4FDFA

Structural insights into putative molybdenum cofactor biosynthesis protein c (moac2) from mycobacterium tuberculosis h37rv
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
146
structure length
134
Chain Sequence
GAAHMVDITKRTAVAAGILRTSAQVVALISTGGLPKGDALATARVAGIMAAKRTSDLIPLCHQLALTGVDVDFTVGQLDIEITATVRSTDRTGVEMEALTAVSVAALTLYDMIKAVDPGALIDDIRVLHKETRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into Putative Molybdenum Cofactor Biosynthesis Protein C (MoaC2) from Mycobacterium tuberculosis H37Rv.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Biosynthetic protein
molecule keywords Molybdenum cofactor biosynthesis protein C 2
total genus 32
structure length 134
sequence length 146
chains with identical sequence B
ec nomenclature ec 4.6.1.17: Cyclic pyranopterin monophosphate synthase.
pdb deposition date 2012-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01967 MoaC MoaC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.640 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Molybdopterin cofactor biosynthesis C (MoaC) domain 4fdfA00
2EKNA 1EKRA 2OHDA 4PYDA 3JQMA 4PYAA 3JQKA 4FDFA 2EEYA 2IDEA 3JQJA 1EKSA 2IIHA
chains in the Genus database with same CATH superfamily
4L76A 4FXVA 4DSEA 3N5BA 3KJVB 2OSQA 4XTTA 4A8XA 4WF9Q 4DL7A 4K4TA 2DCUB 2Y1RI 5LSLA 2OMOA 1R89A 3BEGB 1EZZB 1XEZA 2DNMA 3BF4A 2BW2A 4K4YA 2D9OA 4OLOA 1JLCB 3D6MB 5C25A 4DQPA 4DR5J 2WOMB 3OFEA 2O3DA 2GGPA 2XTJP 4IFVA 4NZ7A 3EVOA 5J2MA 3QO9B 2J0QD 4DFPA 4QJVA 2HAIA 2X3DA 2VDHA 3LH2S 2WVFA 1UCNA 1IBCB 1NDCA 2B4PA 1B0VA 4FVMA 3I31A 3D9BA 3DRRB 4OLPA 5I3UB 1S0OA 4LFCF 3NS6A 1XMQF 3GE9A 4CT9A 3T6JA 2KL8A 4W4MA 4ECQA 1VRQC 3QQCD 3FSXA 3R5AA 3EXYA 5A2QY 1QM9A 4IO1A 3D4JA 1RT6B 1CPZA 1TV6B 4NMLA 5IV4A 3CCVS 1YHQS 3NMAA 4IOAQ 1FESA 3PFEA 4WIIA 2VJVA 2G1HA 4BBYA 1UW4A 2V2ZA 4DSFA 4KGMA 4MFBA 2ABYA 1PAEX 3B4MA 1VQ4S 3NAHA 1NXIA 1K73T 1HNWF 2EI5A 4DV4J 3SBMA 4DV0J 2YPZA 1TL5A 4HHJA 1UPPA 3DLLQ 3UD5A 4C6AA 1S9EA 5IZHA 1TKXB 2AJ4A 4NZ6A 4WXOA 5D78A 2ZH9A 2PIIA 2XZDB 1FRJA 3OSPA 2HQDA 3HSZA 1HHTP 3A8EA 1Q86T 5JVHQ 3ZTRA 1NMEB 1DQ9A 5DM7Q 1PYOB 3RRGA 3KUEA 2ACYA 1PSDA 4F0HA 5A6WA 2MQNA 1WHWA 1X5PA 2D41A 3BO2A 1R8BA 3QFWA 4H4MB 4HHHA 1AROP 4ILRA 4X4RA 3PW0A 3M6UA 3MGJA 3DHWC 1TFYA 2KO1A 2A2DA 2CJBA 2B43A 1FFWB 2V4RA 3D6FB 4X4OA 2J7KA 2M4MA 4KR0B 5IWAF 2A0FB 4RUCA 4CH0S 3LF0A 1B7YB 4W92B 4IRDA 1AZSA 3IG1A 3ZZYA 5HN0A 1H7XA 1LFWA 1ZM2A 3CCUS 1CS4A 4JYAJ 3CNQP 2BJ7A 5B7WA 3MEEB 4U7UD 3Q23A 2VHGA 2I5JA 2XNQA 2KRBA 3ADAC 1N48A 3ZC4A 1HNXF 4USVA 4NLPA 4EO6A 4ZIVA 2Z58B 1BQXA 4DR1J 3P5BP 3EMTA 2FVCA 4Q43A 1X4FA 5ETOA 5KFOA 1GMUA 1L3VA 1BMQB 3GFHA 3KFWX 1KEKA 5J1PA 3PX4A 1T05A 1YKWA 3IAS9 1MLAA 2BE7D 1U1KA 2ACMA 4I68A 4CO0A 3X1LB 1A6LA 2FVRA 1JJHA 2B6AA 2HHPA 2POKA 4GO5X 3UN3A 4C0HA 4FS2A 2IPOB 1VRUB 1VISA 2DEIA 2VL1A 4FZVA 4I64A 3IMQJ 2GHVC 3LP2B 3TX8A 1DZ5A 1UJ4A 2HNDA 2JEFA 5DG7A 4RW6B 1VRUA 2YWWA 4NL5A 1RZMA 2X3GA 1ZBTA 3QLHA 5K5MA 3OBIA 4DN0A 1N52B 2DXDA 4ED6A 2IMWP 1T03A 2PFFB 4MT1A 3O2IA 3ILOA 1BQNA 3T5KA 1RTHB 2Y0SD 4YOEA 3JS9A 2ALYB 1R6VA 2H3EB 4WP3A 3PG9A 1YJWS 4OX9J 3T6BA 4W98A 5KFPA 4ED2A 1J5OB 2YWEA 3F73A 4AYBD 2P6SA 1DQ8A 4QOTA 1OO0B 2JOQA 1F3VA 1S1UB 2EVZA 3NGTA 5J2NB 2R8GA 2HQGA 1N54B 2QSWA 4QIGA 4FKXA 5IXUA 3PKMA 3D0GE 2F40A 4G65A 4JYAF 3I4HX 2OH2A 1H3DA 3TNVA 2VKZG 2G0JA 2MLZA 1U0HB 3I9V9 3LGNA 4DHVA 2XO7A 1CS4B 5LM7E 4GMKA 3K5MA 3ISNC 4CTAA 1QJHA 3MOZA 3CB4A 4KO0B 1B99A 3TARA 2IM0A 2HFSA 2ZDOA 1S1XB 3FBEA 1VJQA 5D4NA 3VZHA 4YY3F 3G4SS 3OHAA 2QLBB 5DQHA 4YB1P 1N8RT 2XSFA 4TU7A 2VFVA 4IDKA 2C22A 3GR0A 1EIYB 1KQGB 1N32F 1YI2S 3GZ7A 4B9LA 1RAOA 1IWAA 1PG5B 3PVXA 2A10A 2P9EA 4QIVA 1R0CB 4CH7A 1R8CA 1F60B 5AJ3F 1WTFA 2Q43A 2W7AA 5C42A 3RBDA 2UVVA 4UY8T 1UVNA 1P1LA 2JX2A 1T9YA 2VKRA 4URSA 2KT2A 3FUYA 2JZ5A 3V2UC 3GG0A 1TKDA 4JV5J 2OKQA 4QBUA 2GIFA 3SDEA 3ENVA 1FKAF 3QWPA 1XR7A 2WK4A 4NA2A 1JX4A 4DL2A 2QZ8A 5K20B 1ZPVA 2HVEA 2RSQA 3MM8A 1Q82T 1U26A 1GNKA 2X1AA 1NJZA 5B0EA 1KVJA 1QTNB 2VBWA 4N76A 4OJ3A 3T19A 2KZMA 4LR9A 4HACA 3VQSA 3T5JA 3G82B 1WEXA 3MOJB 5KFDA 3PRBA 3DU6A 2DYAA 3H2UB 1TL7B 4WJBA 1D9DA 5KT4A 2LQBA 5HROA 2OI2A 2J76E 1IKVB 3AQOA 4DUZJ 2DNPA 4LQ9A 4WP9A 4KPCA 4AD6A 2DGOA 1FJCA 2VH7A 3CCJS 4G6VB 4JP8A 4RW7B 1R8PA 1WHXA 1WKKA 1P6TA 2VBXA 2FHKA 3SCKE 2ASLA 4K0KJ 4DL4A 4MKBA 3Q22A 2NXCA 1JLEA 1WUUA 1Y11A 3TUPA 2Z8QA 2JEGA 1O0PA 3BH7B 2GO9A 1HI8A 3NG8A 5J2MB 1U48A 5AE2A 4C8YA 4FVCA 1C1CA 5THWA 2JH3A 5KFNA 3KHRA 4A46A 4ANEA 4ED1A 4R8UA 2CQ3A 3R5CA 1C0UA 4ECYA 1D9FA 2XWXA 3CIMA 2OAUA 3K5OA 4ZJOA 1OWXA 3M2UB 4EEYA 2A1BA 2XNRA 3EE3A 2B4VA 1XERA 3BKFA 2UU9F 1L3UA 1HNIA 2LQ9A 2R2UA 1CSJA 1QAJA 4ES2A 2OEKA 2VG6A 2AIRB 1T9WA 1KLNA 4FXDA 2YNHB 1YZ7A 3D5MA 3BZQA 5A8WB 1CEZA 3BQ1A 3M6XA 1XWLA 2XHCA 5H9FJ 3FKBA 1IBMJ 4LF8J 5D8HB 2JNJA 4JI7J 3HHLC 2KFZA 3C6UB 3DHXA 3EPGA 4USWA 4MJKA 3QJPA 3DLGB 4DFKA 1U0HA 2A2CA 1F5CA 2HBQB 2MJNA 3MR2A 4L73A 3C6TB 3TOQA 3BGRA 4LF7F 3UVJB 3FSIA 4QWBA 4UUXA 5BR8F 3NLCA 3NOGA 4FF4A 3GP9A 3SSQA 2JSXA 5DDRC 1PC4A 2EBGA 4ZP6A 5JXSA 2OHDA 1T9TA 3VHQA 3BN4A 3D1OA 1P27B 3GIIA 4NE9C 2B9EA 4PWUA 1VHFA 5JMNA 4R5PA 1NSAA 2J7UA 2JLFA 2W2MP 2WW8A 3M1VA 3CDBA 4F2RA 3RU0A 5KFHA 5HVHA 4JV2A 1U6BA 3A8IA 2MJUA 2CG4A 3CD6S 1T03B 1RT2A 4LMZA 3PW5A 3GIJA 1FK9A 2ATCB 3C6UA 3TWZA 4Z7YA 4ZPAA 7FDRA 1UFLA 4F4ZA 1YK9A 2KG0A 4Y2MA 3G82A 3HJFA 3JSBA 2V8VA 9ATCB 4EZ9A 4URGA 2YVSA 3QT5A 4ECXA 3RW6A 3D68A 2C2RA 4DV6F 4Q7AA 1ZZNA 1Z2ZA 3DFEA 2DGXA 2FZGB 3OFHA 3RAMA 3B82A 5MAOA 2FLOA 5HJXA 1RYRA 1WWHA 5B0AA 3W8GA 1U8WA 1YQHA 1HNIB 4IYQA 2D3O1 1MMDA 1EJ7L 2CA9A 2UUAF 4LF5F 1ZS6A 3PM9A 5ETVA 4DPOA 3QAUA 4I2QB 2Q1LA 3AOAA 2PSZA 4ECZA 1NH8A 3O5TB 1NHKL 2VDIA 1H74A 2QJ3A 3HF5A 3I55S 1FX4A 1UJ5A 2I5JB 2PMWA 4ELVA 3LPYA 1U0SA 1UFWA 3T1HF 3JQMA 3TQ1A 3CULA 2HHWA 2JJ4D 2G13A 2QO3A 1AFIA 2R7RA 4DQQA 1DTTB 3NNCA 1X60A 