3TDKA 4YT2A 1WLYA 2OP0A 3VZPA 1HLPA 3GNSA 4IS3A 2AEJA 1K3TA 4XR9A 1VKNA 2HUNA 3TZCA 4NHEA 4TROA 4TVBA 4XGIA 2RIRA 2E49A 4YXFA 2NQ8A 1YL5A 4Z0PA 2GDZA 1E6EA 1BW9B 2VUTA 4OXYA 1AXGA 3HNPA 3A1NA 3E1KA 3HN7A 4DIOA 3W8FA 2GUGA 3I4CA 3I6QA 3NX4A 3VPSA 2DTEA 2VHXA 2EV9A 2I3GA 4DBVO 1PJQA 4YJDA 1Z7BA 3FTNA 4B8ZA 3BTVA 2B35A 4D42A 1H94A 2B4RO 4MP8A 1O9BA 2IE0A 4YAIA 1ISHA 2V65A 1GYQA 3BYZA 2YYYA 1OC2A 3E18A 5AXAA 1HYGA 1GQ2A 3DBRA 3K5PA 1S7CA 3WR5A 3PZBA 4ZICA 4IJKA 1BTOA 1QR6A 4ZQBA 2QRLA 5JW6A 3SC6A 3TQHA 3AJRA 1NBOA 3MOGA 4PLHA 1V3VA 3VAZA 2EG9A 1DFGA 3OJLA 2VHVA 3V2GA 1UP6A 4H3VA 1B2LA 2BFAA 1V3TA 4FFOA 1NWCA 3LT0A 5IN5A 3OA0A 2DU8A 4I5FA 4XZ3A 3PTZA 4BKOA 5B4UA 1E7RA 2Y1OA 3KSDO 3RU9A 1T4BA 2UDPA 5JO9A 2OHXA 4JP2A 3RWBA 4C4OA 1KVTA 1Z75A 4G2NA 1EVIA 3EMKA 4BGEA 5A3JA 1U4SA 1EMDA 4IINA 4D46A 4B4OA 1RM0A 2G17A 1SOVA 3C1OA 4AFNA 2D8AA 3VC7A 1G1AA 3JQAD 1FDUA 4M1QA 3ITKA 3L9XA 4L75A 4LVUA 2VRBA 4CLHA 2BMAA 4TMFA 4P38A 4UUOA 5CDTA 4L8VA 1NQOA 2NU9A 1YE3A 2D5CA 4JBIA 4XWYA 2X58A 3OP4A 4XDYA 3C85A 4HX5A 4M89A 1BXGA 5C37A 2PWZA 4PG5A 2A35A 3NDJA 4EJMA 5JC1A 3W4IA 3AU8A 1YQGA 1RYDA 4TRRA 3FNFA 1ONPA 3KYDB 4DGSA 3PQDA 4IDFA 4GVXA 5I7FA 4II2A 4XRRA 3ZWNA 2PZJA 3GZ4A 9LDBA 1EDZA 1CEQA 4L74A 4PVCA 3S55A 2VOEA 1JVBA 3GVPA 1H9BA 4Q9NA 4RPKA 2FPPA 4NR0A 2PZKA 4JGBA 1IOLA 3CTMA 2NTJA 1JKFA 5A04A 5AOVA 5KJCA 2YQ4A 3GUYA 3KZVA 3PHHA 2CNBA 4OGWA 3LU1A 1XELA 2QIOA 4CLDA 1YBAA 5FI5A 1ZJYA 4QT0A 1OFGA 1H93A 4JXKA 1MGOA 2WMDA 4TZKA 4U0JA 1ZMOA 3CXRA 4BNGA 2I99A 1B16A 5KOIA 3TF5A 1DFHA 3DQPA 4G5HA 2JHFA 3NDRA 3W4KA 2CVOA 4BNZA 3H3JA 4CQMD 3OETA 1PS8A 1Q2XA 1SOWA 2NADA 3ZHZA 4RF2A 5KIAA 5KJ6A 4NPCA 4RDIA 1ZSNA 3UH1A 2CFCA 2XPCA 1ENYA 4EJ0A 4CQMB 4NBUA 4XCVA 3L6EA 3PPIA 2O3TA 4ALJA 3KB6A 3HDHA 3MWDB 1LNQA 4YJGB 4CLOA 1DIAA 4Y8VA 1XCBA 1WMBA 3RD5A 4DMLA 1DO8A 1X1EA 5KVSA 1HDXA 1DBVO 2EXXA 3DHEA 2CDCA 3FHLA 1WNTA 2V6GA 4ZJUA 3AOEA 3B1KA 1QP8A 2PD4A 3HFSA 4FC7A 1E0DA 4TQGA 1PZEA 3UF0A 4CM7A 1DIBA 4ZA2A 1SAYA 3ETEA 4F45A 2B5VA 1OC4A 1HWYA 1PSDA 3KUXA 2C54A 4H7PA 3NT5A 1KC3A 2EKLA 1BSVA 4NU5A 3JQ6A 2E6UX 3ZNQA 3TN7A 4YR9A 1P31A 1ARZA 4GKBA 1D4FA 3KTDA 4W6ZA 4BNKA 4DMMA 1R4MA 4Z9FA 5JAIA 3AW9A 2WD8A 4F6LA 5F3RA 4PG6A 4TZTA 4WCDA 3BXXA 1M75A 4OJNA 4YJGA 4L73A 3GHYA 3BMQA 4RZHA 1LSOA 4UAGA 2V6BA 4GKVA 4JIGA 3W1VA 1I5RA 4LRSB 4UVEA 2D59A 4QSMA 4RVFA 1TEHA 1Q7GA 3PHGA 3WB9A 2E4AA 3JQBA 4DLLA 3I9MA 4WLNA 1NR7A 3ROKA 3VKVA 3VZQA 5A5EA 3A28A 2DTXA 4ND3A 1JWAB 4EEXA 3PI7A 3OICA 1D7OA 2JL1A 3I3OA 1VM6A 3JQDA 4PLPA 4R1SA 1DIGA 4AICA 4MVJH 4CL3A 1CIVA 4J4TA 4BKUA 2PTGA 5TX7A 4MDHA 3RUEA 2O48X 1KEWA 3UAGA 3WGTA 4L4RA 3H9EO 1I24A 3GNQA 4CMJA 2RBEA 4CMKA 1Q0QA 3INRA 4XRGA 4GWKA 1YL7A 1UR5A 3KBOA 3QV1A 2C07A 2JAHA 2NU7A 3UCEA 6ADHA 1BXKA 5LC1A 2CDAA 3ANLA 5EINA 1BDMA 4RF5A 3V1YA 4DBZA 2DVMA 1X0XA 2BGLA 1PR9A 1DHTA 1E3EA 1HYEA 4M55A 2V6MA 2C5EA 1PJ2A 4FPXA 2BGMA 4PCVA 4A0SA 4B79A 2JD2A 2ZYDA 3M2PA 4YRDA 2HRBA 2QYTA 1KEPA 4XQEA 2ZTMA 3LVFO 3DOCA 5A9RA 4HUJA 3V2UA 4CM5A 1YQDA 1O6ZA 3D5QA 5IDXA 3VDQA 1HLDA 1EK5A 1ONOA 1E3JA 5COBA 3R3JA 2GZ1A 4J1NA 2JCVA 4KQWA 3HQ4O 3FSRA 3I6IA 3SX2A 1JAXA 3OFSA 3S1LA 1LSSA 3GOHA 1CQIA 5FWNA 1W4ZA 1Y9AA 3W6ZA 3HDYA 1EUDA 2QQ5A 3RC9A 1V9LA 4AJOA 1AXEA 2RH8A 4MOWA 2Y67A 1JKJA 3NV9A 5CDGA 3AOGA 1A5ZA 2CF6A 2RAFA 4QO8A 3K6JA 4CM1A 3BTSA 2E37A 4WLFA 4ZQHA 5FF9A 4BO3A 3VTFA 3PYLA 4J91A 4DXHA 3GHHA 3MJCA 1SEVA 6LDHA 4QO7A 2ZTUA 3AM3A 5BSGA 3DBRB 4RPJA 3Q9UA 5MGBA 3Q2KA 1E3WA 1U5CA 1E3LA 3IP1A 4WCFC 5K6AC 2G82A 3GVXA 2Y1CA 4G65A 2Y0CA 4PLGA 3S2GA 1HDCA 2UVDA 1ZUD1 4CUJA 2FWMX 1H6BA 3UCFA 3RASA 1TT5A 1EBUA 2P2SA 2FHSA 1EVJA 4CLEA 4IGFA 3ZWBA 1NNUA 3CIFA 1NPTO 4WECA 1WMAA 5IJZA 1KVUA 3JQGA 3UVEA 4HFMA 5HRUA 3EYWA 2O3UA 4O59O 4YAKA 1LC0A 1LX6A 1VC2A 3AM5A 2VRCA 3KLPX 3MCVA 4MVJM 4XJTA 3UCXA 3OQ1A 1E7QA 3FR8A 4EJ6A 4GL4A 1MG5A 3TOXA 3IOYA 3BMOA 4U6QA 1CDOA 3GT0A 4A27A 3NDIA 2HO5A 3VDRA 4I08A 3LSYA 1DXYA 4OYRA 1HZJA 3DBLB 3PFFA 3RFTA 1PGQA 1ZSVA 3WGGA 3ZW9A 1KEUA 4E2WA 2VUSA 4ALKA 2AG8A 4XB1A 3P5SA 3BMCA 1LXCA 2ZTVA 3EDMA 4PLVA 4UUNA 2GF2A 3ROMA 1PEDA 1LI4A 1YS4A 2BHLA 5L4LA 2NV6A 2R2GA 5G0UA 1V35A 3CMMA 4K28A 1IE3A 3E9NA 4WUVA 3WX0A 3CZRA 3F5SA 4FQ8A 4CV0A 4II3A 3KEOA 2HAEA 4BNYA 4RZIA 1R0KA 5CEJA 1PQUA 5ICMA 4PN3A 3F5QA 2Q50A 1N92A 3PIDA 1LLCA 5JCJD 1E7SA 5ER6A 3KSZO 1T24A 5JBIA 4GPD1 1QYCA 4MVJG 2EJVA 4GBJA 1IHXA 2GO1A 2VWQA 5KKAA 2PD3A 2OMEA 3C7DB 3KHUA 4BV8A 4PIVA 5THQA 1N1EA 2OXIA 1PL6A 1RM4A 3LQFA 3OJOA 3BAZA 3T7EA 5G0VA 1K0UA 3O03A 1DC4A 1XYGA 3PFWO 3GEDA 3H65A 1B0AA 3GMDA 3L4SO 4MPDA 4P4GA 3JQEA 3GAZA 4BNXA 5L3ZA 1Q0HA 2HMVA 2QRKA 3JYLA 3QVWA 3HFGA 1DC6A 4GX0A 1EVZA 4PZDA 4BO4A 5ILGA 2FR1A 1L7DA 3JQ8B 2ZKLA 4GGOA 1ZO8A 1WAMA 3ENNA 2UYYA 4MIEA 4BUCA 1IULA 4CLRA 3LC7O 1DPGA 3F6YA 1E92A 3DHYA 1HE3A 3LF2A 1PJ4A 1G0NA 3WGYA 4KQXA 1A4UA 1RJWA 1ID1A 5ES3A 4FFRA 3PJEA 1XWFA 2F1KA 1VE9A 2I5PO 1BG6A 