4OQJA 4X4QA 4ZCLA 1U2FA 3GIKA 4BS2A 1S1WB 3HMJG 3MEDB 3HD1A 3VZIA 1SV5B 3I32A 1HQUA 1WTBA 3KK3A 3FVYA 4QR0A 4JI2F 3UPFA 4QR2A 2UUBF 1IKVA 1LQ9A 4ZS6A 4RLEA 1NK4A 4WE1A 2DNLA 2BEFA 4J9SA 5I42A 1KOHA 3IWXA 4ZN3A 1PYSB 4OHWA 4TU8A 3ZNUA 2B9YA 2HVHA 4ID8A 2AJFE 3NWGA 1WOOA 4OJHA 1O6XA 4U67Q 2OPSB 3MFHA 2XS7A 2RH3A 2DHXA 3MM8B 4P52A 1JLFA 1X4HA 2XCAA 2E29A 2WSFC 3QO9A 2YPYA 4NA3A 4USHA 4DXLA 3TZXA 2PI4A 1K1QA 2HHTA 5EX3A 1H38A 2IVMA 4WK3A 3SDEB 2NQPA 2QX0A 3V6HA 2W4PA 3ILJA 4C3MA 1JIHA 1CC8A 2FGOA 2QLWA 3DC2A 1X8DA 1RBAA 4Q5VA 4IQXA 1S77D 2IY5B 3KNGA 4QPXA 5L38A 3AAWB 2WSEC 3M8WA 1IM6A 4O44B 3D2WA 3KJVA 2P6TA 3W3SA 1FTCA 5GAEU 2BANB 1E6VB 2RD5C 4JI8F 2FZKB 2YKOA 4OJGA 2BE9B 3TX0A 1RHMB 4DPUA 4U6PA 1YBUA 3Q8QB 4FDFA 2L9NA 3MUMP 3DLHA 1LXJA 3GONA 1XR5A 2MTLA 2XGQA 4B9UA 2CQPA 1Q16B 1LWCA 1MWZA 4USJC 4DX6A 1RT7B 4P2FA 1WOSA 2LDIA 2FY1A 5KFMA 2J5AA 2ZDPA 2GJFA 3QSYB 4DV0F 2MQPA 3KTQA 5EGYA 2AYBA 1FRMA 3DU5A 2MKHA 1RACB 4PXDA 4U96A 3UCUP 1HQEA 2NXUA 3EZ5A 1S49A 4DSJA 1JJ4A 3MM9B 2E1RA 4WPAA 4ES1A 5AXKA 4F67A 1VBZA 2IM1A 2JL9A 3D1HA 2J9DA 4M63A 4ZCMA 3KLGA 2ADBA 4OL8A 1RK8A 2XMUA 3FNNA 4NCGA 1NUEA 2E66A 3PHEA 3H2LA 5DQIA 2E5IA 2MSSA 2V4JB 1S6PB 3QBCA 3K59A 4FF1A 5K14B 4ZPCA 4CLTA 2MMYA 4L72B 1FFGB 2AJ1A 4L74A 4PQUB 1UWAA 2CZVC 5DDPC 3PY8A 2XMTA 1VRTA 2GMJA 3HHLA 3LA0A 2BRLA 3EGWB 4IH5A 1VGYA 2C3MA 1HBMB 2QMXA 3CDUA 5C24A 4F50A 1FNOA 4EZ6A 3AB2B 3OW2R 2VPZB 1QSSA 2KVQE 1DAXA 2HEKA 2CWKA 2KT5A 4CO4A 4M5DA 3J81Y 4ZP8A 4MH8A 4H54A 3BSOA 1OYDA 2E7XA 3DLKB 4OZNA 3VR1A 1RU1A 4IG0A 3PEJA 1RT4A 4FF3A 3W66A 2CZ4A 3K5LA 2O01C 2Q3PA 1R7IA 1GXLA 2MHEA 2QG9B 2FZCB 1T9XA 2R7OA 3CD7A 3HHDA 3TJ9A 2CIMA 4ENOA 1GX5A 1OPIA 4PG8A 1TUVA 3OTOF 4PQUA 1RTJA 3MMAA 4FYDA 2ILYA 3HT0A 3PIPQ 3HM9A 2CYYA 2OFGX 1IBMF 3W62A 3P5TL 1RT1B 2JEJA 1T3OA 1TKZB 4ZK7M 3Q8SB 3LWLA 3I0SB 2P5VA 2QYCA 1IKYB 4NLWA 4OZJA 2LEPA 1BY9A 1EETA 3ZZ0A 4WFNQ 2PN6A 4LSLA 2GS8A 3OL8A 4PWWA 3OUYB 4A8KA 3T5HA 1NSQA 2CZ9A 3LGMA 3KLFB 5H9EJ 5LL6d 4ZJQA 1HQEB 2HRUA 3C19A 2NPFA 2D7SA 3UWTA 5AJ3J 3ITHB 1GK8A 3CJTA 2RILA 1EP4B 3DLGA 4XK8C 3VGTA 4F0MA 3TZYA 4IFYA 3G87A 2KM8C 4RW4B 3HFVA 4FYYB 2UU9J 1LWCB 2DB1A 2RQKA 1HW8A 3D28A 1FFSB 1S6QB 1NCLA 2J6TA 2G4BA 3HULA 5G0RB 4O0IA 4B9SA 3FSYA 4KKOB 1RT5A 1O51A 3M8YA 4F04B 1J27A 3KLGB 1JKHB 5B08A 1YJVA 2FHJD 2M88A 2QYGA 1UKUA 4NEZA 2J8SA 5KOXA 3A4TA 3N5FA 3I5AA 3RW7A 1K0VA 1FVSA 2HURA 5DLFA 2ZH7A 2EPIA 2OGUA 3OJSA 4E2FB 4KH0B 1LW0B 2XWYA 2F9DA 2IMOA 1H2VZ 3EVMA 5D3GA 1XNRJ 1RWVB 2E1MC 1S0VA 4B9NA 3IAM9 4JI4J 2QLFB 2CJ9A 1YJRA 3D3CJ 1FKPB 2VZ9A 4MIAA 3R5BA 1DBDA 2B56A 4Y00A 2R3VA 4BHQA 4NCBA 1Y5LB 3LAMA 3CMES 1YRTA 1WEYA 4WE1B 2QMWA 1U49A 2V94A 3QT8A 4OYMA 3QZ7A 2RNEA 4J9KA 1WG5A 1RYSA 2ZH1A 4ED5A 2LP4A 3ETMA 5DM6Q 1UJ6A 3H90A 3SYZA 2W9CA 1L3TA 1Y0HA 1TAUA 1T7PA 5D4OA 1HNZF 3S1TA 5ETLA 3HCXA 4WTOB 5LXRA 2AJ0A 3M8RA 2W9AA 1MWYA 3Q0AA 2OLWA 1AT1B 2AYEA 2ZH2A 3I5BA 3H5XA 2WOMA 5CD4A 1B4SA 1KS2A 2CJKA 2CPEA 3OXGA 4RUAA 2ASYA 2JWNA 1CG2A 2UP1A 4DR3J 1NSPA 4IQMA 2FHOB 3C14B 3JTPA 4LF9J 3FZBA 1S7HA 1QSYA 3JYTB 4OI0A 5L1IA 1EQMA 1CULB 2MYFA 4MMOA 4DX5A 3G71S 1APSA 3DGVA 4DI6A 4GO7X 1OYEA 4OI2A 5HVFA 2C1EB 4ELTA 1IKWA 2P9GA 2GAHC 3W1YC 5HMYA 3R9LA 4KGVB 4OJ1A 4TY9A 1FRIA 2JLGA 1FO1A 5D0GA 2IBKA 1I94F 2D3OR 2HQ3A 3MEKA 2ZD1A 3QAEA 3TO8A 4CWBA 2NYIA 4YB6A 4RW8A 2F7VA 3T9NA 2YTCA 5D0HA 3W2VB 3BGLA 5HMWA 3G6XA 2CPZA 2M8DB 3DCAA 3TJ8A 2YX1A 1HPZB 1KVIA 2GVDB 3MCMA 3V81A 2ATLA 1HWKA 3JSMB 4LSNA 4JI2J 4C4WA 5KG0A 2MSTA 5CAAA 1XN9A 1S1WA 2CPFA 1D0EA 1TL4A 4LBHA 1NK5A 1DURA 2Z2MA 1KDNA 4R5PB 2JFDA 4M5IA 4WU2A 1ZM9A 5C2GA 3DI6A 3JB9k 4NCAA 5CA5A 4ZVHA 2F3JA 3VV2B 5D6GA 2MXYA 1AYEA 1ZTTA 1VBYA 2Z2ZA 3CJKB 4DPWA 3I0SA 3OTEA 4ZP7A 1QVGR 4LF8F 2HFUA 2HPUA 2L3MA 1L5UA 1RT1A 1VHIA 4Y65A 5A2QU 1FDDA 1VDHA 3M9NB 4ZVEA 3KLHB 1RT3A 5ITHA 2CNKB 1MN9A 1LV5A 3MM9A 4TLRA 1TQLA 1WHVA 1HBNA 1Q1KA 1YJTA 2HK2A 4TN2A 2DNNA 1U8SA 3ENWA 3K2YA 5K8OA 4IKAA 1T8EA 5KFXA 4YFUA 3J81U 1U02A 3CD0A 4NLXA 3I56S 1SC3B 4Y34A 4ZVRB 2C3OA 1EB0A 2HQCA 4TY8B 4NXMJ 4M5NA 2IJFA 2RUGA 3RRKA 2ZJQQ 3J7YU 2WVCA 2CJAA 3IGNA 3DGPA 1R8HA 3ILLA 3EPIA 3SXLA 2MY7A 3FCHA 2DNRA 3MUVP 3CE8A 4P7VA 2OPPB 2ZBPA 3VCDA 4DWIA 2E9TA 1LK5A 2LKZA 1CLFA 3IWLA 4C8NA 2EEYA 4X62F 2XZTB 1NZ8A 3M32A 5KFBA 3ZFVA 1WKJA 4ELUA 3W9HA 5LJ3Y 2RS2A 1TKTA 3B78A 3V6DA 2V5HG 2Y1IA 1FE4A 4YEAA 2K3KA 1QAXA 1RWWB 3PHTA 2JVRA 4RNNA 2LFVA 1K47A 4KV8A 4GC6A 5CYMB 3HVTB 3TYTA 4ZVSB 4CO2A 1N6QB 2PMHA 4NLRA 2DXFA 5F0UA 1TFWA 3NL0A 2ZOMA 1TMMA 1F3FA 2KYXA 3B54A 3PRDA 1IQZA 1S59A 2KU7A 1VQPS 3RR7A 1SVDA 2KHDA 4WTYA 3ZTSA 1XC9A 2PI5A 2ZUGA 5A8KB 2DR9A 4ZHRB 4ETXA 3QGPA 4D3HA 4OX9F 3MPYA 2DHHA 5E41A 3TI0A 2I0XA 3MFIA 3IS9B 2GNKA 3G6ES 3TUJC 1M5PC 2UVRA 2WVDA 3M8QB 1VOMA 3E51A 5HL7Q 1S79A 2DNZA 2HKEA 1UL3A 2VC0A 5A8WA 1N34F 2F63A 4OYWA 2GV1A 2YKNB 4JV5F 2M2BA 3OR1B 2CRLA 2RMLA 3GYGA 2FDNA 3HO1A 2ZHAA 1G4CA 3W5ZA 1HNVA 2VG7B 4I56A 2M3DA 2VODA 4KGKA 2N4CA 3UNGC 2P9CA 5KT6A 5GMDA 1Q81T 1E6VA 2DH7A 1Y7PA 4MKYA 4ILLA 1FKOA 3PNIA 2IM2A 2AZ1A 3DMJA 2A6MA 3G9CA 1R6YA 1MU2B 1ZM3A 1JWWA 4DS5A 4ZPBA 4C0OC 1M5KC 3SSRA 2FD2A 3I6PA 4S0MA 1J5EJ 2GQ2A 2E5LF 2B0GA 2W4DA 4CO1A 2QA4S 5DS7A 1CJTA 3C3LA 1VLYA 5E3AA 2MKSA 2RF2B 3BREA 3OD2A 1KTVA 3UN5A 1NDLA 1T0TV 3MAHA 1H73A 3FZ2A 2DIUA 3M30A 2XLJA 1D1UA 3CCTA 4GVBA 2QV6A 4Y28C 4HT5A 4CM2A 2HFOA 4RBVA 4F2SA 1YZ6A 2WB4A 2ZKUA 5KFYA 3OHBA 1RB0A 2N4DA 3RBEA 1VQ6S 1QLNA 1G1XA 3PZPA 4G3IA 1HNVB 1M1GA 2W01A 1FRKA 2L41A 4C3LA 2H51B 5E33A 3PRVA 3TVZA 2MGZB 3PJ9A 2DITA 2VQFF 1URRA 3ET6A 2R8JA 4M95A 3LP1A 1YJ7A 3B8HA 1NHUA 4FBTA 3L95X 2DPJA 3OTCA 3R27A 2CDRB 2RQ4A 3I5CA 2ZH6A 1JJ2R 4JV1A 2HZAA 3RBXA 4CZCA 4DFMA 1OSCA 3V4MA 3PO5A 4P75A 5KG1A 1KLMA 3X3UA 2B9WA 3FRYA 3VGSA 5KT2A 3S7RA 4DS4A 4Z37A 4NLQA 4K4UA 3IFEA 4LBIA 1ZA2B 4N7TA 5L46A 1NK8A 2U2FA 1KC8T 4PYAA 3BDPA 4ZKAA 3GJQB 5RUBA 5F8LA 1HNZJ 