5COAA 2O3RA 3LT1A 1XDWA 4L76A 4CL8A 1YB5A 1PQPA 5IZCA 4I8XA 3WDSA 1GL3A 3GY0A 3QWAA 2IEBA 1U7TA 5FEUA 2O7SA 4A73A 4YRAA 4L0QA 1P1FA 1B7GO 1UP7A 5G4KA 5IXSA 5TS3A 4NDNE 3JQ9A 4MKXA 2HK7A 2FP4A 4Q39A 3ULKA 4NBRA 2P9GA 4ESOA 1AHIA 1YGYA 3ICPA 4XGKA 5F1KA 5DBIA 4A7PA 4J9UE 3LC1O 1DLJA 2X7HA 1YQXA 5IZ4A 2AW5A 4AG3A 1W73A 1R37A 4E13A 1MP0A 4J4BA 3KYDA 5IFLA 5F5NA 2DM6A 3MJEA 3QLJA 2XOXA 4L9RA 2ZB4A 2C2XA 5B4TA 4OMUA 1F0YA 4BQRA 4JJGA 5JPIA 4OOEA 3NJ8A 2PGDA 3SXPA 4I5GA 2OUIA 2YV3A 4HP8A 1QYXA 5J23A 1KVQA 3QWFA 3B1FA 4Y6RA 4TKMA 1MUUA 4YTEA 4GAEA 4RVSA 4IIUA 5JLAA 3F1LA 3GAFA 2Y05A 3U3XA 2VYND 4B7CA 2Q2VA 4WNCA 4ZVVA 2HMTA 4CM4A 3CINA 2WJPA 4IQGA 4KP7A 4XDZA 1I32A 4U5QA 4ND1A 4AJNA 3ZV3A 5A5FA 3P7MA 3CKYA 1YOVB 3OBBA 4BNJA 1UUFA 4CUKA 5ENDA 2WDZA 5KKCA 3I5MA 3NGLA 4R3WA 1E5QA 4MVJP 3JQ7B 4XX0A 3BIOA 8ADHA 3G79A 4P8RA 1GY8A 3GDFA 2YDXA 1GAEO 4M87A 4Y67A 4CQLB 1B3RA 4D7AA 4CODB 4OM8A 5TIIA 4BKPA 3I9NA 3JCZA 1T1RA 4CPDA 1JAYA 3ROPA 3ZI0A 4IZIA 3CE6A 4FS3A 2PZMA 4CMGA 4J4HA 4AJEA 2WYVA 3BMCB 4JP3A 2JD1A 1UXHA 1GYRA 1ISFA 3RBVA 1R66A 5ITWA 3M2TA 4L4XA 2DAPA 3MWEB 1J49A 3QW2A 5FFFA 3P2YA 4JROA 4DC1A 1JDJA 1NFRA 1KERA 4EGFA 4IMRA 1FXSA 4TRJA 3GK3A 4WNIA 2I3AA 3NEPX 3Q2IA 5CPFA 4J9VA 4B4UA 5AXCA 4N54A 4AJ4A 5ER9A 2QX7A 3F1KA 1FK8A 1XHLA 1HDYA 1P74A 3ZNPA 1DIRA 1YDEA 2GN9A 3D3EA 4WOKA 3I23A 3IAHA 3ZWOA 3RJ9A 1GU7A 4IDCA 4RVGA 2WD7A 1P9LA 3GN1A 2VWGA 2DFVA 1KYQA 4DLBA 4AJHA 2YFQA 4IJWA 4TSKA 4IIVA 2X9NA 3L9WA 4D3DA 1UXJA 1H6DA 4YT8A 3LF1A 1EFLA 3QRWA 3W8EA 5A9TA 1E3WB 2PV7A 2HDHA 1GTMA 4GX5A 3RKRA 1AHHA 1D3AA 3DZFA 3TFOA 1O95A 4JN6B 4MP6A 4P22A 3ZH2A 4ZRNA 5DF1A 3F47A 1GQQA 1NFFA 1YBMA 4O63O 1N1GA 3FPCA 4BMNA 4J7XA 3O26A 2ZQYA 4YAGA 1RPNA 4EDFA 2ZB7A 4JQCA 3DAPA 1DJNA 5EMHA 3ZV6A 2ZB3A 3PWZA 2Y0EA 1LDYA 1BVUA 1JW9B 1DHRA 1UXIA 1JTVA 5JMWA 2B5WA 4IGEA 9LDTA 2WM3A 3JYPA 3IMFA 4EEZA 1DIHA 3ZNNA 2OBNA 3ABIA 5F1OA 1JWBB 4J43A 5DDIP 3R1IA 4H15A 4OXNA 3LDHA 4RPHA 4QTZA 2J3KA 2VQ3A 4X54A 1E5LA 4AL4A 1GD1O 1VL0A 4RORA 3ZNOA 2DPGA 5I8WA 1M6WA 3FR7A 1HKUA 4GQAA 5BT9A 1DDOA 4Z3KA 1EUZA 1JU9A 4NFYA 5IN4A 4PLFA 3RBZA 1NXQA 5C7OO 3GVHA 2GN4A 1ONNA 2C29D 2Y1DA 3G49A 1X7HA 3RUHA 3TZ6A 3WQQA 1DAPA 3U09A 1VI2A 3GUCA 1ENPA 4J2HA 3VZRA 4Y6PA 3V5NA 4MP3A 3K30A 4IDBA 5DP2A 1M76A 1EUCA 1BW9A 4WK6A 3WGQA 1Q7CA 2PH3A 2VWPA 5THKA 2WTBA 4BMSA 4EUFA 1ENOA 2NVUB 2DUUA 3ADOA 4K6FA 3W8DA 4PVDA 4KMSA 3AY3A 4W4TA 4BNTA 1PZFA 3WWYA 5KJEA 4I9HA 3X2EA 4E2ZA 2EHDA 1Q7BA 2E48A 1Z73A 3WMWA 1U8XX 2D5AA 3DOJA 1PX0A 4I9NA 4QUKA 3AI2A 3HB4X 3PJFA 3DC2A 3DXFA 1LBEA 4GH5A 1ORRA 2POQX 3OEWA 5BSHA 3DL2A 3G1UA 3OIFA 3DFZA 2J3IA 2YZ7A 3PGXA 4OHUA 4PZCA 4IY1A 4GGPA 1RYEA 1LA2A 2CUKA 3TNLA 5IDQA 5U1PA 4Z6KA 4MJLA 3EAGA 3F4BA 3ZWXA 2C59A 2R00C 5I7VA 4KUEA 3QY9A 3WQRA 4UEJA 1C3VA 3QQPA 2IYOA 3LC2O 4GMGA 1HE4A 4JJIA 1JN0A 2RCYA 4YDRA 3F4LA 1P45A 4IUYA 4DIBA 1C0PA 1PJ3A 1UP4A 3ICCA 4HFJA 3WYBA 1PIWA 1XR3A 2O4UX 5KJ1A 5CDYA 1Y5MA 4FOOA 3WGHA 1R15A 4UREA 4IQ8A 5DNAA 5MDHA 3RFVA 3X2FA 4BL5A 4LGVA 3UXYA 5JDIC 1I2ZA 1UXGA 2CVZA 1XLTA 3NKLA 1BGVA 3LLSA 2O23A 1EDOA 1Z6ZA 2ILTA 1HDOA 1ZIDA 3WTBA 3GNTA 1XQ6A 4ALIA 3ZHBA 2VZ0A 2YQ5A 3D3WA 3LLVA 4XKJA 1F8FA 2UV8A 4I9UA 1NAHA 4Z0TA 2UUOA 4R16A 2HCTA 1I2BA 1UAGA 3VKUA 4P4LA 4KOAA 3AUUA 3OJEA 3U4CA 4BO8A 4DIFA 2DFDA 2FSSA 2IZ1A 2GASA 3PGJA 1ISJA 2SCUA 4UVGA 2IDZA 1R0SA 5A1TA 2D4AA 4I5EA 2Y1GA 4NH4A 5DBGA 1ENZA 5A9SA 5CG1A 5EERA 3RUIA 2AXQA 2XXJA 1KVSA 4YT4A 1NVMB 1M66A 3AY7A 4YT5A 2BD0A 3H5NA 3D4OA 1GUFA 2R6JA 1J6UA 4IPTA 4WCFB 4XYBA 4Y9DA 4TRNA 3JQCA 1DFIA 4J90A 4M54A 3PVZA 4JNKA 4JJFA 3WGOA 4W7IA 3DEYX 3G3EA 3TZQA 4U6SA 4E3ZA 5G4KB 2EWMA 1U8FO 1Y9EA 2J3HA 1ZVMA 2B69A 4PG4A 1ZSYA 1PZHA 2W4QA 4BO0A 1HSZA 2W2KB 3FI9A 4IJVA 1GV0A 3GGPA 3E5MA 4W9NA 2NU6A 4LW8A 3WGZA 3BZUA 4CR7A 2QG4A 2QRJA 2O3JA 4MVJF 1U3UA 4OO3A 1W6UA 5TSDA 4ZD6A 1Y6JA 3DTTA 5JCJA 1U2DA 5DN9A 4CM8A 1KS9A 4XQ9A 3TZKA 4JBGA 2P5UA 5DP1A 2J6IA 3RUDA 1DC5A 1CYDA 2RHCA 1YRLA 3GVIA 1MB4A 5A03A 5BNTA 1YO6A 1C0LA 4BOYA 3NJ4A 4PLTA 1O89A 4J7CA 3P2OA 1CERA 4AJLA 4O0LA 2DPHA 4WEQA 2GPTA 1E1MA 2V7PA 4J49A 2PGJA 2VTEA 2B4TO 3JD1A 4HXYA 3QA9A 5TF4A 4YYZA 1U3TA 3GA0A 3Q6IA 1BWSA 3QVSA 1XU7A 4BKRA 1E1KA 3HADA 3KRTA 3OM9A 5EJ2A 4IQ0A 2X5JO 1O94A 3WQSB 4UVHA 4ND2A 4BNFA 3H6KA 3S2EA 1FDWA 3PHJA 2CF5A 3VH2A 1LSUA 1ULUA 1AN9A 3CPSA 3TOZA 2CY0A 4FFNA 5BSEA 3FCOA 3SLGA 2C0CA 3ETGA 4AJIA 2JFFA 2ZJ0A 2NUAA 3K92A 3PYXA 4MO2A 1NVGA 3PWKA 3WXBA 3I4FA 2DBQA 3ZWCA 4GLLA 2OGUA 5U9CA 5HS4A 2VHZA 1KY5A 2F00A 2VUUA 4M49A 5ICSA 1XG5A 1I3MA 2FY8A 4M8SA 4BMVA 3MJ4A 5JXWA 4OKNA 3VTZA 2X5KO 3PEFA 2ZTLA 2P68A 4CM9D 2JCYA 1H6CA 4CMIB 4FC6A 4UVDA 5TT0A 2O3SA 1FF9A 4CM8B 1UZNA 2GR9A 1YB1A 2P9CA 2W8ZA 4D0SA 3EUWA 1T25A 3ZWYA 1PGJA 4WASA 4HBGA 2AE1A 1C1DB 4GI2A 2FZWA 4F46A 4NQZA 5H82A 4EBFA 2JJYA 2G1UA 4UVIA 1IPFA 4PFJA 1E3SA 2CDBA 2C7GA 3HSKA 4BNNA 4ILKA 1LU9A 2EGHA 1MC4A 2X9GA 