1SIWB 1TK8A 2E5GA 4J9RA 3M2VB 2IAJB 4CYUB 1FDNA 2MEWA 2YKMA 1B0TA 3ZZPA 3CC2S 4RO0A 2AX0A 1PKUA 1Z2LA 2CXEA 2K2PA 2DCLA 3N6NA 3RYLA 5K8PA 1IM4A 3CCES 1D8ZA 4K4SA 4YDDB 3UNYA 3CMQA 2EWHA 3IG1B 1Q4RA 1QE1A 3OTOJ 3UQSA 3H59A 4I6YA 4F3QA 4K4WA 1Y5NB 4DV1J 4C8ZA 2HHVA 2I6WA 1BQNB 3DNCA 4O4GB 4JI8J 2F8EX 5DZ6A 5F0WA 3R7SB 3L3CA 2ZC4A 5DQGA 3L7PA 1DLOA 1SB6A 1FEHA 2GIRA 1F9HA 2L9DA 2VC1A 3D6TB 4YQWA 3LPEA 3DGPB 2DD8S 2E44A 1RKJA 1N32J 2MZQA 1TZ0A 1Y4ZB 4NLDA 1SPBP 4CQ1A 1FXRA 2CWXA 3NNHA 5KG5A 3M2UA 4J5OA 4DSLA 5A8KA 5EWGA 1V9OA 1IJEB 2GHPA 5HI7A 4RBTA 2MZRA 1MW7A 1N33J 2RT3A 1G7CB 3V4IB 3TANA 2WVBA 1OMSA 5GVQA 2ILZA 1N6QA 3H8YA 4CRJA 4QW9A 1M0SA 4DL6A 1F0XA 4K0KF 1OSDA 1RTIA 9RUBA 4Q8EA 2IYGA 2MQ8A 2OD6A 3BBCA 3KJNB 4DX7A 2V50A 4B3OB 2ZHOA 4PAAA 4QWCA 3EWGA 1G6BA 2VBYA 3H20A 3SV3A 4F02A 1JLBA 2KHCA 1XTZA 3U02A 3PR4A 2RB7A 4H4KA 4LR7A 1Y00A 2YNFB 3F0NA 3BGOP 1F5BA 1R0BG 2LEBA 2L9WA 4OZ5A 3UD3P 4ED7A 1KKHA 2Z4PA 3HFKA 4MK9A 5BXIA 3MEGA 2IRXA 1VIXA 4B3TF 3B6BA 3GFXA 3C46A 3BSCA 4NPOA 2OPQA 1JNRB 4C11B 4ZCKA 2CVEA 3H4DA 2OMLA 1BUXA 2DGWA 2ZM6F 2RUSA 4KV8B 2NXEA 4RJVA 2MKYA 3H2VE 2DNKA 2M70A 5IS2A 1H98A 4O0NA 2YXLA 4OFZA 3MM7B 4QCLA 2BZ2A 3BN7A 1T11A 3MPVA 3W61A 1F9FA 3M4XA 2XC9A 1N36F 2RU9A 4MYUA 1FXDA 2IA6A 4LSNB 3TP2A 3CT9A 1UA0A 1TR0A 2DH9A 4LR8A 3M8SA 2CQGA 2RRBA 1RA7A 3V81B 1UWBB 1Q7YT 4NI2B 2HHSA 3ZZTA 4KJIA 4O4GA 3VAIA 4USTA 3NMRA 3CJ4A 2ZH4A 2JHEA 4MKVA 3PO4A 2SXLA 3D0IE 2LDYA 2M9KA 4NLVA 2KVIA 4UQGA 2K1RB 2NUUG 5F3TA 1DQAA 1X4CA 2ZC3A 1NPPA 3BBBA 4AXIA 4U8YA 2ZJPQ 4JI6J 1GX6A 4KIAA 1UEVA 1IKWB 3WQPA 4P10A 1QDUB 1HR0J 1G2EA 4WFZA 1TKXA 3MMBA 3FFIB 4UOFA 4A8MP 3DYAB 2HHHJ 1S9FA 2B4UA 4WZMA 3I0RA 3QATA 3KLHA 3BR8A 5H9EK 2I38A 2BA9A 1ELOA 5ETQA 4KQZA 5IQQA 1KLMB 4JI6F 1S9GB 4Q45A 4DV7J 4P9SA 4DEZA 3F41A 1J2VA 1Y3KA 2CQIA 3NWRA 3AFGA 2UVUA 2B51A 1RBOB 3B4DA 2R9LA 2V9WA 1LW2B 1NLKL 2AEMA 3DDNA 3HKWA 3JTNA 2F9JA 4XAKA 1YLXA 5D15A 1N5TA 2YKNA 4XPCA 3HT3A 3SIPB 1KFSA 1MNEA 2X7IA 1PYTA 3SSSA 2PD1A 2ASJA 1JLAA 2LU1A 2YX4A 3M6WA 3K5PA 3SI8A 1T3NA 2HSEB 3MHYA 1RHJB 1RWOB 2DNHA 2DPIA 3FJ2A 5U47A 4NYZA 3KK2A 3VAHA 1IKXA 4PG5A 4DV4F 4P73A 2HNDB 3UDEA 3ZZRA 2FC8A 4ETZA 4ECWA 1F2GA 3G8SA 2GJIA 3KLIA 5E7OB 1KRPA 3CTRA 4X65F 1WD6A 4IDKB 4I69A 2NYHA 3DRPA 4DG1B 3BJYA 3DMJB 5HMXA 2UXCF 4U8VA 1IJFB 1RDRA 5FIIA 2Y0BB 1S1XA 1VQKS 4EBDA 2BE2A 1I1GA 1H2TZ 2AP6A 2EFPA 2X1GA 3IS9A 3NCPA 4RW9A 1RTZA 3TEHB 3VF0B 2MKJA 5IT0A 3OVAA 4JI3J 1XMQJ 1WELA 2RKIB 3K8VA 3NS5A 3QGGA 1T05B 1WEZA 3FCWA 3A13A 2HMIA 5MLCV 4I2PB 3OR1A 1XQIA 1Q53A 3QMQA 1I94J 4DN9A 2QA2A 1EQ0A 2AJQA 4U7CA 4WYLA 3JAMU 3FCVA 3UR3C 2ZFHA 3AJDA 3SQOP 1SJ1A 5GAEI 1AUSL 1F9EB 4B9VA 4KFBB 2PA8D 3KG1A 1J5OA 1ULRA 3KXDA 2DT9A 3RUBL 4X4PA 3KUGA 3C15B 2LCWA 3BM7A 4OV6A 4ZOSA 4AE5A 3K7RA 3N28A 2YX7A 4OHZA 4ZCIA 2LXIA 2R2SA 3CF5Q 2MPUA 2KH9A 2EK6A 5J1NA 2M7SA 5LJ5Y 1YVFA 4P2MA 4QWEA 4PKDB 4K59A 3IWNC 1S6QA 3EDRB 1PBUA 1RLCL 1SXLA 2ZD1B 4ZVPB 3TAMA 2KM8B 2WONA 2K7JA 2HNZA 1RU2A 3NGUA 1I51B 3HSDA 3Q8PB 4QWDA 2CVIA 3GILA 4ZPVR 2M8HA 2FYXA 1VC6A 2G9OA 2D3ZA 2E7WA 2G1DA 3MURP 1SIZA 4UZCA 4O3OA 4B3MF 2JEIA 2GW8A 1UEUA 2W2OP 2XY7A 2B5JA 1LWEA 2CQ0A 2C3YA 1NM2A 1RAFB 2BVZA 5L1JA 5DGBA 3BH6B 1HPZA 1HWIA 5LXYA 1HFEL 1NKBA 3OPKA 1VJWA 2PA3A 4IG3A 5HAOA 3KG0A 1KQFB 1SL1A 1FI4A 3VGVA 3MI7X 3GSIA 4K7QA 4F4WA 3AH6A 4CDIA 3RAQA 1L3SA 3CDWA 4LFAJ 3TUZC 3MF5A 4NLUA 1FE0A 1KP6A 2CQDA 2OEJA 2OP5A 1BHNA 3GTYX 4B9MA 2YWGA 1YJ9S 3DXSX 1ZYQA 4TXSA 3LANA 3OT9A 5AT1B 5L1LA 4AL6A 1QSLA 5DDQC 1CJVB 1N5YB 1XMBA 4DR7J 3POTB 2GCFA 1GTEA 3CDEA 4UZBA 4ZITA 4DUYJ 1NPRA 3IR6B 2LA6A 4ZPDA 4U95A 1P9QC 5E3PA 3W2WA 7AT1B 4RX6A 1FWLA 2W2PP 4ICLA 3LTOA 5H1SV 1HLWA 3KJQB 4QZVB 3NAIA 4DPYA 3KLEA 1RCXB 2CNNB 2GO8A 1J5EF 4LF6F 4N41A 1EARA 2NXNA 3W9IA 4DV2J 4ZLJA 3ILIA 1VQ9S 4B17A 2YQ3A 5IV3A 3ENAA 3CW2C 4ED3A 4GKJF 3JYTA 4DPXA 2B8QA 3D6HB 3SFUA 1NRKA 2DNGA 2CQ2A 2IVYA 3Q24A 4FS1A 4CLKA 3GWCA 5IM0A 1FRLA 2CPHA 2MQMA 3LOUA 5CYJA 3OTBA 3KK1B 3FK4A 3MPUB 2B8PA 2VQEJ 5E3CA 2VIHA 2VOOA 4G1PA 4CT8A 5G0RA 4IOBA 1U1RA 4CIOA 1IKXB 1JLFB 2Z0GA 1UPMB 2QTWA 2Q6BA 2VOPA 1I6JA 2HHUA 3CCRS 1GMVA 2XM3A 4GKJJ 4LF4F 4OI6A 3AOBA 1RWXB 1OIAA 5FDLA 2IHR1 1QUVA 1TL3B 3THPA 4E0DA 4JI0J 2JDJA 3MPDA 5DETA 2H5EA 2KYZA 4OYAA 4RUHA 1LXNA 3M7VA 2Y9HA 3H0PA 4ZMMA 3QRPA 3DXBA 1REVA 3CPWR 1RAEB 1RHUB 2DK2A 2V8GA 2VF3A 4F4YA 1GXTA 2ZZNA 2AX1A 2M0GB 3AJ2A 3PJXA 1IKYA 3NOCA 4ID5A 2KI2A 2CNOB 2DNYA 2MQLA 1ZAWA 3OXLA 2HQIA 1VCTA 1FD2A 4KKOA 5C25B 1MMNA 2C2KB 1MMLA 1SI9A 3BO3A 2MQOA 3Q2TC 3SZ2A 1YGYA 5A0YA 3UE2A 1SJFA 2E1PA 1FVQA 3FBBA 5IWAJ 1W7WA 3BO4A 2AYGA 2DH8A 3CD5A 1JLGB 2VU5A 2JRSA 3MDFA 1WC6A 4NEYA 5T41A 3TQEA 5A8RB 5KFLA 2FJEB 4M5HA 4ANDA 3KNAA 1GXUA 3AQPA 1SUQA 3R5GA 5EWFA 3BSNA 1S48A 2EFNA 3PDNA 2NXJA 1WJ9A 2EG2A 5CYQA 4PG6A 4TVAB 3PXGa 4F8RA 2AHOB 4PYDA 1X4EA 1X0PA 3DN9A 3W7BA 1FEEA 3KLEB 2FC9A 2OPRB 2V8HA 5BYRA 2IJNA 5SUHA 5HLFA 1W26A 3QIPA 3O6QA 2GFFA 4LRDA 2BANA 2QGFB 2NZCA 1U45A 2R8KA 1U24A 2E9ZA 4QWAA 1HBMA 1UZHA 5KFIA 3BPSP 4ZVQB 2V6AA 5C24B 1CJUA 1UTAA 3UFCX 3KMSA 4J9MA 1RE1B 2HHXA 4CLSA 5HVGA 1SJRA 4C9DA 1BWVA 3QIDA 3I4PA 1NK9A 3OUYA 3CCLS 2EKNA 3SCLE 4OIXA 3H25A 3GCWP 4ATNA 1GMWD 2OPSA 1JLQB 5HBMA 4JV0A 3THTA 1F5AA 2CPYA 4BLGA 3PYDA 3VAFA 4RW4A 3BB5A 2IBOA 3MCOA 1FRHA 5GAHI 4OZ1A 1Q7LB 1SCJB 3I96A 4FKYA 3CCQS 3EM1A 1C1BA 2ZEJA 3LWMA 1V3ZA 3OR2B 4USKA 3J80Y 3R6GB 1NBEB 4FPRA 3DOMB 4R0JA 2DRAA 1C1BB 4CI0B 5BJRA 4M5JA 4O3SA 3WX4A 2A6OA 2DBBA 3M1VB 2H54B 2H5IB 2WBRA 5KFWA 2W25A 5M2UA 4NMXA 4DLGA 2HVIA 2DO0A 2IYIA 2Y3YA 1LWEB 1X4AA 4HTIA 2BJEA 1WC4A 4QIEA 4JUZA 4B3SJ 3FQLA 4YDXA 2LXUA 2V8DA 4QYZK 5ETTA 1DTQA 4ZVOB 1FJ7A 2J0SD 3KDNA 5EX0A 3TVKA 3KHHA 4NCGB 3D67A 4HI1A 4QW8A 4WYWA 1PIEA 1IVZA 1B7FA 3TAQA 3FC9A 1NH7A 2CQCA 3O8WA 3OL6A 4FP9A 1ICEB 4DL0C 1FJGJ 3DLKA 3AA8A 2IFXA 4OZ0A 3AD8C 2G2ZA 3BQ2A 5HP1B 3TAMB 4LF4J 5F8JA 