1AUPA 4DPLA 1HYHA 1NASA 1CF2O 1O5IA 4CV2A 3WBBA 3M1AA 4PRLA 4B8WA 4IDAA 1Q1NA 5KTKA 3LT4A 1DSSG 4K26A 1L1FA 4XQGA 4W82A 3L77A 4DVJA 4YAJA 1OAAA 4R68A 3SJUA 1NQ5A 3A14A 3EVTA 4MKZA 1WXDA 1A4IA 3B1JA 1I8TA 2X6TA 1I0ZA 5F5LA 4FOSA 2AG5A 2GSDA 5JC8A 3ZWMA 1TI7A 4IXWA 4R01A 4E5MA 1ML3A 2WEKA 2VT2A 1G6KA 1CETA 3DOOA 2GN6A 1P33A 3KEQA 4XYEA 2OOSA 3WBFA 3EZLA 1GUYA 4B3JA 4PZEA 1KETA 1N2SA 1TA4A 4E2XA 4LSMA 3GPDG 3ORFA 4YJFB 5B4VA 4AJ2A 3FNEA 3KLMX 3RKUA 4YJFA 3KETA 1LLUA 3EC7A 4MVJE 5A02A 4CLOB 4DWVA 3ADPA 2GNAA 3IUPA 1LJ8A 1N8KA 1HEUA 1P0FA 3AFMA 4CMIA 1PR3A 4ZHSA 5T57A 4WKGA 1PWXA 1V0JA 1MC5A 2WSBA 2NU8A 1GFSA 1LQTA 1R6DA 2DQ4A 3GG2A 3DBHB 1VRWA 4JBHA 3I9JA 5DOZA 3EHEA 3L6OO 1RWBA 1QG6A 1LRJA 4D43A 3ONEA 3WJAA 1DRWA 1KBZA 2FN7A 1MFZA 4KZPA 4F3YA 3L07A 3RC7A 3HDJA 3LYLA 1X0VA 1JQBA 1UH5A 1TLTA 1NX6A 3ITDA 4QQRA 5JDCC 5AXBA 5A05A 2O50A 1BXZA 3DZIA 2LDXA 2EJWA 4ZQFA 3G1TA 3SC4A 3D0OA 2C82A 2ZQZA 4I5DA 3TZHA 1NHWA 4XJSA 3QHAA 3GGOA 2HMSA 1A7AA 5B1YA 2VZ8A 3WOHA 1R0LA 4IMPA 5JY6A 4BNVA 5KVVA 2VT3A 4YCAA 4HNGA 3HHPA 4FJ2A 1H2HA 1BVRA 1SZJG 4WCFA 4RCVA 4HY3A 4CMHA 2WE7A 2NNLD 4U7WA 4GX2A 2DBVO 5KVCA 3GFBA 4RPGA 4NFHA 3E03A 1ZFNA 4IDDA 2YFHA 5CEEA 3E82A 1B8UA 3RSHA 4YRBA 8LDHA 1A9ZA 4E5PA 3K9QO 3GF4A 3ASVA 5L9AA 3VH1A 1I33A 3FNGA 4KUHA 1ZK4A 4IXTA 2O3QA 3K8ZA 3ZU3A 3WYCA 3M6IA 4N5NA 3NTRA 2AQHA 3TL3A 1WWKA 2DBRA 1WPQA 1VJTA 3D1LA 4A5OA 1EZ4A 2HSDA 3QVTA 2FMUA 1AE1A 5DCWA 1X13A 1E77A 4DPMA 5I7EA 4A26A 3K2BA 5T8KA 3H3FA 5C7LO 1H2BA 4ID9A 4EUHA 4FDAA 2YHUA 3ON5A 5HBRA 1OMOA 5IF3A 1SO8A 5JDCA 1C1XA 4NG5A 2AEFA 2PR2A 1Q0LA 1EEHA 5F21A 3LT2A 3H5AA 4YACA 3UOGA 3AUAA 2PKRA 1K6XA 1UZMA 4MVJI 1EQ2A 1ADBA 3QWIA 3WNQA 4B3HA 2W90A 5KCZA 2OORA 1QMGA 4MKRA 4TVOA 1GR0A 1E6WA 5CAEA 1I01A 3DTYA 4E21A 2Q4EA 2GRAA 4HNHA 4GLOA 3GDOA 3VZSA 1A27A 3DZHA 1MG0A 1GYPA 1W0CA 2P9EA 3F46A 1JVSA 1WZEA 2GERA 4GMFA 4XD2A 3UUWA 3O9ZA 1ISMA 3IUSA 3COSA 2HK8A 1TXGA 2ZIZA 4K9DA 5GZ3A 1PJLA 1DAOA 4D79A 4MVJA 3N7UA 3CSDA 3ST7A 4RQUA 4KDFA 4YA6A 3U62A 2FR8A 2JFGA 2P4QA 4K6CA 3NAQA 1B3BA 1YDWA 1ZW1A 3JQFA 4ND4A 4IS2A 3UKOA 4EITA 3DONA 2NACA 1KVRA 1O0SA 2UUPA 3H2SA 3H9QA 1T2FA 3JTMA 2CD9A 3ONFA 3WNVA 5EQFA 1Y7TA 1MX3A 3VPXA 5A3VA 2PA3A 4PG8A 4O1MA 1PJTA 2IXBA 1K5HA 1IPEA 3I1JA 5EQDA 5JAZA 4N5LA 3DZJA 3Q3CA 1LLQA 4LCEA 2BLLA 1XSEA 2B4QA 1HSOA 3WIDA 1T2AA 1EQUA 1PWZA 3AFNA 5TRTA 3PLNA 3E6AA 4YWJA 1ADFA 3U0BA 1CQJA 1U5AA 1J5PA 1BDBA 3HUDA 3E9QA 4OXKA 5AYVA 3DZKA 3BHMA 5TNXA 3GZNA 1QV6A 3VPHA 5HTOA 1J4AA 2Y99A 2VCYA 4BS9A 3ZZNA 2EKPA 3GRPA 4QXMA 4BO9A 4WEOA 4D3SA 1J0XO 4Y6SA 4PLWA 3IJRA 5BR7A 2FRDA 2BKAA 4FJ1A 4DC0A 2C5AA 4KTVE 2OL4A 1QSGA 3KYCA 2X1HA 4BNWA 4RLHA 1XQ1A 1GV1A 4FW8A 1GZ6A 1WDLA 4E32A 3H9UA 3JYNA 1EVYA 3C8MA 2YHIB 1DJQA 2BGKA 2HU2A 2YY7A 3MZ0A 5T6BA 4JCOA 3K2EA 4UEKA 3DMTA 1ZBQA 3SJ7A 1F06A 4E30A 1UDAA 5JCXA 1P1KA 1W8DA 3WICA 3SVTA 2QW8A 2DUWA 3G17A 1PQWA 3FF4A 3PQEA 2X4GA 5AQ1A 4KDEA 2Z1NA 1T1SA 5G0WA 1PTJA 2CVQA 3PYMA 2GGSA 2GZ3A 2W98A 1RKXA 4LK3A 3H8VA 2JFHA 2QHXA 4ZQGA 4XA8A 3RAJA 4UULA 2PKQP 1QYVA 2IXAA 1AGNA 1N9GB 3KVOA 2HQ1A 3UGKA 4NMHA 5GMOA 1OBFO 3WLFA 3QJ5A 3GR6A 4KWHA 3RBXA 4EUEA 4CM3A 3NGXA 5T8KC 5BQFA 3OJFA 1VJ1A 2BFOA 3OH8A 1OZAA 3PDUA 1ZNQO 4WLOA 5TJ9A 3PJGA 3EVNA 4A03A 4Z3DA 2W2KA 2XAAA 5LDGA 1VL6A 2CZCA 2TMGA 1XGKA 2Y93A 3IDSA 2ZATA 1D1SA 3DAFA 4B4WA 1HRDA 1VLLA 1CRWG 3GDGA 1MV8A 4KTTE 1LRKA 3KM0A 1VSUA 3I52A 1QV7A 3U4IA 4CMEC 3S2IA 1GZ4A 5JDIA 2RHRA 3AI3A 3CZMA 4FFLA 2I6TA 1K6IA 2VHYA 2HMWA 2D0IA 4E5KA 1Z82A 4KUGA 3AI1A 4MIYA 4BNIA 2WE8A 3E48A 2VWHA 1H9AA 3OSUA 5ITVA 1HZZA 2VN8A 4R9RA 4IBOA 1PGNA 2EW8A 4DTIA 3KYCB 3I9LA 2C2YA 3Q0EA 1ADCA 1FDSA 1ZK1A 4NK4A 4JX8A 2BI7A 2X0NA 4OL9A 4XB2A 1YKFA 4FFPA 3RCBA 2JCXA 1I3LA 3JQ8A 5JS6A 1HF3A 3UN1A 4W9NC 1ZK2A 4CM4B 3ZWAA 4RJTA 5U4QA 3GFGA 4CLXA 1GPDG 5CEFA 4J1TA 1Z7EA 3ZV4A 3IKTA 2Q1TA 1WDMA 3HB5X 5L53A 4ZQEA 2HJRA 2Q3EA 5L7TA 2AHRA 4NJMA 1Y1PA 1M67A 3OQ6A 3RC2A 1WZIA 5T5QA 2VHWA 4PLCA 1BRMA 1K2WA 2EERA 4N7RA 3DZBA 1NYTA 1CJCA 1GDHA 2WD7B 3F3SA 3EGOA 1L7EA 3PWSA 3H4VA 3ZU2A 3DB2A 4Q3CA 5K0ZA 5HM8A 4IM7A 3PHIA 3ZHXA 3V1TC 3E8XA 2Q1UA 5DOVA 1F14A 1GPJA 4B4VA 1UJMA 5I7SA 1FDTA 3WFIA 2E82A 4BKQA 3KOUA 1T2CA 3INGA 1N5DA 1R4NB 1YB4A 4QFDA 2J3JA 2AEMA 4G81A 4DLAA 1EE2A 1N9GA 1Y8RB 1V3UA 3ZN2A 3L0DA 1B8VA 3C1AA 1JLLA 1GADO 4YQYA 2DKNA 3KSUA 4J0FA 2YV2A 1UAYA 1RM5A 5K6AA 3N58A 2VOJA 2DBZA 1BMDA 5JAMA 4E33A 2ZCUA 4J7UA 5ILOA 4BO2A 3FBTA 1PJSA 2Q45A 2DTDA 1B15A 1P1RA 1NQAO 2FZEA 3MOIA 3ZWWA 4OOFA 1LRLA 3ZDFA 3EK2A 2IRWA 1QLHA 2BF7A 2QZ9A 5BSFA 3AK4A 3DMYA 5A9SB 3RI3A 5L51A 2EP7A 4RV9A 4CMAA 4IJUA 4UUPA 1FJHA 1E7MA 1HXHA 4XYMA 1ZK3A 3WGIA 1KEVA 3ZU5A 2AQKA 2B0JA 1XIVA 4ALNA 3NT4A 2Y1FA 4R1UA 4R5MA 1GEGA 4E12A 3ENKA 5FI3A 1PS0A 2YDYA 5G0SA 2Q4BA 2WWRA 1VL8A 3MTJA 2BRUA 3VVBA 2PY6A 1DC3A 1QKIA 3WYEA 2FR0A 1GUZA 4P4NA 1SMKA 1YJQA 3UFXA 2QZZA 2OZPA 2R00A 3JD2A 4EYEA 