1NKCA 1TMJA 3R5DA 1OQ6A 3H40A 4M94A 2AWZA 2KTQA 5CH7B 4J9UE 2VG6B 3MM6B 2E1AA 2FJWA 3HJVA 2LMIA 2ZNZA 3SCJE 1NK7A 2XMAA 1WF2A 1WOPA 2BJ8A 4ECUA 1LK7A 2PEBA 1CVJA 1VRTB 3HHLB 3NNAA 1VFJA 3M2RB 3P49B 4UOHA 1UZDA 4TYBA 1VC0A 4CLWA 2NR0A 3EXCX 2DEJA 2DGUA 3KK3B 4K2XA 2BXJA 5ETMA 2MHNA 2N7CA 3DRPB 4LUBA 4DG1A 3G8TA 2CPIA 5FLXY 4DSKA 4O3PA 1R8AA 2VV5A 2X1FA 3IBCB 1U1MA 5B0FA 3LAKA 5IFMA 3AXMA 4USIA 3E2EA 4PXCA 4KH1B 3DM2B 4CCHA 2HVZA 1S57A 2Y1LB 2N82B 4OZLA 2W8KA 2HNYB 3PCOB 2EKYA 3AA9A 3Q8UA 1P9YA 3MR6A 4LFCJ 3DRSB 5GADI 2BR0A 5FDLB 1ZETA 2MDAA 2F8HA 3GIMA 2F4FA 2GMLA 4KT0C 2DHAA 3K5NA 3TJAA 3UR0A 3RB3A 5J2PB 4DUZF 4CLLA 2HS3A 2HQFA 2LYVA 2GAGC 4C98A 3CC7S 1VQSA 1S4EA 1HARA 2H1YA 4DR2J 1DTTA 3T1AA 1XIQA 3EZOA 1R31A 2GMHA 5CZXA 1HHSA 3A8JA 1E6YB 4LRCA 1YSJA 3CVKA 3ETOA 3TEGA 5I42B 4X4SA 1HI0P 4UY85 2GIQA 1HD1A 2BOPA 1MU2A 2W7OA 3CCWA 2XY5A 1GTHA 1IBKF 4I2QA 2K8GA 4B3RJ 4A47A 1R27B 1HBOB 2HNYA 4KE5A 2UVWA 3OVBA 1C1CB 4ZVFA 5HANA 3PKYA 2BKOA 2CDQA 1GQEA 4A8OA 1N34J 3OL9A 3T1YJ 3MMCA 1QD1A 2FJDB 2F8MA 3EGNA 3I0RB 5F8MA 5A76A 2YH1A 1NJWA 4F4KA 3GMGA 3HZGA 2ZUAA 1LWFB 2K7KA 3MEDA 3H4BA 1GAOA 4KTQA 1RABB 5CCMA 4A8QA 1C0TA 3E8OA 2UUCJ 3EJMA 1M5HA 2R4FA 5DLGA 1WC3A 5CABA 1UVIA 2B7BB 1TL7A 4CLYA 4F0KA 5M2PA 3FBCA 1YITS 1V6HA 2FIUA 2K1RA 1RCOB 2YWFA 3ISZA 1YJNS 1U4BA 3DDKA 4A4JA 1QTMA 1M5OC 1QVFR 1REGX 3W64A 3KWMA 3R1LA 3HVRA 2E5HA 5EUHA 1OY9A 3N79A 4P72A 4RNHA 4GRSA 2FVQA 1DY3A 4X4VA 2B5JB 3GYNA 5GMKa 2R8HA 4F4AA 4WKYA 4UOCA 1VR6A 5K8NA 4K4XA 4F3OA 3UVJA 1IXKA 1FA0A 3OSNA 3H5YA 1D09B 5DDOC 3E01B 2MY8A 3R2CJ 2KXHA 3CJQA 3AD7C 3D54A 3TZWA 2W9BA 1SJ4P 4Y2AA 3ENQA 4LFAF 1K8AT 3OLBA 2DR8A 4M5MA 5DJBA 3QJJA 2H5JB 3VAKA 4DSIA 1RAGB 4YUDA 5F3ZA 4BC9A 4XDCA 3ZTQA 1GFWB 2E9RX 1P1TA 1DLOB 1S1UA 2MLYA 1BLUA 2YNHA 3C66A 3QT6A 4TQRA 5DO2A 1RT2B 3T3FA 2FLLA 2RDDA 2ZKTA 4O23A 2ZZTA 4L3NA 4OZ2A 1NB2A 3FRZA 4HHUA 2F4VF 3IRXA 3IM8A 1WSVA 3J7AN 2HG4A 1KOOA 4PXBA 4CTAB 1XNQF 4KGZB 5D0RA 8RUCA 3CGIA 2ZH3A 4XIUA 2QFIA 2CJQA 3R2DJ 1C4CA 1VI7A 4RU2A 3K17A 2PMZD 3AODA 4TQSA 1KNZA 3L09A 4I6WA 4WXWA 6FD1A 2HGLA 1NU4A 3W5XA 2EBEA 4OMFG 4EU0A 3DDIA 3BGRB 3GSDA 2DR6A 2WW4A 4R25A 5KFRA 5HBMB 4FBUA 3VVTA 4Z2XA 2PGCA 3RB6A 2V9KA 5LMUJ 5F8HA 3PEHA 3HPOA 2FHMA 3BQ0A 4CH1A 2R7WA 1F2HA 3P6YC 3WBZA 4DR2F 2VA2A 4RW7A 2HLTA 4ZVTB 3K57A 4BWJA 4YY3J 3DOKA 1JQGA 3SFGA 4C0BA 1HNXJ 2OTLS 5B0BA 3DOLB 1K44A 2B4OA 2VPXB 1H7WA 4G1QB 3QLHB 3SQGB 4BDPA 2HHHF 4QYZJ 5KFFA 2C3UA 2CUYA 4RW8B 2W1BA 4O3QA 4ZLLA 2KJWA 2CQHA 1RWMB 4CLFA 2EFVA 4LBPA 3Q8YA 1Q79A 4XPEA 2LEAA 2RAQA 3NKYA 1SUQB 3JQKA 5KTQA 2DISA 3BR9A 5DGAA 2EC0A 1X31C 5KFVA 1W2BR 2C2ZB 4EMDA 5KFZA 1LW2A 1D8YA 2MKKA 2YKMB 2CJXB 1EX8A 3M8ZA 3VAGA 2J9DE 3RGIA 4L6V3 3BGFA 2MKCA 4X4UA 4RUBA 4DR4J 3WDOA 1SC4B 2VPYB 1N0VC 3E01A 3FEXB 3HI9A 1X4GA 4OI4A 1OS5A 4JI5J 1PAUB 6FDRA 2G0CA 2G0IA 4IFVB 2MGZA 2DRDA 1S9EB 4RPFA 2ZM6J 1YBTA 1FNXH 2UUAJ 3Q2SC 3VGUA 4RR5A 4LF5J 1HW9A 1M1HA 4DV2F 1L3KA 2HIYA 4Y2KA 4XDDA 4ZPWR 3GU0A 1JB0C 1SBRA 3F56A 3EVWA 4NWBA 5L9NA 5CD4H 2HWTA 4X64F 1HWUA 2QA4G 3VALA 3PJWA 2MB0B 2UXBJ 4X2BA 2G2YA 1E6YA 3W9JA 3CJ2A 1N5SA 3MTKA 1CJTB 1WACA 2CQ4A 2J7WA 1RT6A 5AXMA 3F44A 4JB8B 4ZLNA 5F8IA 2Y1JA 4NRUA 4J91A 4TLQA 3MM6A 2NSCA 1ZM4A 4KYZA 3G2XA 5IM0B 3KK1A 3DRSA 4YP3A 4DBQA 2PO4A 2J9CA 4J9OA 4W90B 2UXDJ 3PYEA 3MR3A 2VJUA 3L7UA 3PX6A 5KT5A 1RHQB 1U6ZA 2E7VA 3NBPB 4MAKA 1FWKA 4F4XA 3EDQB 4IOCQ 1PBAA 3A1YG 2D74B 3HD2A 2HLUA 3JAMY 1AW0A 2QIFA 1TELA 2GQCA 3O44A 2XYHB 1IR2A 4J9PA 4NXMF 1ZH5A 4ID5B 3I82A 2COLA 3M8PB 2OELA 4QQBA 1DFDA 4WK1A 3CCMS 2MZ1A 1U6FA 4CLPA 3ZNJ1 3N9UC 4KSEB 5HQ8A 3J7Z5 3PYFA 4ZA1A 5EDWA 3ZXWA 1HA1A 4J9NA 4DOZA 4DX8H 5C7PA 3IRXB 3T1YF 4HT7A 3AT1B 1UA1A 2OTJS 3TAPA 2ZH8A 2X51A 2E5JA 2ROPA 3IR7B 1RI7A 2BDPA 2AF6A 1FX2A 1H6KX 1XJWB 1H2UX 2CNLB 3CJ5A 4L75A 4M1KA 5L8RC 5LSOA 3M30B 4LSZB 5KT7A 5DG8A 1VIOA 3U7JA 4FNHA 3MAQA 2BUNA 2FGCA 3PW7A 1ZAXA 3P96A 1GT8A 1JLCA 2GC8A 3NCRA 4EGLA 1K0TA 1VQLS 3QYYA 1NK6A 2BOAA 3IGVA 2VB6A 2R7TA 3ELHA 1WHYA 4CNYA 1RTJB 2X1BA 4ECRA 2PC6A 1YTYA 2ROEA 1HYSA 4QYRA 2KKHA 3HP6A 4YB5A 2YY3A 1FTRA 2QA1A 2YKPA 1UETA 2ZVIA 2G2OA 2KZZA 2QN6B 1VBKA 4UOGA 3GV5B 1V3SA 3SCIE 3MAAA 4DQSA 1ZAVA 2OO4A 4OI3A 5T7LA 2AGQA 3HHLD 1RT5B 2UXDF 2B6AB 4PWDA 3A12A 3NP5A 3GPAA 2XGPA 5E0OA 2D1CA 4RU9A 3EYZA 1T94A 3M8QA 5HK4A 3PYGA 5C2CA 1YWXA 1EAYC 1QE1B 3QGIA 2FTRA 2V67A 5KG3A 3MEEA 3CSKA 1S76D 2H65B 1TTHB 3OJUA 1UEKA 3T5LA 3IO1A 4L3KA 5L9XA 2QSFA 5CYQB 3A3NB 3VWSA 2AGPA 4NLSA 2C28A 2UUCF 2R8IA 4J9VA 2R2TA 2V2VA 2CJYB 1BD6A 2YBVA 2OEMA 2GVDA 3IXQA 3HHNB 1XMOJ 4DV5F 2XS5A 1PGZA 3HLUA 3UDVA 3RAXA 3MXHP 3HHKA 3LGHA 4WU3A 1ACMB 4YMEA 1MG7A 3DI6B 3KMQA 2QLJB 4KBIA 2A3JA 4HH1A 2V0NA 3MCNA 4LJMA 3L4BC 2OD4A 5J1EB 4ALZA 2GX8A 3I87A 1HBOA 5FD1A 2KXFA 4A48A 3ULHA 1KBRA 3W65A 3LP1B 1M90T 2WSCC 5E3QA 3IBFB 3MECA 3UD4P 4KC5A 3MCSA 4LFBJ 2KFYA 3AXKA 1GH8A 2V2KA 1SKSA 2YNIA 3T41A 2RS8A 2XG8A 3DRXA 5CHCB 1Q8KA 2WB1D 4IG0B 3OL7A 1TL3A 3EX7B 1IBKJ 1PC5A 2J0XA 4NYPA 3DRYA 4WIQA 3V6JA 1BGXT 2WAQD 1KONA 3US5A 2XMWA 4JOUA 4NX9A 4OYOA 5LMNJ 1WG1A 3QIPB 2IRUA 1TU0B 3LALA 3OFGA 3CWJA 4PPZA 3Q86A 4C2MA 2NPIA 1XNRF 1FNMA 1N88A 2R7XA 4JI4F 1FKPA 1U09A 3AD9C 2JC1A 3LUYA 5J2QA 4PUOB 1WDDA 1SKWA 4AL5A 3L9ZA 5KG2A 1MROA 2HRTA 3CEDA 3TZZA 2HBZB 1IR1A 5KFJA 2R7UA 4WFAQ 3MECB 4F3MA 1NHVA 1CQMA 1N0UA 1YG0A 2P2CB 4ANCA 4B3SF 4B08A 2C2EA 4PQAA 4YR3A 2AEFA 2FB0A 5HO4A 3C14A 3QZ8A 2ZWPA 1FRXA 4C8KA 3J7YI 4ILMA 2DRBA 2BQRA 2XHWA 4HTJA 4Q0BA 1S97A 1WC1A 1W2IA 2EK1A 2VFSA 4P2XA 2BM1A 2LQ5A 5EWEA 2YNGB 1CC7A 2FJAB 2I9SA 2J0WA 2QLXA 4DR3F 4IH7A 4ZHRA 1JKHA 1WC5A 3GJSB 1MROB 2N3LA 4NZ0A 4WBFA 4Y2IA 4JI5F 2KRRA 4Y6IA 3V5RA 4YR2A 4PUOA 1NPKA 5GAHU 1AXQA 1LEOA 3SMZA 2YH0A 1PCAA 2IC3B 4LRBA 1XBWA 3UDLA 4LIRA 1RSCA 4R0EA 1QAYA 3KDOA 3HK2A 2IA0A 2WZ1A 1R0AA 4WZQA 2XYGB 1W25A 4DR6F 3N6LA 2V63A 4RNFA 4IG3B 4HEA9 4P2SA 3V6DB 4IFYB 2DO4A 3N4WA 1LW0A 2Z2YB 2NREA 2OFHX 5ETSA 3ITHA 4LF6J 2VPWB 2MZJA 2GA7A 4OYXA 2HIQA 1C2PA 2VG5B 2XMMA 4E8UA 1VQOS 2QL9B 2Z2LA 3GV7B 4DLEA 2DR5A 2EC2A 4K50A 1XR6A 3C8YA 4HH0A 2ZBIA 4OHXA 3S8SA 1O8BA 2BJ9A 2W9CB 1A9NB 1S5ZA 1VYAA 2HAFA 4ECSA 1TKZA 4ZDNA 2RRAA 2PE8A 1O5JA 4KPYA 2NLWA 3NS7B 4C3KA 1LKZA 3MMAB 5AXNA 1HKAA 2HGNA 2AZ3A 1WKLA 1VQYA 1RKIA 2DNOA 1UMJA 3RJMB 8AT1B 1B0PA 3KLFA 3FDSA 3RTVA 1N33F 2JC0A 3M2RA 2AJ2A 4LSLB 1M5SA 5AXLA 1FJGF 2OIHA 4KHRA 2XCPA 3BKUA 1JLBB 4NLGA 5IC4B 3CXCR 1VK3A 4DL3A 2FVPA 3FMBA 1YIJS 4KGXB 3IN5A 1WDTA 3KG4A 1ZA1B 2D9PA 4KFBA 5D3GB 5E2QA 5KFGA 3MAAB 1BE4A 5FJ4A 1K1SA 3UO0A 1AB8A 2P8IA 5L1KA 3M8PA 3DLBA 2VG5A 4DU8A 2EFGA 2Q79A 2V4JA 3SQGA 3P3DA 4IR1A 5HQMA 1IWGA 2VFUA 2QL7B 2XSJB 3EICA 4I2PA 1SL2A 2RVJA 2HW3A 2GVZA 1TP7A 5EN1A 1IN0A 2IVFB 2RHSB 3U27A 3CO9A 2PT0A 3MM7A 2QFJA 4CLUA 3ICLA 3P45B 1HQ2A 3W2VA 1S72S 2QC3A 4DUTA 4H4OB 4FYXB 3I9ZA 4MKAA 2NS1B 3D1QA 3R7NB 1EP4A 2BRKA 1DHMA 1YX2A 2XMKA 3R5JB 2YWHA 3RZAA 1RLDA 5HMZA 1MSWD 1U7LA 1PJ6A 4HKQA 2LA4A 2OSRA 3FQKA 5KG7A 2XBPA 3A3OB 4OX8A 3Q8RB 4DQIA 4DR7F 2BW7A 1NO8A 2FJBB 3CJ0A 4AQYJ 5A0YB 3M2VA 4K5RA 3PIOQ 4V1Ak 4YS2A 4UW2A 3MUTP 2LU2A 2CPJA 1U1PA 4C8LA 4OZ3A 2JFKA 4C8OA 2NSBA 3H7HB 1RTIB 5T7LB 1N56A 4XO0A 1HD0A 4IUFA 1WNEA 3QJLA 4K4ZA 2RQCA 3JQJA 1S0NA 4RKUC 4DU7A 5ETPA 4ER8A 1S6PA 1T02A 5B0CA 2CQBA 1FDBA 1LNQA 3VVUA 1RWNB 2DJWA 8ATCB 2W9BB 4PG7A 1EKSA 1HYSB 2C3PA 1RT4B 4AFFA 5KT3A 1NJYA 4LRAA 3G96A 5J2QB 1B64A 2RU3A 4GVLA 2AYMA 1RJJA 3NRBA 2E1CA 4KAIA 2BJDA 2KT3A 4ZN1A 5CQGA 2DGSA 4NASA 4PPDA 3OTDA 7FD1A 3UCZP 4DCPB 2IC3A 5IQ6A 3HZEA 2B9XA 5EHHA 4CNZA 4UUWA 4LFBF 3MR7A 1IUJA 3JXOA 2H4WB 3PTWA 4WFXA 1HWLA 1X5OA 3UW1A 3W8PA 4DMZA 2HFZA 3CJ8A 2HFNA 3L7OA 4FYWB 4DL5A 4HYKA 3KK2B 1D9AA 2Z57B 4ZVUB 2W2QP 3IC1A 4KHMA 2YWKA 3DLEA 4I4BA 3WIUA 1SC1B 5K8MA 3CUNA 2KFNA 5K14A 1DRZA 4DV5J 4MTPA 2R7VA 4Q0BB 4WFBQ 4Y0FA 4OYPA 4WP8A 3LP0B 4MIWA 3UDCA 2AKWB 2ZVSA 2AW0A 1TUWA 1REVB 1Y5IB 4LQ3A 1X5TA 3E3XA 4DV7F 3PFOA 4FPIA 1BQMB 1HMVB 2LQJA 5BYSA 1FT8A 1BWEA 2AGOA 3O3LA 1PO6A 4CM0A 4FF2A 3WX8A 2BJ3A 2CADA 3HKZD 4PXEA 4TKTA 2MLXA 4LVOP 4ZLPA 2RHQB 2UUTA 3BPDA 5M2RA 4DR5F 4AT1B 3KHGA 3FFIA 3R6LB 1HQUB 1RXOB 5F8NA 1WF1A 4QIWD 4X62J 3PR5B 2UV8G 4TYAA 1IQTA 3OV7A 4BC7A 1F6TA 4O44A 5CYMA 3IP0A 2FY8A 2GHWA 3DKDA 3MPWA 4I7FB 2UUBJ 3CO0P 5KFTA 3S01A 4P74A 4M5GA 3QRRA 1Q5YA 2K3IA 2ZWOA 4DV3F 3WIVA 1FERA 4DF4A 2C2DA 4NI2A 2XMVA 4LRFA 2HK3A 3RG6A 3FEYB 2B3TB 5LOQA 1ROFA 3OXFA 3Q89A 5C42B 5DG9A 1RHRB 1Z1ZA 1UVJA 2ZBRA 1NSKL 4JI7F 4DR6J 4NLOA 2OPPA 5J1EA 2OPQB 4C11A 1VMBA 4EBCA 1WSRA 3FEZA 2FJXA 2XQCA 1TUGB 3HVWA 3RB0A 4B3TJ 2FUG9 1H72C 2L08A 2MKIA 1IBLF 4NA1A 1RTDB 2RIJA 2NUHA 4DV3J 1I5OB 3POTA 4ED8A 2KG1A 3EGZA 5KAKA 3C6TA 5AE3A 3AHPA 1X9SA 4BCAA 4QU6A 5ADZA 3MEGB 3QFHA 4RL1A 3V6KA 3GCXP 2XEXA 1Z4UA 2GQQA 3UCGA 2L48A 4B3OA 3HVAA 3S6EA 1S1VA 2VFTA 4AL7A 4HDHA 5E3RA 4EWTA 3CCSS 2HWIA 2RQMA 3TR5A 4U9RA 4JI1F 1OY8A 2GZOA 3QT7A 3AJ1A 1NB7A 3EZUA 1PILA 2D3UA 3BS9A 3H5UA 3DOLA 1YRXA 3K89A 3GB0A 2YQ1A 3MM5A 4G1QA 4J7CA 3THVA 1N5VA 3DOKB 3GYXB 2FPHX 3FGVA 3RBZA 3NBPA 4HDGA 3D3BJ 4WCEQ 1JLEB 4LF2A 5F41A 1U1LA 1N4LA 3KUHA 2ZBQA 1FF2A 2NCKL 1TKTB 1TAQA 3PW2A 4OV1A 1UVLA 1AA1B 3AOCA 3C16A 4EI2A 4PWDB 2UXBF 4JI1J 4CLZA 3HDSA 1ITPA 1RQ0A 3T9ZA 1C0UB 3ET6B 1TVRA 2XY6A 1R43A 1WI6A 1JXVA 5E5NA 4PR6A 4R8UB 1RTDA 4PRFA 4QU7A 3MWBA 3KLIB 3VAJA 3WC0A 1SJQA 4DFJA 1S12A 3OQ2A 3FMWA 1KD1T 1AUDA 3CMAS 2UXCJ 1WF0A 4HVZA 1RUSA 4RWXA 4HR2A 4ES3A 1TL1A 2ZE2B 3NCQA 5T14A 2A18A 4DV1F 3OVSA 2HFVA 1JLAB 3D7SB 1KHVA 4KB7A 5I4MA 1IBLJ 2FJVA 2RF2A 3GFZA 4ZJLA 4B02A 3GQCA 4MIBA 2VD3A 3H98A 5DRKA 5KG6A 2KDOA 4AXJA 4EBEA 2QL5B 1VQ5S 4NXNF 4KHPF 1T9UA 4OYBA 1S0MA 3R3TA 3NGSA 4N47A 4A8YA 2ZITA 1VQ8S 4N5SA 5CZVA 1SH3A 3PX0A 3HSGA 1FKOB 3KJFB 1NJIT 2AD9A 1OY6A 3M6VA 4EYIB 2ERRA 4ZVGA 2R7SA 5BYQA 1SKUB 3CC4S 3J7A1 1RHKB 3DLJA 4K8RA 4DR1F 2V69A 1S1VB 3MD3A 3PV8A 4ED0A 1SJ3P 2FVSA 5HROB 1U1NA 4PCQA 5L39A 3MMJA 2BE2B 3A8KA 5CXTA 2BKNA 4QPTA 3MD1A 3MMBB 5DZ7A 1T95A 3H42A 1QAIA 4Q44A 2VASA 1QUPA 4TNOA 3DLEB 4Y2CA 2C2OB 1HWJA 4KO0A 4NOHA 1KQSR 2IM3A 2NZ4A 1RWPB 1FWPA 2OUGA 1VK8A 1ZOTA 1Q78A 2CPDA 2HWHA 2LXFA 2W4CA 1RA6A 1YDLA 3GG1A 4J37A 4GC7A 5J2PA 4Q8FA 2LQ8A 4Q2MA 2BMBA 1VQNS 1YRUA 1UW9A 2W2NP 3QGHA 5LSRA 1UWBA 5LMNF 4NYOA 2QEXS 4D3GA 3U1MA 1LWFA 4J90A 5D0EA 3C16B 4I67A 1UVMA 3VTIA 1FCAA 2C42A 4MK7A 3WHIA 4F36A 5HP1A 3ZZUA 1OJ4A 4JI0F 2J9EA 3DM2A 4J9LA 4KY3A 2DNQA 2O5DA 3BBFA 2O1PA 5KFAA 1CBKA 3BKTA 4DCJB 1UFKA 3ISND 2HZVA 4NLYA 3HSJA 5D4LA 1VQMS 3MZIA 3GJTB 1X7VA 4MYTA 2B7CB 1DTQB 1HNWJ 1Q8IA 3M9OB 2MZTA 1SH2A 2V68A 1JXEA 3LP2A 4IRCA 5GAGI 1RWUA 4ZP9A 2BQ3A 3BGUA 1SC6A 4HLBA 5I3PA 4A8SA 1AFJA 4URQU 1KN6A 4X66F 2DHSA 2CPXA 4RNMA 4PG4A 3J81j 4HACB 3OLAA 3CCZA 3R1HA 2ROGA 2VBZA 4CO3A 5KFQA 4B9TA 3K0JA 1F1BB 2C2NA 1TL1B 1RGVA 4HI2A 1VC5A 1KTQA 4Z7CA 4YN3B 1OQ3A 4X4TA 3H5SA 5K9FA 2VUGA 3LP0A 5SZTA 1M1KT 3NGKA 4LF1A 4UF4A 3MM5B 2ZHBA 5F8GA 1RWKB 3WC2A 1S4FA 3CJKA 3NEKA 5IOLA 2BX6A 2EFOA 1EKRA 2ZOGA 2M5YA 2CG8A 4H4OA 1SQFA 4U7UK 4EUVA 4K2JA 4YR0A 1U1OA 2ZE2A 3O1LA 4ED4A 2XI3A 3N0VA 2ZJRQ 4N8OA 2ALZA 4GKKJ 4OX7A 2BABA 1D3WA 1CJKB 2DIVA 2VG7A 2DHGA 5GAGU 2J6UA 1RTHA 3ZTPA 4I7FA 4AQYF 2E5LJ 2XULA 1KVKA 1RAJA 4TY8A 1H0HB 1JNZB 1TVRB 2RRNA 5BR8J 2WTFA 4EYHB 2JLEA 4ITSA 1JMTA 1BC6A 1NDKA 3Q8VA 1S6UA 1S10A 3PW4A 5I3QA 3VQTA 5F9LA 1V5IB 3CJRA 4EO8A 2HS4A 3DOMA 2F1FA 2Q66A 3QSIA 3OR2A 5KFSA 3NXZA 2YNFA 1V3RA 1SQEA 1C0TB 3JSRA 1R3NA 2AT1B 4C7QA 4LIWA 1LWXA 5GADU 2IAJA 1HIYA 4CYUA 3RB4A 3T1HJ 1JJCB 3KKFA 1P8GA 2XMJA 1CULA 1FHTA 1VLOA 2KXNB 4LREA 2XZWA 1Y3JA 4LT6A 3IRWP 2VQEF 1JLGA 5A8RA 4DQRA 5C5JA 2VA3A 1JLQA 1RT3B 1VS3A 2BACA 3MMCB 3CIZA 1RBLA 5ETNA 2ZH5A 1M5VC 2LVWA 2BKPA 1NJXA 1LOUA 2V34A 2Z30B 3V4IA 5F9NA 3QWUA 1ZPWX 2I2YA 2GJ2A 4MK8A 4QIFA 1S6OA 2U1AA 1FDAA 4WFYA 