1EE9A 3FRJA 1PL7A 2X0JA 4WJZA 1HTBA 4NZ9A 4BNHA 2GYYA 4EZBA 4RO0A 1IYZA 4AJJA 2J8ZA 3PRJA 3RROA 4LCJA 1NHGA 1U28A 2JHGA 4CM9A 3U49A 4L4SA 5KVQA 4RVUA 5ENVA 4D3FA 2IZZA 1HE5A 4PG7A 4ZN6A 1LDEA 1ZEJA 3FPLA 2P5YA 5IXYA 1P0CA 4CMBA 4FD3A 5L95A 2PH5A 1T4DA 3KO8A 1IL0A 4TKLA 2I65A 3E5RA 1G0OA 1VPDA 4IDEA 1H6AA 4W99A 3GH3A 2Y66A 1IB6A 1VSVA 3PHLA 3EY4A 3INTA 4FN4A 4A2CA 1X1TA 1NFQA 4BB6A 3HN2A 5CP8A 4CQMA 4Q3EA 1U1IA 3JD4A 5EIOA 3RUAA 2Z1MA 5KJFA 5JNLA 3OMLA 1WVGA 1IHYA 7ADHA 1LSJA 4Z0HO 4MINA 5GZ1A 3IP3A 4GWGA 2ZK7A 3O8QB 5L40A 1LDBA 5EN4A 4W7HA 3BMNA 2VNAA 4YBZA 1QYWA 3NYWA 3ONDA 4LMRA 3UICA 2NQTA 3AUSA 1YVEI 3PZRA 5F1PA 2HMUA 3PJDA 1FDVA 3D3WB 3OJ0A 4YVFA 1N7GA 1NR1A 3E9MA 4DREA 5TC4A 2Q46A 4BO1A 1XU9A 3VH3A 4OKIA 1IY8A 3RQSA 3ANMA 2RH4A 1GCOA 3BHIA 3I9KA 1WW8A 4QX6A 3Q9NA 3ZGYA 4UEOA 4YQZA 4YB8A 1VJ0A 3H5RA 1U2GA 3H9JA 4HFNA 1F12A 4PLZA 4I1IA 4J3FA 2B37A 2GLXA 3RVDA 3CMCO 1U7HA 4C7KA 5L4NA 3B70A 5CHEA 1I2CA 3GC6A 1DRVA 4YPOA 1KY4A 5GZ6A 4RL6A 5T67A 1BXGB 3TL2A 1ULSA 2VYNA 1R16A 1QRRA 4LRTB 2X23A 3U9LA 2EF1A 1LLDA 1O8CA 3VHRA 1XEAA 5ADHA 3BHJA 2IYPA 4OAQA 4Q3DA 3RJ5A 3OECA 1UXKA 4XGNA 1JA9A 2DLDA 5A06A 2A94A 1SB8A 1DLIA 3FWNA 4HWKA 2NVWA 3QSGA 3RU7A 1Z74A 3CEAA 5T64A 2EKQA 4F6CA 4DL9A 1TB4A 1N7HA 4NU6A 4HKTA 3OQBA 5TQVA 3V8BA 3JQGB 1Z45A 3FTPA 4XIYA 4INAA 3O8QA 1EK6A 1P44A 4H16A 2P4HX 4DPKA 1H0KA 1ZEMA 3FN4A 1A72A 1P3DA 4LN1A 2WYWA 4XQCA 3GQVA 3H7AA 4YJHB 2XXBA 2O2SA 1DRUA 2Q1WA 5FYDA 3OEYA 4J1SA 3GVCA 3R0IA 5LCXA 4N5MA 3QE3A 4BO5A 2XF8A 3I83A 4FB5A 5CFZA 2PLAA 1HETA 2BH9A 1ZZEA 5DCYA 1R12A 4BNMA 2J5KA 3WJ7A 3L6DA 3GMSA 3NTQA 5L45A 4FJ0A 5CDSA 1HE2A 2GCGA 3KYBA 4S1VA 2PD6A 5DCUA 3ETDA 1I10A 1ZCJA 2VYVD 3JV7A 2OBYA 1PGOA 2PNFA 3PLRA 4FGWA 3QP9A 1PJCA 5JY1A 4CV3A 3FNHA 3NTOA 4CMCA 3D5TA 4WE3A 1NPDA 1PS9A 3L4BA 4CLRB 3DO5A 5K9ZA 2Q1SA 3FD8A 4BNLA 4B3IA 1Y81A 4E31A 2OP1A 4NI5A 3OHSX 1C14A 2Z5LA 4NBTA 4S3MA 4B7XA 2HLPA 1U9JA 1F8GA 1K6JA 1D1TA 1P1IA 4K1LA 4R1NA 4RDHA 1MFPA 5G2OA 4OIMA 1I3KA 1V6AA 4ZRMA 3P19A 1ZKMA 4WLEA 3ZHYA 3AY6A 2I9PA 2BI8A 2G76A 4YEDA 5B12A 3K96A 3MJVA 2FPIA 1X15A 3B6ZA 4ONEA 4NBVA 5IDWA 1C0IA 2J5RA 3DR3A 3IQDB 4ITUA 1YOVA 2W2LD 1ZMTA 5DBFA 1IZ9A 3A4VA 1IZ0A 1LDNA 1D8AA 4NJMB 4BV9A 4D44A 1H5QA 4R5HA 4ALLA 2H6EA 1I36A 2HK9A 1NP3A 2IEDA 1ZH8A 1SPXA 2LDBA 4R41A 4BGUA 3K73O 2AMFA 5BNIA 3UW3A 2YW9A 3AWDA 3CUKA 1T26A 4E0BA 5HWSA 3R6DA 4XR4A 3IC5A 3I9OA 1GZ3A 1HDRA 2A9FA 2EP5A 1PZGA 4R51A 2J5QA 3D4PA 1EBFA 2C20A 2YJZA 3VPGA 5AXDA 4FFMA 3U4HA 4MVJD 3ZV5A 1C1XB 5JYEA 5CDUA 3UHAA 3VH4A 4BGVA 2PFGA 4CJXA 1PGPA 2HJSA 1E7YA 3PK0A 1HL3A 3IKVA 2GN8A 2ZYGA 3DZGA 3WFJA 1Y8QA 4PGFA 3PDJA 3IJPA 3FBGA 3H2ZA 4MIOA 2OFPA 2BELA 1NAIA 2NSDA 3PP8A 5H83A 3WSWA 3WTCA 3RFXA 3ZW8A 1FMCA 1ISGA 1YJ8A 3NRCA 3JQ9C 4BGIA 4LISA 2YUTA 4D45A 1E7WA 3BMNB 3QWHA 5DT9A 3DMTC 4FGSA 1P1JA 3JSAA 4PLYA 5LDHA 1BHSA 2HKIA 1ZXLA 2ET6A 4GVLA 4DA9A 1SB9A 1Y8RA 3CH6A 4FCCA 2I66A 4B7UA 3ZCXA 3U5TA 3DDNA 4RPLA 5IZCC 3S2FA 5IG2A 3H9GA 1E1LA 5JSFA 4DYVA 2PZLA 4OH1A 4XYGA 4Z9XA 1UDBA 2FPGA 5G0TA 3WIEA 3JQFC 4JK3A 3IS3A 1KC1A 3K31A 3ZWPA 4BNUA 4DQVA 3ANNA 3T7CA 3HWRA 4RVDA 3KXDA 1ZXBA 1GQYA 2JKVA 1ISIA 2V6FA 3AUTA 3OIDA 5AVOA 3OA2A 4YJHA 2BFPA 3TFQA 2A4KA 4FIZA 4Q3BA 1R4NA 2X22A 4WGGA 1E1NA 3DHNA 2NLOA 3HDQA 3HJAA 3MJTA 2NWQA 1UZLA 2IODA 1QYDA 1NVTA 3ASUA 3NUGA 1K89A 2HRZA 1P77A 4AJKA 3W6UA 2VTDA 5L7WA 4Z9YA 3PIIA 4D0RA 3C7CB 3SEFA 4E5YA 1CWUA 1XA0A 1MXFA 2Z95A 5B37A 4CMEA 3F9IA 1E6UA 2H1SA 2O4CA 1A71A 2TMDA 5EPOA 4D41A 4DQXA 1YBVA 2D2IA 1A7KA 1PL8A 1JKIA 3JQ7A 1IUKA 3V1UA 4XYLA 4IZHA 3C7AA 2PKQO 2AQ8A 1MXHA 3WLEA 1YONA 4AJPA 3C24A 3BMOB 3C3XA 1B26A 5G4LA 3BTUA 1NPYA 3BA1A 4CR8A 3T4XA 3KV3O 2X8LA 3D7LA 4BHTA 1YXMA 4RF4A 3T4EA 1U3WA 4HFRA 5TGDA 5JO0A 3QVOA 4FBGA 1SEPA 4J6FA 3NT2A 2NTNA 2NTVA 1OI7A 1ZK0A 3TSCA 1WP4A 5CPBA 1XKQA 1TT5B 4R9SA 3RUFA 5KWEA 1R4MB 1C0KA 3GRKA 4ZU3A 5KNLA 4E2YA 4LMPA 2H9IA 1ZJZA 4DQUA 4LVCA 2D1YA 3EZYA 5IDYA 1VKOA 1DEHA 1T2EA 2AE2A 4NIMA 2YV1A 4OQZA 3A9WA 3VVCA 3R3SA 3O4RA 4BVAA 3DAGA 3N74A 5L7YA 2O7QA 4ND5A 2GD1O 2VZ9A 1HT0A 5COQA 2YHIA 2P91A 1U3VA 4CQLA 4UUMA 1SNYA 1B8PA 2X86A 3GEMA 4BQPA 1LUAA 3QWBA 5EL0A 3GGGA 3JD3A 1NWHA 2X0IA 3DBLA 4CM6A 3DWFA 3AU9A 1GCUA 5IAAA 2I76A 2H5LA 2NVBA 4ROSA 3Q1LA 4OQYA 1QXSA 3OIGA 3FWZA 3D64A 3TRIA 3M1LA 4GX1A 4XEHA 3SLKA 5EESA 3TPCA 4DRYA 3G0OA 5DULA 5TLSA 1NM5A 2GZ2A 3GLQA 1Y5RA 3L4BC 3GZNB 4N18A 4WPGA 3MJSA 2O2YA 3WMXA 5I9NA 5JE8A 3MEQA 3IIEA 4GSLA 3BTOA 3JD0A 4ALMA 2EEZA 4URFA 2PK3A 4R3NA 1LQUA 4JLWA 4RF3A 1KOLA 1F17A 4NJOA 1PU2A 3RIHA 4YAEA 5C7IO 2Q2WA 4DUPA 2X5OA 3TJRA 3ZWVA 2BFMA 4O6VA 2VYVA 1LEHA 1TT7A 2DT5A 3PXXA 4R69A 2UAGA 2ZJ1A 1GEEA 3D4NA 5JFOA 3C1TA 4NK5A 2PGLA 2H63A 4QECA 2Y0DA 3ROQA 4J2OA 4CUZA 3BMQB 4EW6A 4E5NA 2EW2A 2D3TA 4Q3AA 3RUCA 3S8MA 4RQTA 3SBOA 3EW7A 3VPFA 2JAPA 4RLSA 5A4DA 5H81A 4HADA 4NFSA 2JD0A 2ZYAA 1EFKA 2Y68A 3PQFA 3O38A 5HA5A 3MTGA 1SBYA 3V2HA 1QORA 1U4OA 5L4SA 4BO7A 5HS6A 4R1TA 2VRCD 1MLDA 2ZB8A 3GG9A 1YL6A 3AM4A 2CSUA 1LDGA 2X9VA 4WOJA 5I8ZA 2EGGA 4AVYA 2G0TA 5I9MA 4CV1A 1MA0A 1UDCA 1X14A 5I9LA 2AQIA 4LSWA 3ZU4A 1P1HA 3TWOA 2OO5A 4ZGWA 4OSOA 4NNJA 4DYDA 4EI2A 2Y1EA 2EIHA 4KWIA 3VOSA 4J1QA 3Q11A 3QVXA 1B14A