3NY0A 4DZDA 5AE1A 4M5LA 4RWWA 5D77A 3C2PA 2O66A 3GR1A 1XMOF 3K58A 1YBAA 1WORA 4OYIA 2XLKA 3R97A 5KFKA 2VQFJ 2V4QA 3QPIA 4C8MA 2XB2D 3KHLA 4PABA 1VQ7S 5JVGQ 4GKKF 2WBMA 2DR7A 1HBUB 5B0GA 2ZNYA 2HNZB 3TW0A 1RADB 1BQMA 1HMVA 1S99A 4MFBB 4O3RA 1PJ5A 2QE5A 4GVBB 3IR5B 1NAQA 1FJEB 4DZ6A 5D4PA 4ECVA 1RAAB 4YHHJ 4FXWA 5G4DA 3Q83A 2R7QA 3A3PB 1Q5VA 3IBWA 4I1TA 3CJ3A 4P7TA 1U2CA 2HBRB 1WI8A 4CO5A 3GJRB 1Y9OA 2IIHA 4N56A 3M05A 2RE1A 3DRRA 5I3UA 3OFFA 1TK0A 4ZPTR 3TA1A 1JXLA 3K8WA 3RRHA 2YNGA 4IR9A 3ZZZA 3PACA 4OX6A 4X66J 2AV5A 1TV6A 2VICA 2OPRA 2MQQA 2AU0A 2BQUA 3KLVA 4J9QA 4OYZA 5ETKA 3IA0A 1X4DA 4FN5A 4FYVB 4UTGA 4AUKA 4NXNJ 1URNA 1N36J 5HSPA 4KHPJ 2VONA 3D0HE 2PDAA 1Q95G 2N3OA 2HMIB 1CJUB 2EXUA 1UP1A 3W2WB 3HX9A 3NGRA 1I3OB 2RKIA 1JK9B 3R7BB 4M8LA 4BWMA 4DCOB 4WWSA 2Y8WA 2WVEA 3QNWB 5KG4A 3IM9A 2PFDA 2N7YA 4DJBA 3BYRA 2XI2A 3GIRA 1VBXA 1B3TA 5IT9Y 2JVOA 2VFRA 2UV8A 3ONQA 2ZZMA 2IRYA 1R0AB 2H9ZA 1SV5A 1BXNA 1Q8BA 1V5VA 2GGPB 4K4VA 2PEHA 2RJZA 4N8NA 3TRGA 4UT4A 4A8FA 3LQVA 4V19J 1SL0A 4OI1A 2RDJA 4V19X 2DVIA 2KB2A 1KQKA 2YKAA 1NEEA 2HS0A 4RZRA 4TU9A 2RDIA 5J2NA 1WC0A 2KJVA 4DV6J 5IC6B 2XO6A 4DUYF 5JUMA 1ZTWA 2DY9A 2HHQA 4Q2LA 4IH6A 3M32B 4RNOA 4YHHF 2GVZB 2YKQA 3RR8A 2WRMA 1XK8A 2FQQB 5KFEA 1DJ0A 2K06A 4I0WA 4P71A 2UUWA 1X9MA 4ICLB 1SH0A 4RW6A 5FLXU 5JJBA 3JSYA 4UQTA 3QRQA 5H9FK 2LLZA 1HHQA 2AEJA 3WZ0A 1X9WA 2HBYB 3CJSA 1S9GA 2WHOA 4F26A 1KR4A 3G8QA 4JI3F 4C48A 2UZAA 3P8BB 3TA0A 1G3OA 1S1TA 2BYCA 5LT5A 4IO9Q 4LF9F 1HI1A 2BM0A 2J6SA 1UVKA 2C2MB 3BSAA 4ZIWA 1MN7A 5LMUF 1U1QA 2M52A 1U2RA 1B70B 1MWQA 3AB4B 3N01A 2FLNA 1PJ7A 2FHJA 1OPZA 1RISA 3D66A 5B0DA 3GFYA 5ETRA 1A7GE 4M5KA 3W63A 1N5QA 4A8WA 1NDPA 4F25A 1C4AA 3U1NA 3LO3A 5CCLA 2DY1A 1ZZFA 2XLIA 1EHWA 1LFPA 2DGVA 2QT7A 1X4BA 2V8PA 3HVTA 4FNIA 1A0OB 3R8YA 3UI3A 2YNIB 1EETB 3LW5C 4HL9A 4X4NA 2F4VJ 4KRWA 3W5YA 5A6PA 2I8EA 2W24A 1KHWA 2QMUB 3CDAA 1CJVA 2HZCA 2R42A 3AY0A 3ZZOA 1AZSB 2R2RA 1N5YA 4OHYA 3BDEA 3NGDA 2HVDA 2AMCB 3TUIC 1DARA 2AQ4A 2V2QA 4F7VA 3W60A 3JSMA 4ERDA 5IT9U 1Q0NA 4USMA 2WONB 2ZOFA 3GLJA 1X5SA 1RAHB 2D69A 1KSPA 3U1LA 2CAJA 2EFQA 3P4UB 3VAMA 4H4MA 2FLPA 3ZO7A 5HLFB 4NLTA 2ADCA 1S1TB 2EW9A 4PEOA 4CP5A 3KYLA 5B09A 2BV3A 4DDFA 4WKRA 2DGTA 4N77A 1Y10A 1QY7A 5HJYA 2O67A 2IJRA 2DKOB 1HBUA 4NRTA 4X84A 3MR5A 1TK5A 4EK2A 4DF8A 4RBUA 3J80U 2KN4A 1WG4A 2HGMA 4OHVA 1SKRA 4G1IA 2H48B 4M5DB 3KOAA 2IDLA 1CJKA 1FD8A 2XSJA 3TVYA 2XS2A 1HBNB 1FK9B 1RP5A 4EFAC 3HFZB 2APOA 1NKEA 3BYPA 3M9MB 3BV8A 1KFDA 3EUNA 5HQLA 4IRKA 2DGQA 3C15A 3SV4A 2Q6CA 2F65A 1YJUA 1CQNA 1S7IA 2CQ1A 2XYPB 2H4YB 1UAWA 3N6MA 4P6QA 2W7PA 2YQ0A 4YB7A 5KOWA 4X64J 2I1RA 1HL6A 4O4RA 2CFXA 4O3NA 1KWMA 1GEHA 4QR1A 3GV8B 1RAIB 1NK0A 2HYIB 4RW9B 4LF7J 2BJ1A 4B3MJ 2OJ3A 4LVNP 5HATA 4X65J 2QRRA 2Z56B 1NNDA 2MZSA 2ZBCA 3MTJA 4Y3CA 3J7ZT 2ASDA 1K9MT 2F5GA 4I6AA 3G86A 4JBCA 6AT1B 4USUA 1RT7A 3HXMA 1SQGA 5KFUA 1FXLA 3G6VA 1GMWA 3DYAA 2LECA 4DR4F 3TA2A 2J8AA 3G6YA 2WCXA 1Q8LA 1T9VA 1NZAA 2Y8YA 4B3RF 1U25A 5KFCA 2BBEA 2EG1A 3SEOA 3ZTOA 1HR0F 4DPTA 1U47A 3FBFA 3HHEA 4C97A 5IT4A 4PZVA 3UN2A 4E98A 4H4KC 1X0FA 1XNQJ 3EGVA 4K5SA 2DXEA 5GMEA 1IR0A 4ECTA 2W8LA 2DTJA 2IDEA 2CKWA 2HRYA 3JTOA
chains in the Genus database with same CATH topology
2EKNA 1EKRA 2OHDA 4PYDA 3JQMA 4PYAA 3JQKA 4FDFA 2EEYA 2IDEA 3JQJA 1EKSA 2IIHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKN A;  1EKR A;  2OHD A;  4PYD A;  3JQM A;  4PYA A;  3JQK A;  4FDF A;  2EEY A;  2IDE A;  3JQJ A;  1EKS A;  2IIH A; 
#chains in the Genus database with same CATH topology
 4L76 A;  4FXV A;  4DSE A;  3N5B A;  3KJV B;  2OSQ A;  4XTT A;  4A8X A;  4WF9 Q;  4DL7 A;  4K4T A;  2DCU B;  2Y1R I;  5LSL A;  2OMO A;  1R89 A;  3BEG B;  1EZZ B;  1XEZ A;  2DNM A;  3BF4 A;  2BW2 A;  4K4Y A;  2D9O A;  4OLO A;  1JLC B;  3D6M B;  5C25 A;  4DQP A;  4DR5 J;  2WOM B;  3OFE A;  2O3D A;  2GGP A;  2XTJ P;  4IFV A;  4NZ7 A;  3EVO A;  5J2M A;  3QO9 B;  2J0Q D;  4DFP A;  4QJV A;  2HAI A;  2X3D A;  2VDH A;  3LH2 S;  2WVF A;  1UCN A;  1IBC B;  1NDC A;  2B4P A;  1B0V A;  4FVM A;  3I31 A;  3D9B A;  3DRR B;  4OLP A;  5I3U B;  1S0O A;  4LFC F;  3NS6 A;  1XMQ F;  3GE9 A;  4CT9 A;  3T6J A;  2KL8 A;  4W4M A;  4ECQ A;  1VRQ C;  3QQC D;  3FSX A;  3R5A A;  3EXY A;  5A2Q Y;  1QM9 A;  4IO1 A;  3D4J A;  1RT6 B;  1CPZ A;  1TV6 B;  4NML A;  5IV4 A;  3CCV S;  1YHQ S;  3NMA A;  4IOA Q;  1FES A;  3PFE A;  4WII A;  2VJV A;  2G1H A;  4BBY A;  1UW4 A;  2V2Z A;  4DSF A;  4KGM A;  4MFB A;  2ABY A;  1PAE X;  3B4M A;  1VQ4 S;  3NAH A;  1NXI A;  1K73 T;  1HNW F;  2EI5 A;  4DV4 J;  3SBM A;  4DV0 J;  2YPZ A;  1TL5 A;  4HHJ A;  1UPP A;  3DLL Q;  3UD5 A;  4C6A A;  1S9E A;  5IZH A;  1TKX B;  2AJ4 A;  4NZ6 A;  4WXO A;  5D78 A;  2ZH9 A;  2PII A;  2XZD B;  1FRJ A;  3OSP A;  2HQD A;  3HSZ A;  1HHT P;  3A8E A;  1Q86 T;  5JVH Q;  3ZTR A;  1NME B;  1DQ9 A;  5DM7 Q;  1PYO B;  3RRG A;  3KUE A;  2ACY A;  1PSD A;  4F0H A;  5A6W A;  2MQN A;  1WHW A;  1X5P A;  2D41 A;  3BO2 A;  1R8B A;  3QFW A;  4H4M B;  4HHH A;  1ARO P;  4ILR A;  4X4R A;  3PW0 A;  3M6U A;  3MGJ A;  3DHW C;  1TFY A;  2KO1 A;  2A2D A;  2CJB A;  2B43 A;  1FFW B;  2V4R A;  3D6F B;  4X4O A;  2J7K A;  2M4M A;  4KR0 B;  5IWA F;  2A0F B;  4RUC A;  4CH0 S;  3LF0 A;  1B7Y B;  4W92 B;  4IRD A;  1AZS A;  3IG1 A;  3ZZY A;  5HN0 A;  1H7X A;  1LFW A;  1ZM2 A;  3CCU S;  1CS4 A;  4JYA J;  3CNQ P;  2BJ7 A;  5B7W A;  3MEE B;  4U7U D;  3Q23 A;  2VHG A;  2I5J A;  2XNQ A;  2KRB A;  3ADA C;  1N48 A;  3ZC4 A;  1HNX F;  4USV A;  4NLP A;  4EO6 A;  4ZIV A;  2Z58 B;  1BQX A;  4DR1 J;  3P5B P;  3EMT A;  2FVC A;  4Q43 A;  1X4F A;  5ETO A;  5KFO A;  1GMU A;  1L3V A;  1BMQ B;  3GFH A;  3KFW X;  1KEK A;  5J1P A;  3PX4 A;  1T05 A;  1YKW A;  3IAS 9;  1MLA A;  2BE7 D;  1U1K A;  2ACM A;  4I68 A;  4CO0 A;  3X1L B;  1A6L A;  2FVR A;  1JJH A;  2B6A A;  2HHP A;  2POK A;  4GO5 X;  3UN3 A;  4C0H A;  4FS2 A;  2IPO B;  1VRU B;  1VIS A;  2DEI A;  2VL1 A;  4FZV A;  4I64 A;  3IMQ J;  2GHV C;  3LP2 B;  3TX8 A;  1DZ5 A;  1UJ4 A;  2HND A;  2JEF A;  5DG7 A;  4RW6 B;  1VRU A;  2YWW A;  4NL5 A;  1RZM A;  2X3G A;  1ZBT A;  3QLH A;  5K5M A;  3OBI A;  4DN0 A;  1N52 B;  2DXD A;  4ED6 A;  2IMW P;  1T03 A;  2PFF B;  4MT1 A;  3O2I A;  3ILO A;  1BQN A;  3T5K A;  1RTH B;  2Y0S D;  4YOE A;  3JS9 A;  2ALY B;  1R6V A;  2H3E B;  4WP3 A;  3PG9 A;  1YJW S;  4OX9 J;  3T6B A;  4W98 A;  5KFP A;  4ED2 A;  1J5O B;  2YWE A;  3F73 A;  4AYB D;  2P6S A;  1DQ8 A;  4QOT A;  1OO0 B;  2JOQ A;  1F3V A;  1S1U B;  2EVZ A;  3NGT A;  5J2N B;  2R8G A;  2HQG A;  1N54 B;  2QSW A;  4QIG A;  4FKX A;  5IXU A;  3PKM A;  3D0G E;  2F40 A;  4G65 A;  4JYA F;  3I4H X;  2OH2 A;  1H3D A;  3TNV A;  2VKZ G;  2G0J A;  2MLZ A;  1U0H B;  3I9V 9;  3LGN A;  4DHV A;  2XO7 A;  1CS4 B;  5LM7 E;  4GMK A;  3K5M A;  3ISN C;  4CTA A;  1QJH A;  3MOZ A;  3CB4 A;  4KO0 B;  1B99 A;  3TAR A;  2IM0 A;  2HFS A;  2ZDO A;  1S1X B;  3FBE A;  1VJQ A;  5D4N A;  3VZH A;  4YY3 F;  3G4S S;  3OHA A;  2QLB B;  5DQH A;  4YB1 P;  1N8R T;  2XSF A;  4TU7 A;  2VFV A;  4IDK A;  2C22 A;  3GR0 A;  1EIY B;  1KQG B;  1N32 F;  1YI2 S;  3GZ7 A;  4B9L A;  1RAO A;  1IWA A;  1PG5 B;  3PVX A;  2A10 A;  2P9E A;  4QIV A;  1R0C B;  4CH7 A;  1R8C A;  1F60 B;  5AJ3 F;  1WTF A;  2Q43 A;  2W7A A;  5C42 A;  3RBD A;  2UVV A;  4UY8 T;  1UVN A;  1P1L A;  2JX2 A;  1T9Y A;  2VKR A;  4URS A;  2KT2 A;  3FUY A;  2JZ5 A;  3V2U C;  3GG0 A;  1TKD A;  4JV5 J;  2OKQ A;  4QBU A;  2GIF A;  3SDE A;  3ENV A;  1FKA F;  3QWP A;  1XR7 A;  2WK4 A;  4NA2 A;  1JX4 A;  4DL2 A;  2QZ8 A;  5K20 B;  1ZPV A;  2HVE A;  2RSQ A;  3MM8 A;  1Q82 T;  1U26 A;  1GNK A;  2X1A A;  1NJZ A;  5B0E A;  1KVJ A;  1QTN B;  2VBW A;  4N76 A;  4OJ3 A;  3T19 A;  2KZM A;  4LR9 A;  4HAC A;  3VQS A;  3T5J A;  3G82 B;  1WEX A;  3MOJ B;  5KFD A;  3PRB A;  3DU6 A;  2DYA A;  3H2U B;  1TL7 B;  4WJB A;  1D9D A;  5KT4 A;  2LQB A;  5HRO A;  2OI2 A;  2J76 E;  1IKV B;  3AQO A;  4DUZ J;  2DNP A;  4LQ9 A;  4WP9 A;  4KPC A;  4AD6 A;  2DGO A;  1FJC A;  2VH7 A;  3CCJ S;  4G6V B;  4JP8 A;  4RW7 B;  1R8P A;  1WHX A;  1WKK A;  1P6T A;  2VBX A;  2FHK A;  3SCK E;  2ASL A;  4K0K J;  4DL4 A;  4MKB A;  3Q22 A;  2NXC A;  1JLE A;  1WUU A;  1Y11 A;  3TUP A;  2Z8Q A;  2JEG A;  1O0P A;  3BH7 B;  2GO9 A;  1HI8 A;  3NG8 A;  5J2M B;  1U48 A;  5AE2 A;  4C8Y A;  4FVC A;  1C1C A;  5THW A;  2JH3 A;  5KFN A;  3KHR A;  4A46 A;  4ANE A;  4ED1 A;  4R8U A;  2CQ3 A;  3R5C A;  1C0U A;  4ECY A;  1D9F A;  2XWX A;  3CIM A;  2OAU A;  3K5O A;  4ZJO A;  1OWX A;  3M2U B;  4EEY A;  2A1B A;  2XNR A;  3EE3 A;  2B4V A;  1XER A;  3BKF A;  2UU9 F;  1L3U A;  1HNI A;  2LQ9 A;  2R2U A;  1CSJ A;  1QAJ A;  4ES2 A;  2OEK A;  2VG6 A;  2AIR B;  1T9W A;  1KLN A;  4FXD A;  2YNH B;  1YZ7 A;  3D5M A;  3BZQ A;  5A8W B;  1CEZ A;  3BQ1 A;  3M6X A;  1XWL A;  2XHC A;  5H9F J;  3FKB A;  1IBM J;  4LF8 J;  5D8H B;  2JNJ A;  4JI7 J;  3HHL C;  2KFZ A;  3C6U B;  3DHX A;  3EPG A;  4USW A;  4MJK A;  3QJP A;  3DLG B;  4DFK A;  1U0H A;  2A2C A;  1F5C A;  2HBQ B;  2MJN A;  3MR2 A;  4L73 A;  3C6T B;  3TOQ A;  3BGR A;  4LF7 F;  3UVJ B;  3FSI A;  4QWB A;  4UUX A;  5BR8 F;  3NLC A;  3NOG A;  4FF4 A;  3GP9 A;  3SSQ A;  2JSX A;  5DDR C;  1PC4 A;  2EBG A;  4ZP6 A;  5JXS A;  2OHD A;  1T9T A;  3VHQ A;  3BN4 A;  3D1O A;  1P27 B;  3GII A;  4NE9 C;  2B9E A;  4PWU A;  1VHF A;  5JMN A;  4R5P A;  1NSA A;  2J7U A;  2JLF A;  2W2M P;  2WW8 A;  3M1V A;  3CDB A;  4F2R A;  3RU0 A;  5KFH A;  5HVH A;  4JV2 A;  1U6B A;  3A8I A;  2MJU A;  2CG4 A;  3CD6 S;  1T03 B;  1RT2 A;  4LMZ A;  3PW5 A;  3GIJ A;  1FK9 A;  2ATC B;  3C6U A;  3TWZ A;  4Z7Y A;  4ZPA A;  7FDR A;  1UFL A;  4F4Z A;  1YK9 A;  2KG0 A;  4Y2M A;  3G82 A;  3HJF A;  3JSB A;  2V8V A;  9ATC B;  4EZ9 A;  4URG A;  2YVS A;  3QT5 A;  4ECX A;  3RW6 A;  3D68 A;  2C2R A;  4DV6 F;  4Q7A A;  1ZZN A;  1Z2Z A;  3DFE A;  2DGX A;  2FZG B;  3OFH A;  3RAM A;  3B82 A;  5MAO A;  2FLO A;  5HJX A;  1RYR A;  1WWH A;  5B0A A;  3W8G A;  1U8W A;  1YQH A;  1HNI B;  4IYQ A;  2D3O 1;  1MMD A;  1EJ7 L;  2CA9 A;  2UUA F;  4LF5 F;  1ZS6 A;  3PM9 A;  5ETV A;  4DPO A;  3QAU A;  4I2Q B;  2Q1L A;  3AOA A;  2PSZ A;  4ECZ A;  1NH8 A;  3O5T B;  1NHK L;  2VDI A;  1H74 A;  2QJ3 A;  3HF5 A;  3I55 S;  1FX4 A;  1UJ5 A;  2I5J B;  2PMW A;  4ELV A;  3LPY A;  1U0S A;  1UFW A;  3T1H F;  3JQM A;  3TQ1 A;  3CUL A;  2HHW A;  2JJ4 D;  2G13 A;  2QO3 A;  1AFI A;  2R7R A;  4DQQ A;  1DTT B;  3NNC A;  1X60 A;  4OQJ A;  4X4Q A;  4ZCL A;  1U2F A;  3GIK A;  4BS2 A;  1S1W B;  3HMJ G;  3MED B;  3HD1 A;  3VZI A;  1SV5 B;  3I32 A;  1HQU A;  1WTB A;  3KK3 A;  3FVY A;  4QR0 A;  4JI2 F;  3UPF A;  4QR2 A;  2UUB F;  1IKV A;  1LQ9 A;  4ZS6 A;  4RLE A;  1NK4 A;  4WE1 A;  2DNL A;  2BEF A;  4J9S A;  5I42 A;  1KOH A;  3IWX A;  4ZN3 A;  1PYS B;  4OHW A;  4TU8 A;  3ZNU A;  2B9Y A;  2HVH A;  4ID8 A;  2AJF E;  3NWG A;  1WOO A;  4OJH A;  1O6X A;  4U67 Q;  2OPS B;  3MFH A;  2XS7 A;  2RH3 A;  2DHX A;  3MM8 B;  4P52 A;  1JLF A;  1X4H A;  2XCA A;  2E29 A;  2WSF C;  3QO9 A;  2YPY A;  4NA3 A;  4USH A;  4DXL A;  3TZX A;  2PI4 A;  1K1Q A;  2HHT A;  5EX3 A;  1H38 A;  2IVM A;  4WK3 A;  3SDE B;  2NQP A;  2QX0 A;  3V6H A;  2W4P A;  3ILJ A;  4C3M A;  1JIH A;  1CC8 A;  2FGO A;  2QLW A;  3DC2 A;  1X8D A;  1RBA A;  4Q5V A;  4IQX A;  1S77 D;  2IY5 B;  3KNG A;  4QPX A;  5L38 A;  3AAW B;  2WSE C;  3M8W A;  1IM6 A;  4O44 B;  3D2W A;  3KJV A;  2P6T A;  3W3S A;  1FTC A;  5GAE U;  2BAN B;  1E6V B;  2RD5 C;  4JI8 F;  2FZK B;  2YKO A;  4OJG A;  2BE9 B;  3TX0 A;  1RHM B;  4DPU A;  4U6P A;  1YBU A;  3Q8Q B;  4FDF A;  2L9N A;  3MUM P;  3DLH A;  1LXJ A;  3GON A;  1XR5 A;  2MTL A;  2XGQ A;  4B9U A;  2CQP A;  1Q16 B;  1LWC A;  1MWZ A;  4USJ C;  4DX6 A;  1RT7 B;  4P2F