chains in the Genus database with same CATH superfamily
2J7PD 3AUKA 4ZOLB 1LDMA 5DV9A 1IEXA 2FOIA 1UBMS 2ZJ7A 3RJZA 4F7WA 4IL5A 5I6DA 3RTGA 1ACMA 1RYYA 4KLCA 2A1IA 4GDFA 3GFVA 2VDWA 4AJ1A 5FPYA 5CXQA 4BU1A 4UDOA 4RTOA 3NHFA 4JA0A 1PKXA 1Z37A 5D3QA 2NVUA 1S6YA 4P3YA 3N8DA 3S5UA 2WWGA 3TTXA 1V8BA 2RKOA 3UJNA 3TLAA 4ABYA 4CT5A 1EIWA 5DYWA 4HWRA 3OZ7A 3MINA 1EJBA 3JQAB 4M9XA 5GPBA 2P6MA 1MV5A 2AMJA 4F3CA 1K27A 4FQ7A 4KMRA 1GU0A 3GPIA 3PCXA 5AKKA 2P6RA 4WJKB 4QEDA 4QFCA 2WYUA 2A0YA 3JWEA 4ILEA 4MH0R 5I3CA 1JHZA 1MTOA 2HTFA 3H8SA 2FUEA 1KJWA 3DEFA 3T4PA 1CQJB 2XE4A 4ZVUA 3ZE7A 5FDFA 2H9AA 4R4JA 4BB5A 4I36A 3S8YA 2X15A 5JMOA 3C6BA 4IDGA 4EQZA 4MQEA 1G2IA 1RADA 2OAEA 3I8SA 2XQJA 3TIIA 4FILA 5LNK1 3A06A 1FE8A 4X1YB 1TVKA 4JA2A 1KQPA 2DGDA 3FYCA 3O8OB 3B20A 4C14A 4YRKA 2ZZNA 5A3QA 2Q49A 3F6EX 4WDQA 1WZCA 2AIRA 2WA2A 2BR5A 4TRMA 1KIFA 1ZUNB 1LH0A 4L8LA 4XWTA 2P3SA 2ALJA 1XEXA 2QE7D 2XUFA 4M76B 4MS4B 3VO2A 4YYEA 3UFXB 1ESEA 3LWZA 1XEFA 1DOAA 3FKSA 5DZSA 1WD5A 3D9QX 3UW1A 5FPQA 4CR6A 4R1QA 1K98A 1UPAA 3ICWA 5ALZA 5CLJA 2V96A 2AZDA 2BUCA 2JLRA 3UMFA 4DLVA 1ZIOA 1K8XB 3BUSA 4E07A 4M1KA 1FFCA 5CVDA 4H08A 1Y8QB 3B6JA 2HI0A 3LK7A 1OGYA 1AB6A 1A9YA 1U0EA 3PT5A 4NBWA 3GBVA 2IX9A 2VHQA 3HKCB 1PTKA 1M6EX 2NVOA 3QVGB 4RY2A 2P6PA 3ZY5A 2VPYA 2X0RA 3CO5A 4UU7A 4A2WA 3WA7A 1NI4A 3CX4A 3GJ7A 2IZ0A 4YMGA 2ZAOA 2G5CA 1NXVA 4M1EA 3C7KA 1JALA 3K09A 4PPYA 4TSFD 1DZIA 2EYUA 1C2TA 5EGNA 1OWPA 2FEMA 1E1RD 3HP4A 1IBSA 1MIHA 1REQB 2B83A 1TVEA 2M6RA 2SHKA 4EHAA 2CT8A 5TE9A 1W36C 1E2GA 2XQIA 4FSHA 1SOMA 3HG7A 3NHWA 3NS7A 4V39A 3RNOA 2AYZA 2HBZA 3LZDA 3WS7A 3NBMA 3ZDQA 4U8GA 1M6HA 2IU0A 2E4UA 1BGXT 1DB3A 1T5HX 2FSVA 2A92A 3BBPA 4DIDA 1JG3A 3EBPA 4QNRA 3C8ZA 5BUSA 5C9ZA 3M83A 4QD3A 2GA9A 1NKVA 3GNSA 4H7JA 1PJRA 2BRUC 1VLMA 1IOZA 3F6SA 4IS3A 2AEJA 1K3TA 2HUNA 2O0HA 2JIOA 2IA5A 2XB8A 1X1SA 2Y1WA 3EWSA 2HT1A 4K9RA 3HL4A 2XUDA 3QPDA 5FBWB 3EIEA 4TVBA 1A8IA 2PQ0A 2OC9A 2Z58A 4IDOA 2NQ8A 1W5BA 1YL5A 3LFHA 4Z0PA 4C7XA 1TK2A 1V8DA 1W4AA 3BFKA 3DC7A 4JJ8A 4F72A 3HN6A 1AXGA 3I64A 1UAAA 1OFTA 4XB6B 3W8FA 3W1EA 1F2TB 3ZXIA 3IVRA 3JX9A 1RQGA 3I6QA 3VPSA 2DTEA 2PT7A 4YJDA 1D6SA 1Z7BA 2P9BA 1NZJA 4L95C 1PK7A 4B8ZA 4D42A 1NL3A 3HB1A 1DADA 2G40A 3ICOA 4TTQA 4PR3A 2B4RO 4QASA 1O9BA 1T5SA 2IE0A 2PA0A 1HQKA 3QXHA 4LC0A 1H5UA 1XXHE 3STTA 1ISHA 1Q6YA 1GGHA 2RBGA 2YYYA 1U9IA 3FOEC 4PC3A 3K1AA 5KYUA 3T7IA 3GBPA 3T7SA 1VMIA 1GQ2A 1X7XB 1S7CA 4L5BA 4M22A 4HDSA 2UXCB 3I61A 5GTDA 2DKFA 4KITB 4IJKA 1YVRA 2GVNA 1BTOA 1M0TA 3FGZA 4PR0A 1MHPA 2A9JA 3WYNA 7MHTA 1AQ6A 2XXAA 2N1MA 4MWTA 3TQHA 1U5BA 3AJRA 1NBOA 2WTAA 1OX5A 2B5OA 4RXMA 1DFGA 3OJLA 4GZ6A 1H23A 1CQPA 1MNAA 1OKKA 2XCIA 3EEYA 1TU4A 3AVQA 2P2YA 2VF2A 4ZIRB 4GRDA 3VR2D 4UQPA 5HQ3B 3OPVA 4DJ5X 3P96A 5TQ2A 5JSYA 4ANFA 4CI0B 1OIVA 2QY6A 3HHEA 4OBXA 3RU9A 3A8TA 3TMKA 4WINA 1FU8A 3KWJA 1Y1TA 1EVIA 4CWAA 5KNBD 4WK0B 3HCPA 3HACA 2WDPA 1EMDA 2IV2X 3EARA 2QUBA 3DL4A 4NBNA 1SBQA 3A9CA 3KEGA 4B4OA 4MV7A 5IAGA 4YRGA 3K70B 2AJLI 1FDUA 5AI8A 4M1QA 3TKYA 1EP3B 3VVMA 1ZQ9A 3K0SA 1NVBA 2VRBA 3JPWA 2BMAA 4CLHA 4G0VA 2CFRA 5NULA 4UUOA 4LDPA 5AVWA 2NO5A 2GKOA 3E2PA 1AK2A 1KP9A 2JJ2D 1YE3A 2NU9A 4Q6BA 2F3UA 2IF0A 3GARA 4Q1CA 4XWYA 1KMIY 1PV4A 1EVQA 2R60A 5BVHA 2P6NA 3C85A 3Q7PA 4EDHA 5C37A 1U1DA 4PG5A 1YF3A 4BAZA 1EXMA 3NDJA 5JC1A 1CUVA 1W4LA 5LVAA 4P0QB 1I4EB 2LBPA 3FETA 3FNFA 1WEHA 4TRRA 4B5KA 1KRHA 1KQOA 1V1RB 3GAMA 4R1MA 1GPMA 5K8LA 1QP4A 2JLXA 5I7FA 4II2A 3HGTA 2NZJA 2PZJA 3I1YA 1Q44A 3LY5A 3W2IA 5H68A 9LDBA 5JFGA 2Y1XA 4KXFB 4P92A 3UAYA 1J90A 4YRFA 3NHAA 4RZSA 2VOEA 1L7VC 4EMUA 2OB2A 3WMGA 2PVCA 4DWJA 3ABZA 2B21A 1IOLA 1I80A 3U3DA 1D2CA 5AOVA 2EC5A 4BLRA 5KMGB 4O4HF 4G84A 4MWSA 3KQKA 1ZNXA 4YGYA 5FBVB 1VIYA 2Q0SA 2CNBA 4OGWA 3EIHA 2ZSAA 1SKUA 3F90A 3KVYA 5AW4A 1QBKC 4CLDA 4JXKA 4C7OB 3SF0A 1MGOA 4G0NA 2H4JA 2WMDA 4U0JA 2IS1A 1A82A 1BWQA 4OQMA 1FLDA 4C0LA 4ZT4A 2TMKA 1E3MA 2W6OA 4QYWA 2ZIEA 3L02A 2XRYA 3FHTA 2XTZA 4XLZA 1F48A 2ZTHA 5T4BA 4EB0A 4OREX 3ETJA 1PR1A 4OQDA 1XMOB 1RJDA 1WJGA 2DQSA 3LP8A 3P8ZA 2ZJYA 4NPCA 5BVGB 4KSYA 4TXLA 1CP2A 1EM8B 1K5DA 3D7MA 1GCIA 3P0JA 4EJ0A 4NBUA 2GXQA 1E59A 4X20A 3X1ZA 4F1KA 3AR9A 2O3TA 4MNTA 4UASA 2VDWB 3KB6A 4W1PA 3N2YA 4BLWA 1QTNA 4GKJB 1DIAA 2C88A 3H18A 1II8A 4U1RA 3UC5A 2A0KA 3GJYA 4GOOD 3VTAA 4DMLA 1DO8A 1L4EA 1TLFA 3ZVRA 3NH9A 2BE7A 3LUCA 4I4IA 4AF7A 1XZPA 3DHEA 1YI1A 1WNTA 3AJDA 3ESCA 4IR7A 5LQAA 1FRFS 4CT4B 1L7RA 3AOEA 1TQ6A 4X8LA 3IPAA 3HFSA 1RJEA 3C6KA 4FC7A 3G85A 5ALKA 1JNYA 2P6OA 2PXHA 3L49A 3M7IA 5ISMA 3K0KA 1E0KA 3DMRA 1FP2A 1DIBA 2EFJA 1CS4C 4ISCA 1XKLA 1OC4A 1T5LA 4H7PA 4UBNA 5DXAA 1UM9B 1KC3A 2WRZA 4NU5A 3TG8A 1XRNA 3HNOA 2A88A 2MINA 3P32A 5ELLA 4C76A 4N0EA 2E5WA 4YR9A 1P31A 3E3NA 1ZIXA 3RT1A 2FW7A 1JR3D 3WLQA 3WKAA 4DMMA 3AFHA 4Q9DA 1K97A 2O9JA 1ZGZA 1IDOA 1CSEE 1P7PA 1IOVA 2X7JA 3CG4A 1B0PA 1UFQA 4RKYA 5HFNA 4ZOQI 1LB1B 4BNDB 4F6LA 1WEKA 1EX6A 1YGPA 4EA7A 2YHSA 3UHPA 1CYEA 2LPMA 3ZWQA 3BKWA 2JFWA 2HHLA 1IJKA 5DM2A 4MDFA 2Z09A 1LSOA 4JVNA 4RZHA 4GKVA 1M1YE 5CLGA 3L6CA 1I5RA 3W5IA 4LRSB 4JLVA 1CVIA 1ZQ1A 2A0WA 4MRMA 2H8GA 1QHHA 3DKVA 3NVKI 2FRVA 5BSRA 1PT5A 5T3UA 4ZK6A 5CVTA 1L9XA 4IHAA 4WX2B 1NC3A 2E6KA 3TTSA 1QWOA 2DYKA 1D1QA 4IIJF 3AKZA 1O6FA 1R9JA 2GKSA 3CLRD 3QLVC 2QENA 4ND3A 5YASA 2AF3C 1A04A 3PI7A 3BJEA 2ZPUA 3I3OA 4G09A 1WCWA 3FCUB 4MB0A 4UTPA 4RTMA 2E4WA 3JQDA 3MCAA 4QLOA 3E84A 1OZFA 4Z9AA 3ZHUA 1HFKA 1YB7A 2H06A 2JGRA 1RWOA 3IJEB 2BJWA 3HR7A 3PIRA 1CRZA 4GLJA 1NW3A 3EXHB 1FUEA 1ZLXA 4DSZA 3S81A 3REGA 4N76A 3UUEA 3D2LA 4WNAA 2IYEA 3FZQA 3G7NA 4NCNA 5TGZA 1E98A 4EA6A 2WF7A 4EG4A 3GGCA 1PFWA 2N46A 3G13A 2MT9A 3HABA 4MTCA 3SS9X 3TI9A 1I24A 4G26A 4DUGA 1N0VC 3C6XA 3GNQA 4JLMA 3SQDA 3WLMA 2RBEA 2YIMA 3N0XA 1WUTA 1M2EA 2GCIA 4KQCA 5DTEA 1NE2A 1RWNA 3L7LA 4XRGA 4GWKA 3F98A 3SC2A 4M1WA 1UR5A 1IZ7A 4D4GA 2NU7A 2JAHA 3U7HB 2NUPA 3BICA 1IM5A 4RF5A 2I71A 3NIFB 1XEXB 3WMFA 4BRZA 1PFGA 1L8QA 2P75A 5ECGC 1G18A 4M55A 1QNLA 2Z8YA 2OHFA 1LVHA 2HEIA 1JSXA 1LS1A 2V6MA 1GRRA 3D7SA 4N3CA 3UXMA 3W5SA 5EWLB 4C4SA 2K6GA 2W2TA 2PPLA 4M38A 1IC6A 4DLWA 4B79A 4QVIA 1RI1A 1XCPA 3U9TA 1FP4B 3GJSA 3M2PA 2W2XA 2H08A 5CDHA 5A9RA 5I5EA 5IJ0A 2REBA 3PA8A 3V2UA 3IILA 2Q6OA 1CEEA 5IDXA 2IZ6A 3VDQA 3KKOA 1HLDA 5JQGB 3LFUA 1ONOA 2W6NA 4PNZA 5COBA 3QPBA 2QX9A 2GZ1A 3R3JA 2V6JA 2QVGA 3FSRA 1KGDA 2VHEA 4FMDF 1YRYE 5CK5A 4LYYA 1J8QA 4HDSB 5LBUA 2P65A 2Q6IA 2DF8A 1NUAA 3FLEA 3DYIA 2CLFB 3GOHA 1MQSA 1QRAA 2AWNA 3OFKA 1AA6A 4C2UA 3LP5A 1W4ZA 2PT9A 1FVHA 3HFJA 3Q3IA 1JLHA 3W6ZA 2QQ5A 4UCFA 4A3SA 1V9LA 3CZ9A 1KH3A 4PBRA 5EXPA 4RJLA 1FTGA 4MOWA 2RH8A 1HNXB 1E0AA 1UQTA 4F2HA 3AOGA 4O1IA 5CDGA 4CKCB 3JYHA 4WERA 4CM1A 2XRFA 4PZAA 4QARA 2E37A 4TMKA 5FF9A 1W36D 1CY0A 1O9GA 1RPJA 2PRYA 1YZLA 3G9TA 2QJFA 2Q8NA 3B5EA 4LBVA 4F5DA 2P27A 2PMWB 1CE8A 3K9FC 1BHJA 1GNRA 3K0AB 5IANA 1ZHFA 3AUYA 3O9VA 3V8PA 1UODA 2D2XA 4RPJA 3HDVA 2WJGA 4U6NA 1VI5A 1E1RA 5IH7A 3T1YB 3AVOA 3K5HA 1U5CA 1MKYA 2C4UA 2J7PA 2OHIA 4HRYA 2NZ8A 2X5NA 3SNHA 3GLGB 5K6AC 1G42A 4K6KA 4R2XA 4WVLA 3PX7A 1FOEB 5PGMA 1W9HA 5HKBA 2ZBPA 3GGSA 5FOVA 3NJRA 2P2SA 2X0EA 3B85A 3FF1A 2Q5EA 2YVKA 4IGFA 4I6JA 4FWTA 5CUQA 1NPTO 3FJOA 2GX6A 4HNVA 1RT9A 3OIUA 4XUGB 1U2DC 4ARZA 1DEAA 1I14A 1OY1A 5ALQA 2YYSA 4BMCA 2PH1A 1M1YB 2Q4DA 4Q21A 2PSSA 4QRHA 4OI0A 2ZUBA 4TXNA 16PKA 1BU5A 2PV0A 1LX6A 1VC2A 2VRCA 4FLMA 1JHVA 1RWQA 4JHLA 4Q01A 1E3QA 4PM4A 2CL6X 2J9ZB 4XJTA 4BB9A 1G2OA 1E7QA 3CLTC 2XAUA 2Z2IA 1Y0BA 1UKCA 2ZG6A 1E32A 4TWIA 3HVHA 2XUGA 3BRWD 4HWPA 4H77A 3H2YA 2FPKA 4KIWA 3BRSA 3VDRA 1W96A 3A1UA 4I08A 3DBLB 1T8WA 4E2WA 2A6PA 1ZSVA 4LOLA 5A4KA 2ZRMA 2Z5VA 1N2GA 3B6EA 5B5SA 4INOA 3F5DA 1ESCA 3WWOA 3BMCA 1EJ2A 2WFMA 3BGSA 3BWEA 1O95C 2IOYA 4I0WB 4H6VA 1CZLA 3TEMA 4I8DA 4ARBA 1M8KA 1WOYA 4P31A 4OGFA 3HU2A 1TZJA 4I4TA 721PA 1QQ7A 1DKPA 2PX8A 2DLCX 3OUTA 1IJFA 2JGEA 3GCDA 5IVKA 2FG7C 2R2GA 2QX8A 2QLJA 1U2EA 3E9RA 3CMMA 2K4MA 3IULA 1WZNA 1QP0A 1RMYA 3LVRE 5BN4A 3F5SA 3LIIA 1C7RA 4M0LA 3KEOA 2EDCA 1K3UB 3IESA 3MW8A 4I4TF 4RZIA 1R0KA 3MERA 4DTCA 1C7FA 2Q9BA 4PHCA 3LDAA 2DFTA 3IDOA 5LL6P 3RVLA 3VR6A 2XNDD 4QU9A 4YJ2F 5CX1B 4G86A 5LP6A 3LX6A 2FPOA 3PIDA 4LRQA 4CNQA 1U5BB 4Q00A 1G20B 1E7SA 5GOTA 2VTBB 4KFRA 3KSZO 1DCFA 1SQ5A 5JBIA 4JB0A 5EJIA 4B0PA 4M8NE 1U0SY 2BBWA 3FZNA 4KKXB 4GBJA 3SXUA 4DDUA 4EG0A 1W87A 2QKYA 4BV8A 4K9NA 1N1EA 1PT7A 1PL6A 2LTAA 5HMMA 3QHPA 4OHFA 3ZHOA 1Q19A 2AI1A 3AVVA 1OWMA 2J3LA 2ZS7A 4KR0A 4DA0A 1OH8A 1KS2A 4LXGA 3TRHA 1I4LD 1JDPA 3F2VA 1XTRA 1R6BX 4DNQA 1K0UA 2FEXA 3PFWO 5JRDS 3H42B 2ZI5A 3GEDA 5KTRA 1P2DA 3BIXA 1P7WA 2GYVA 5IUKC 3GMDA 3U0VA 1U6JA 4HZUB 4F12A 1YZKA 3D7KA 3L4SO 1ECBA 2Z4RA 3RSCA 4LOJA 1JHOA 2GXSA 4LOIA 4BNXA 4BX0A 4RTNA 2CV1A 4FD2A 5LXTF 3CF6R 4NKRA 1R27A 1G38A 4XH9B 3RTAA 4TXHA 2HZBA 3H75A 1KKUA 4NONA 1DC6A 1MX5A 3TR0A 5F9FA 3AL2A 1USGA 4HXGA 1WY5A 5EE3A 4DNXA 1L7DA 1A5BB 2IU3A 2ZWVA 4MGZR 4MIEA 3DPIA 5JWRA 3MM4A 3KKQA 4QJBA 4CLRA 1O0CA 4ER7A 5AJZA 1DPGA 3LF2A 5EMMA 1R4AA 3A6EA 3DHYA 4Q37A 3WIVA 4HS4A 3ZTYA 1P18A 4KQXA 1RJWA 3RRZA 3TPFA 3VNVA 3TVYA 2CZGA 3FTQA 3LT1A 3MFQA 4LGYA 3BE6A 1YB5A 3OQNA 1N2CE 4K40A 2IYUA 3GY0A 3TE7A 3GRVA 2Q41A 1U7TA 3BQMB 4MI3A 4A92A 3TBFA 4NU0A 1T9ZA 2ZAIA 5LWHA 4OLAA 4F4CA 1YQ9A 3VYVA 3OE1A 3CSUA 4QBIA 1B7GO 1UP7A 4H59A 5TVGA 1OUMA 1PUJA 2OZLA 1JIIA 1OB2A 3DWIA 4NDNE 3JQ9A 5ECYA 3HUFA 1VL2A 2WF9A 4Q39A 3ULKA 5F2OA 1LBIA 1ZWKA 1KL7A 2JA2A 3NG1A 2P9GA 1KFCB 1IXSB 4L8YA 4ESOA 1AHIA 1B74A 4PYNA 3DM9B 2CFSA 3JXEA 5DBIA 3Q41A 4TTPA 2Y9PB 3DLBA 1OF1A 2BKXA 3HVJA 1KI6A 3JS5A 1B6TA 2XWPA 4TMZA 1W73A 3OHMA 2G0NA 3VSAA 2Q5QA 1JLRA 5BMVA 5IFLA 2NYUA 4ZYZA 2O8FB 2C58A 4ZVTA 3QLJA 1MB0A 3E81A 4EY6A 1SA0B 4NX2A 5B4TA 1RJFA 2OECA 2RAVA 4GS5A 3P4YA 5IKEA 3NJ8A 4QRDA 3R5HA 4GI7A 9ABPA 3ZDDA 4I5GA 3PE3A 4HAIA 2OUIA 4UPDA 3DEJA 3ST7A 1E2KA 1FFWA 1A3CA 4HH1A 1AS3A 4UHDA 2GB4A 2GHTA 2OM2A 4Y6RA 1XMXA 3BE8A 4DV2B 4RVSA 4G0YA 4LBZA 5JLAA 5T4HA 3F1LA 2ZJAA 3GAFA 3UB4A 1H85A 4EELA 1YZQA 2DY1A 2VP4A 2FEAA 2ABWA 1ZH2A 2Q2VA 5DNYB 3QEAZ 2OKCA 2OXCA 4GQIA 4BEJA 5EFOA 1FX0B 4NV0A 1A9TA 2HMTA 1NF3A 2WJPA 1O96A 4KP7A 4TYMA 4XDZA 4DEXA 2X2FA 1I32A 5A5FA 3KNZA 2QN9A 4KGXA 3P7MA 1DKLA 3RJTA 4BNJA 4GI5A 2AOTB 2HV8A 2RGBA 4XLTA 4IJQA 5TQ2B 2PS3A 3C3DA 3GIWA 3NGLA 3CLRC 5HCNA 4PQYA 1TM1E 3DE5X 2CYBA 1GY8A 4HLNA 1BEUB 3GDFA 4Y67A 5H8WA 3Q0IA 3PICA 2NAFA 4YONB 2WFZA 5DGXA 5EEGA 5HILA 4FOTA 4MWCA 1OHHD 2BMVA 3RFUA 1J8FA 3JCZA 3FVWA 3V1MA 1FPQA 3V7YA 5EZYF 4BKPA 1JAYA 3DSRA 2FNAA 3L5OA 3RS9A 5EGSA 1NBMA 4FS3A 5DHUA 5DCLA 4CMGA 3THYA 1J00A 3A4TA 1XZFA 5EP4A 4JP3A 4Z7NB 3SR4A 5JYBA 1ISFA 4ZI7B 3L46A 1R66A 1W85B 3IKJA 4N5IX 5ITWA 4UHEA 3M2TA 1XN4A 4DNPA 3O95A 3ZUPA 3O93A 2D5BA 3ECCA 3HMQA 4JMPA 3PRHA 4KYVA 4WBNA 6GPBA 2YV5A 1P9NA 4C1NA 3I76A 1Y98A 4LYAA 2I3AA 1BQ3A 1SU4A 3CGWA 3G9XA 4N54A 3VKFA 3MGKA 4AJ4A 1APBA 3F1KA 1GSHA 3UV6A 1RI3A 5LKRA 4FLEA 4OHKA 3ZGLA 1G5PA 1C7ZA 2FCRA 1Z15A 1E62A 3RFCA 5K4AA 3STXA 4V0OA 1WR8A 1E2NA 5ECDA 3ZLVA 2P30A 3D3EA 4WOKA 4O33A 1OBVA 4MDYA 3DCJA 1UT8A 1YKGA 3PB3A 3A4IA 2IV7A 4DOMA 3CN9A 3K2IA 1P9LA 2F48A 2VWGA 4WRRA 4UM9B 1T9CA 2QEQA 4YMIA 3KWLA 2XA9A 2XMZA 4AJHA 4IIVA 1T9BA 2NP6A 1J2RA 4PSCA 1EB8A 1H6DA 4YT8A 4JKIA 5AVKA 1OXBB 3LF1A 1RWPA 3PRKE 2GF9A 5IJ9A 2V8BA 3W8EA 1TTTA 5A9TA 2PV7A 4HQFA 1S8AA 4UAUA 1GTMA 1II0A 3A26A 1MOZA 1AHHA 4H0CA 3VSBA 2HW8A 1KH2A 3RNLA 2XH8A 1JR3A 1QHSA 1FSSA 1QH8B 3K6RA 4MR7A 1EYZA 2ZOSA 2QMZA 4MA5A 5IJWA 4BFSA 1ZKDA 1YBMA 1XL0A 4BVKA 1G20E 4NXNB 3CR7A 1QK4A 3QX7A 3TKAA 2I78A 4QGAA 4YAGA 1I3CA 2FQQA 1N8SA 1L5KA 4RSRA 2LWIA 2Y0EA 3D6MA 5IYZA 2IYQA 4FYPA 1G60A 1O7JA 4J75A 1LDYA 4MK4A 4BEVA 5B7PA 4WACA 2D8MA 5NLLA 5JMWA 1ZGJA 5FPPA 2HBQA 4BQOA 3UPDA 5BWNA 5F3DA 1CJBA 3H99A 5SICE 2BF4A 1YJ5A 1JHMA 5AICA 4LZJA 1DIHA 4Q4HA 4NNPA 2JEZA 1BD4A 2WFLB 3T95A 2CK3A 1JWBB 3TBKA 2ZXFA 3DXYA 3BGWA 1U1EA 2PBRA 2VDLB 4HMPA 4ARZB 1K68A 3M4JA 4IUCS 5DDIP 2AC7A 2I2XB 3SIRA 1U7ZA 4QTZA 4RZXA 4RPHA 2O54A 4UHFA 2H18A 4LVNA 3QUQA 1RKVA 5KNCH 1RLIA 4AL4A 1QO0A 1T13A 1ZCBA 1UJ6A 2CBXA 3KKMA 2ZPAA 4FONA 1QIHA 3IT3A 1GD1O 6PFKA 2JK0A 4RORA 3PC4A 4I1RA 3UBTA 1FMTA 5EXDA 2QTBA 1S8NA 4RKQA 5CFOA 5EUCA 1CK4A 4OSEA 3TL6A 4PTLA 1TQ2A 3CKLA 4PLFA 1PW7A 3RBZA 4G4SP 3KT6A 1CUEA 2GN4A 3GVHA 3TCXB 3UANA 1Q0PA 4J2HA 1CR2A 3F3YA 5FJIA 1XN1A 3TGWA 4KLRA 4IDBA 2IGBA 2VH1A 2WAAA 1EVKA 3EXHC 5DP2A 1Y42X 3FWPA 1HOXA 4PNPA 2A1UB 121PA 1WU8A 2RDMA 3TXYA 4K9SA 4NAUA 1X42A 3QU2A 4Q9KA 3NV7A 4ZGBA 5IPFA 3R09A 3GLSA 5JS2A 2NXWA 2QXTA 4HWOA 1LBTA 2BEUB 2R87A 4D6YA 2DUUA 3UAWA 3Q6NA 5CHYA 4LEIA 4TMYA 4MCIA 1R88A 4RMGA 2BVNA 3NHKA 2BM9A 5AKEA 4PVDA 3DOUA 1ILEA 1BC5A 3AY3A 1Q15A 4EOGA 4RHXA 1LY1A 4K9OA 4BNTA 3W3ZB 3WWYA 4P3OA 4V0RA 1QHGA 2Q62A 4DDWA 2PGIA 5D5HA 4E2ZA 4B3GA 1AZWA 1XPUA 3ESAA 1K7EB 1U8XX 1ZOOA 6REQB 1NF8A 3IOMA 1VDMA 4IKEA 4KWTA 3IPRA 2WHPA 5A71A 1ODTC 4KAAA 1NN0A 2EL7A 2FN3A 4PTZA 1OLUA 4IHQA 4BEWA 4YN3A 3G1UA 3OIFA 1A9PA 1YUBA 3HI6A 5K51A 4AKTA 4AS3A 3NALA 4YUXA 2J09A 3U7IA 1RYEA 2IJGX 1Q0UA 2CUKA 4RIIA 1CCWA 1OA1A 3UMBA 5IDQA 1BQ4A 1I6MA 5CMLA 4M8KA 3UJ8A 1ODFA 2TSYB 1LKZA 1E2UA 2O2HA 5IAKA 1O54A 1C3VA 2IYOA 3EXIA 4EHLA 5ALIA 1HE4A 3I58A 3MRXA 4MKHA 3OOSA 4RHCA 2RCYA 1T5DX 4PE5B 1P45A 3TCKA 3IA7A 1RXYA 3G5LA 1PJ3A 1QIMA 3ICCA 2OHVA 4HAUA 1H42A 1JFFB 3WYBA 1IJBA 4YLEA 3Q4GA 3Q7RA 5I9SA 3T3PB 5BUQA 2O4UX 2XGSA 2EBWA 3HUTA 3OHPA 4FOOA 4G8CA 4YFYA 5TARA 3WGHA 4HK4A 4KRFA 3T4UA 2AK2A 3RFVA 1AX9A 2RGRA 3CF4G 4LGVA 4WY8A 1ZGCA 5U4XA 1UXGA 2WB2A 2IYAA 3D4IA 3LLSA 1J1IA 4DSNA 4NXMB 3S2SA 4DZZA 1Z6ZA 4MQEB 1HDOA 1FIUA 1KBOA 3PE6A 1ZIDA 3WTBA 4LE2A 1S8OA 1SC4A 2BFCB 2MR6A 1XEWX 2QSUA 2W37A 4HNRA 4O5AA 3IB3A 3OPQA 1G59A 1IXYA 3VDMA 1IY2A 1HDIA 3GDWA 3OPXA 4LI0A 2ZUWA 4U9HS 4Z0TA 3GJRA 5IBQA 2R0QC 1GXSB 5WRFA 3R8FA 2PUFA 3BQNB 2FDRA 1ZDMA 3VKUA 2JH8A 2B9EA 3BSYA 3VA7A 2PMKA 2A5JA 2DFDA 2IZ1A 3D3JA 4XPIB 3PGJA 3PFBA 1X1QA 4G5OA 2XCTB 3IHTA 1Z4NA 2D4AA 1R8XA 2E55A 2ON6A 2Y1GA 3A1SA 5DBGA 2H85A 3FKJA 4B2PA 1EG2A 5A9SA 5CG1A 3IMEA 2UYHA 2FSIA 3EISA 3EODA 1EJ0A 1XPJA 3PRYA 4ZI5A 3WZLA 4R8RA 4CCWA 1QQ6A 3TEFA 1M66A 2ACVA 3AY7A 3I1IA 4GMKA 4WK4B 1Z34A 3K0AA 5E2AA 3UATA 2J5XA 3H5NA 2OGWA 3T7AA 1M2GA 2R6JA 3QOYA 3DCIA 5IKMA 3D0RA 3LBIA 3QFSA 3RVJA 3JQCA 1YS1X 1E9DA 4J90A 1RQRA 3P4XA 8MHTA 4TM7A 1CZNA 4DLYA 1P7ZA 4JNKA 3LNCA 4QUGA 2GD2A 1VMDA 5F7JA 1DQYA 4N41A 1BGWA 1TEXA 1VGQA 5BR8B 3TZQA 5TEWA 3SZLA 3W9SA 2EWMA 1U8FO 2DWQA 4MGKR 4QEZA 1IB0A 2B20A 2R5FA 2B69A 2RKWA 4J0QA 4PG4A 3RVSA 3UQZA 4BO0A 4C30A 1C1HA 1CUCA 1HSZA 2R2AA 3VYUB 4JUFA 1NF2A 1XQYA 3V97A 4L85A 4I1YA 1SUBA 3WGZA 3LS2A 2ZBQA 3MILA 4RIGA 4CR7A 2QG4A 2QRJA 4YRMA 3GZJA 3KV1A 3O4JA 1W6UA 2ID7A 1QRDA 3GRZA 1W0KA 2R6R1 3PUYA 5TSDA 3W5BA 2OFWA 4IEEA 4HJXA 4YMUA 2GPYA 3H11A 2YMLA 1PI3A 2W0SA 2J6IA 3I9V1 1AQYA 1NMQA 3NBXX 2PXCA 3PX2A 5J4KA 3QBVA 2RHGB 2Z56A 1J1ZA 1YRLA 1R7RA 1A7UA 1YJBA 1LD3A 3ZWDA 4ZVNA 4R6WA 4L5IA 1A9OA 4G24A 4R7TA 3IURA 1YO6A 5J5VA 3D3KA 1Z39A 4H6XA 2REOA 4O2LA 4KN8A 4LYDA 1QHNA 2VK2A 5SY6A 2BEWB 5EKXA 4L3OA 4ZOBA 3HSYA 1QCDA 3FDFA 3U4GA 4EPWA 1US8B 3QKSB 2WJYA 5DHPA 2DPHA 4GUAA 1XLTC 2GPTA 4WFQA 1L5OA 1Z6YA 3W5VA 3G0GA 4HBZA 4I50A 3QA9A 4OJMX 5KSWB 5KYXA 3GA0A 1MOQA 1NJ5A 5KNDD 2HXSA 3QVSA 4ZU6X 3T7TA 4BKRA 3RC8A 1Z4KA 1B41A 4C22A 1W46A 4LXXA 4ZAFA 5CXSA 5B57C 3OM9A 4EKEA 3O7MA 3LIPA 3MNFA 3N8GA 3SI7A 5F77A 4MRMB 4KR2A 3S2EA 3VH2A 1Z5UA 3L93A 1LSUA 4YMVA 1ULUA 2ZI3A 4GM0A 3TOZA 2CY0A 2JGKA 4UNSA 4RTRA 3GEBA 4CCYB 4AJIA 2NUAA 4HOYA 4R84A 4DCTA 3PYXA 2ECFA 2OCBA 2XR1A 4U7DA 4GIBA 3WXBA 4TUYF 5JCPA 4GLLA 4BU0A 2F2TA 2C96A 1O87A 1Q7EA 1KI2A 4EJSB 1M0EA 1XQ9A 4X20B 3NUQA 2Q8QA 1TUGA 2FMHA 2PEZA 4TS1A 1P19A 3V8RA 4B6EA 4KNYA 1BDIA 4OB7A 2KJQA 4ZCIA 4F3TA 4BZXA 4BMVA 3UBMA 3OIWA 4XCXA 1RIIA 2B8NA 2PX2A 3PEFA 4ARSA 5EJ5A 2ZTLA 4XUEA 2ES4A 3ZY4A 1CT9A 5F35A 3P9SA 4YLGA 2DFPA 2IY9A 3KVNA 1YD7A 3EEIA 2VRNA 4RA6A 3S27A 2IEAA 3TO5A 3M6MD 2AVDA 4QATA 2VUHB 1U7XA 1QR2A 2QRMA 3N2ZB 3P9KA 1G20A 2WYIA 5FUYA 4IO1A 4WN3A 3T1NA 2FW8A 3WKDA 2AN5A 4NQZA 5CIYA 2JJYA 5ADUS 2AFIE 2CE2X 4FOPA 3SD7A 1Y4AE 2ZYTX 1E3SA 4X6YA 2V8OA 5ABPA 2X9GA 1X8KA 2PGAA 1QGED 3QNMA 4YP5A 5F4BA 3UGJA 1O5IA 2QZPA 3F49S 3I6ZA 5E6RB 5KYKA 2PX0A 2WSSA 3M1AA 4N7MA 4PRLA 4B8WA 4I3FA 5A0FA 4IDAA 2G1KA 4X45A 1QTQA 5SY4A 5AVSA 4GGMX 2CL7X 2QPTA 4OQEA 3O92A 3MQFA 2LNDA 4B6FA 4XQGA 4EECA 4LNUA 4LXHA 4MX8A 1Z0IA 4YAJA 1Z88A 4HTFA 4KXYA 3RRNA 2QS9A 2XGGA 3OIYA 2WLSA 3A14A 1MRSA 3EVTA 4OHMA 1J2YA 2UZ4A 1OTXA 4NSNA 4UC0A 3ME5A 3Q10A 2FI1A 2VT6A 3ETLA 1KFBB 3PEVA 3NFYA 1ZM7A 3JQQA 5DX1A 5FV4A 2IBTA 1U1GA 5TEVA 4L5CA 4NZOA 3K0HA 3IUNA 2Y4NA 4U3JB 5JC8A 2R6CA 2AGVA 2NTYC 3GGJA 2VF8A 4MRRA 1ML3A 2VT2A 4LVOA 2IQIA 3R4CA 2FCAA 3C3WA 2C5LA 3DOOA 5IKXA 2OOSA 3OCYA 1I4DD 1IMJA 3FPHA 2EG5A 3WBFA 2L0XA 5KDDA 1GUYA 4B3JA 1KETA 4FZ3A 3QI2A 4LJ5A 4DRZA 3H16A 5EHZA 5KOHB 2FZCA 4AJ2A 3CPJB 3Q3HA 5TVKA 2Q6KA 4YJFA 1D0IA 4F8JA 3KETA 4WJLA 3RANA 5A02A 2DWUA 4DWVA 3ZOKA 5G02A 3OCXA 1R64A 3PENA 1M5RA 2GNAA 3EGDA 1IUPA 3IMGA 3IUPA 5J47A 3VR5A 4D9NA 1N8KA 4QWMA 1P0FA 4CMIA 2HQOA 3EFBA 4ZHSA 5T57A 4LDAA 1NOIA 4HEQA 4S1TA 5B7GA 5BR1A 1GJRA 5LQMA 4TKZA 1FYXA 2Y77A 3CURA 1XVAA 4JBHA 1SD2A 3TQIA 5DOZA 1UBKS 5GQSA 4M36A 3QMVA 4IFEA 3SFTA 1ZINA 3KQLA 4KZKA 1W4BA 3WKEA 3ONEA 3KQSA 1G3MA 2BGGA 1DRWA 2BUAA 2P2ZA 3W04A 1SHJA 2YH2A 2QBYA 4S1PA 1Z56C 2WKWA 4LTDA 5DNCA 3V4RA 1KR5A 3C4JA 4X90A 1BZYA 3B51X 3L07A 5LA6B 1N4AA 3ZLUA 2DJIA 4RVCA 1UH5A 1EK0A 2H51A 2ISCA 1E61A 4GEGA 4R2HA 1JPVA 3HZOA 5DFAA 2XCSB 4GR5A 2AN3A 1E9SA 1BVHA 3DUFA 1J06A 1RQ2A 3QHQA 1GVHA 3ET4A 5JDCC 1C1YA 2ZYHA 5A05A 5JEDA 4RFSB 5EJEA 1VBMA 1UPFA 2XCUA 1C30B 3G1TA 3D0OA 3G8CA 2C82A 5AK6A 1AY0A 3K0FB 2ZQZA 4TTVA 3RAGA 3TZHA 1A9SA 2AI3A 2CKMA 4LE1A 5FPSA 1A7AA 3EZXA 2G1PA 1Y9JA 4JBXA 4KGVA 2I9KA 1RZRA 4V2IA 3V8QA 5F7XA 1I13A 5JY6A 5KVVA 2H4ZA 4C6TA 1UPCA 2VT3A 2BL4A 2VQDA 4L7QA 4YCAA 2IS4A 4UTVA 1N2BA 2EWVA 4WCFA 3KAQA 4ENWA 4CEIA 3A2MA 2H52A 4MUIA 1V96A 1HT1E 4GX2A 1ESDA 3WI7A 4DV4B 1U02A 4RK1A 4NFHA 5JD4A 2XDYA 4E03A 2HU5A 2IW1A 1B8UA 3RSHA 4YRBA 1ECJA 4A16A 3K9QO 5D5PA 3GF4A 2UVPA 3LPDA 3QZUA 5DTMA 1I33A 4UU0A 1L5NA 1P2SA 1ILWA 3O4IA 5DHTA 4IXTA 2O3QA 4RHEA 4YRRA 3O21A 5ETJA 3ZGNA 4WKPA 4LI3X 4P86A 3RYCB 2WSSD 3P0EA 4ZVSA 2DBRA 3D1LA 2A7XA 3HGMA 3EQ7A 3PTLA 1DX4A 4PX2A 2ORYA 4FHGA 4X64B 4B74A 3KT3A 3Q7TA 1TU3A 3ND9A 4H35A 1MAWA 1X80A 3OSZA 1S3FA 5J2UB 5LP6B 1KU0A 1JH8A 1MBZA 1SY7A 2B3DA 3R20A 4JP8A 3VR4D 5I7EA 1XZIA 1HURA 1MH1A 4DCPA 5C5CA 3QBEA 2ACKA 3AF4A 3NDBB 1EESA 4EATA 5TQJA 2OG2A 3GGDA 4BVLA 1C1XA 2B94A 4NG5A 2AEFA 3R76A 3MB5A 1ZOPA 4PS1A 3H5AA 5JVDB 2OUKA 3MT9A 4I50F 2PU5A 4JOSA 3SFVA 2PKRA 3PPXA 4RLFA 4G56A 4BLSA 4Y1RA 4J2TA 1ADBA 3QWIA 4C05A 8GPBA 5KCZA 2V55B 4KXWA 3Q0TA 1QMGA 3BCRA 4EZIA 4GOKA 4JLBA 2JHAA 3T0FA 1N3IA 4EY5A 1MJ5A 4JC0A 3E7DA 1I01A 4E21A 1DQRA 2Q4EA 2Q9UA 2XF2A 3I6YA 5B1HA 3TPZA 5CLFA 4GLOA 2CJPA 2AJ8A 3JVIA 3UMRA 1L6IA 5C1PA 3CHYA 4ARUA 4EB6A 3MMZA 5I7UA 2G9UA 3NOXA 3DZHA 1W0CA 1EM6A 3F46A 1WZEA 3QUCA 3TTYA 1S2OA 3O9ZA 1JYSA 3COSA 2HK8A 3O1IC 3WY9A 4H7HA 3A6ZA 4FHEA 4K9DA 4TV8A 1Z18A 3LUPA 3WE7A 1PJLA 4EHJA 2PJRA 3N7UA 3CSDA 2ZJ5A 2VP5A 3EAFA 4JU9A 3JVDA 2PLNA 4KDFA 4QXPA 3RK1A 1EWTA 4F85A 2YXPX 3BWYA 5GJWC 2P4QA 3WLTA 4BNDA 4NCKA 4AMVA 3BS4A 3UKOA 1PDOA 3DONA 3FM9A 3HLYA 2GK6A 4MW2A 4WZZA 1T2VA 2NACA 4OHOA 4H3KB 3CRNA 3LBNA 2CD9A 1JDZA 4Q47A