A;  1WOS A;  2LDI A;  2FY1 A;  5KFM A;  2J5A A;  2ZDP A;  2GJF A;  3QSY B;  4DV0 F;  2MQP A;  3KTQ A;  5EGY A;  2AYB A;  1FRM A;  3DU5 A;  2MKH A;  1RAC B;  4PXD A;  4U96 A;  3UCU P;  1HQE A;  2NXU A;  3EZ5 A;  1S49 A;  4DSJ A;  1JJ4 A;  3MM9 B;  2E1R A;  4WPA A;  4ES1 A;  5AXK A;  4F67 A;  1VBZ A;  2IM1 A;  2JL9 A;  3D1H A;  2J9D A;  4M63 A;  4ZCM A;  3KLG A;  2ADB A;  4OL8 A;  1RK8 A;  2XMU A;  3FNN A;  4NCG A;  1NUE A;  2E66 A;  3PHE A;  3H2L A;  5DQI A;  2E5I A;  2MSS A;  2V4J B;  1S6P B;  3QBC A;  3K59 A;  4FF1 A;  5K14 B;  4ZPC A;  4CLT A;  2MMY A;  4L72 B;  1FFG B;  2AJ1 A;  4L74 A;  4PQU B;  1UWA A;  2CZV C;  5DDP C;  3PY8 A;  2XMT A;  1VRT A;  2GMJ A;  3HHL A;  3LA0 A;  2BRL A;  3EGW B;  4IH5 A;  1VGY A;  2C3M A;  1HBM B;  2QMX A;  3CDU A;  5C24 A;  4F50 A;  1FNO A;  4EZ6 A;  3AB2 B;  3OW2 R;  2VPZ B;  1QSS A;  2KVQ E;  1DAX A;  2HEK A;  2CWK A;  2KT5 A;  4CO4 A;  4M5D A;  3J81 Y;  4ZP8 A;  4MH8 A;  4H54 A;  3BSO A;  1OYD A;  2E7X A;  3DLK B;  4OZN A;  3VR1 A;  1RU1 A;  4IG0 A;  3PEJ A;  1RT4 A;  4FF3 A;  3W66 A;  2CZ4 A;  3K5L A;  2O01 C;  2Q3P A;  1R7I A;  1GXL A;  2MHE A;  2QG9 B;  2FZC B;  1T9X A;  2R7O A;  3CD7 A;  3HHD A;  3TJ9 A;  2CIM A;  4ENO A;  1GX5 A;  1OPI A;  4PG8 A;  1TUV A;  3OTO F;  4PQU A;  1RTJ A;  3MMA A;  4FYD A;  2ILY A;  3HT0 A;  3PIP Q;  3HM9 A;  2CYY A;  2OFG X;  1IBM F;  3W62 A;  3P5T L;  1RT1 B;  2JEJ A;  1T3O A;  1TKZ B;  4ZK7 M;  3Q8S B;  3LWL A;  3I0S B;  2P5V A;  2QYC A;  1IKY B;  4NLW A;  4OZJ A;  2LEP A;  1BY9 A;  1EET A;  3ZZ0 A;  4WFN Q;  2PN6 A;  4LSL A;  2GS8 A;  3OL8 A;  4PWW A;  3OUY B;  4A8K A;  3T5H A;  1NSQ A;  2CZ9 A;  3LGM A;  3KLF B;  5H9E J;  5LL6 d;  4ZJQ A;  1HQE B;  2HRU A;  3C19 A;  2NPF A;  2D7S A;  3UWT A;  5AJ3 J;  3ITH B;  1GK8 A;  3CJT A;  2RIL A;  1EP4 B;  3DLG A;  4XK8 C;  3VGT A;  4F0M A;  3TZY A;  4IFY A;  3G87 A;  2KM8 C;  4RW4 B;  3HFV A;  4FYY B;  2UU9 J;  1LWC B;  2DB1 A;  2RQK A;  1HW8 A;  3D28 A;  1FFS B;  1S6Q B;  1NCL A;  2J6T A;  2G4B A;  3HUL A;  5G0R B;  4O0I A;  4B9S A;  3FSY A;  4KKO B;  1RT5 A;  1O51 A;  3M8Y A;  4F04 B;  1J27 A;  3KLG B;  1JKH B;  5B08 A;  1YJV A;  2FHJ D;  2M88 A;  2QYG A;  1UKU A;  4NEZ A;  2J8S A;  5KOX A;  3A4T A;  3N5F A;  3I5A A;  3RW7 A;  1K0V A;  1FVS A;  2HUR A;  5DLF A;  2ZH7 A;  2EPI A;  2OGU A;  3OJS A;  4E2F B;  4KH0 B;  1LW0 B;  2XWY A;  2F9D A;  2IMO A;  1H2V Z;  3EVM A;  5D3G A;  1XNR J;  1RWV B;  2E1M C;  1S0V A;  4B9N A;  3IAM 9;  4JI4 J;  2QLF B;  2CJ9 A;  1YJR A;  3D3C J;  1FKP B;  2VZ9 A;  4MIA A;  3R5B A;  1DBD A;  2B56 A;  4Y00 A;  2R3V A;  4BHQ A;  4NCB A;  1Y5L B;  3LAM A;  3CME S;  1YRT A;  1WEY A;  4WE1 B;  2QMW A;  1U49 A;  2V94 A;  3QT8 A;  4OYM A;  3QZ7 A;  2RNE A;  4J9K A;  1WG5 A;  1RYS A;  2ZH1 A;  4ED5 A;  2LP4 A;  3ETM A;  5DM6 Q;  1UJ6 A;  3H90 A;  3SYZ A;  2W9C A;  1L3T A;  1Y0H A;  1TAU A;  1T7P A;  5D4O A;  1HNZ F;  3S1T A;  5ETL A;  3HCX A;  4WTO B;  5LXR A;  2AJ0 A;  3M8R A;  2W9A A;  1MWY A;  3Q0A A;  2OLW A;  1AT1 B;  2AYE A;  2ZH2 A;  3I5B A;  3H5X A;  2WOM A;  5CD4 A;  1B4S A;  1KS2 A;  2CJK A;  2CPE A;  3OXG A;  4RUA A;  2ASY A;  2JWN A;  1CG2 A;  2UP1 A;  4DR3 J;  1NSP A;  4IQM A;  2FHO B;  3C14 B;  3JTP A;  4LF9 J;  3FZB A;  1S7H A;  1QSY A;  3JYT B;  4OI0 A;  5L1I A;  1EQM A;  1CUL B;  2MYF A;  4MMO A;  4DX5 A;  3G71 S;  1APS A;  3DGV A;  4DI6 A;  4GO7 X;  1OYE A;  4OI2 A;  5HVF A;  2C1E B;  4ELT A;  1IKW A;  2P9G A;  2GAH C;  3W1Y C;  5HMY A;  3R9L A;  4KGV B;  4OJ1 A;  4TY9 A;  1FRI A;  2JLG A;  1FO1 A;  5D0G A;  2IBK A;  1I94 F;  2D3O R;  2HQ3 A;  3MEK A;  2ZD1 A;  3QAE A;  3TO8 A;  4CWB A;  2NYI A;  4YB6 A;  4RW8 A;  2F7V A;  3T9N A;  2YTC A;  5D0H A;  3W2V B;  3BGL A;  5HMW A;  3G6X A;  2CPZ A;  2M8D B;  3DCA A;  3TJ8 A;  2YX1 A;  1HPZ B;  1KVI A;  2GVD B;  3MCM A;  3V81 A;  2ATL A;  1HWK A;  3JSM B;  4LSN A;  4JI2 J;  4C4W A;  5KG0 A;  2MST A;  5CAA A;  1XN9 A;  1S1W A;  2CPF A;  1D0E A;  1TL4 A;  4LBH A;  1NK5 A;  1DUR A;  2Z2M A;  1KDN A;  4R5P B;  2JFD A;  4M5I A;  4WU2 A;  1ZM9 A;  5C2G A;  3DI6 A;  3JB9 k;  4NCA A;  5CA5 A;  4ZVH A;  2F3J A;  3VV2 B;  5D6G A;  2MXY A;  1AYE A;  1ZTT A;  1VBY A;  2Z2Z A;  3CJK B;  4DPW A;  3I0S A;  3OTE A;  4ZP7 A;  1QVG R;  4LF8 F;  2HFU A;  2HPU A;  2L3M A;  1L5U A;  1RT1 A;  1VHI A;  4Y65 A;  5A2Q U;  1FDD A;  1VDH A;  3M9N B;  4ZVE A;  3KLH B;  1RT3 A;  5ITH A;  2CNK B;  1MN9 A;  1LV5 A;  3MM9 A;  4TLR A;  1TQL A;  1WHV A;  1HBN A;  1Q1K A;  1YJT A;  2HK2 A;  4TN2 A;  2DNN A;  1U8S A;  3ENW A;  3K2Y A;  5K8O A;  4IKA A;  1T8E A;  5KFX A;  4YFU A;  3J81 U;  1U02 A;  3CD0 A;  4NLX A;  3I56 S;  1SC3 B;  4Y34 A;  4ZVR B;  2C3O A;  1EB0 A;  2HQC A;  4TY8 B;  4NXM J;  4M5N A;  2IJF A;  2RUG A;  3RRK A;  2ZJQ Q;  3J7Y U;  2WVC A;  2CJA A;  3IGN A;  3DGP A;  1R8H A;  3ILL A;  3EPI A;  3SXL A;  2MY7 A;  3FCH A;  2DNR A;  3MUV P;  3CE8 A;  4P7V A;  2OPP B;  2ZBP A;  3VCD A;  4DWI A;  2E9T A;  1LK5 A;  2LKZ A;  1CLF A;  3IWL A;  4C8N A;  2EEY A;  4X62 F;  2XZT B;  1NZ8 A;  3M32 A;  5KFB A;  3ZFV A;  1WKJ A;  4ELU A;  3W9H A;  5LJ3 Y;  2RS2 A;  1TKT A;  3B78 A;  3V6D A;  2V5H G;  2Y1I A;  1FE4 A;  4YEA A;  2K3K A;  1QAX A;  1RWW B;  3PHT A;  2JVR A;  4RNN A;  2LFV A;  1K47 A;  4KV8 A;  4GC6 A;  5CYM B;  3HVT B;  3TYT A;  4ZVS B;  4CO2 A;  1N6Q B;  2PMH A;  4NLR A;  2DXF A;  5F0U A;  1TFW A;  3NL0 A;  2ZOM A;  1TMM A;  1F3F A;  2KYX A;  3B54 A;  3PRD A;  1IQZ A;  1S59 A;  2KU7 A;  1VQP S;  3RR7 A;  1SVD A;  2KHD A;  4WTY A;  3ZTS A;  1XC9 A;  2PI5 A;  2ZUG A;  5A8K B;  2DR9 A;  4ZHR B;  4ETX A;  3QGP A;  4D3H A;  4OX9 F;  3MPY A;  2DHH A;  5E41 A;  3TI0 A;  2I0X A;  3MFI A;  3IS9 B;  2GNK A;  3G6E S;  3TUJ C;  1M5P C;  2UVR A;  2WVD A;  3M8Q B;  1VOM A;  3E51 A;  5HL7 Q;  1S79 A;  2DNZ A;  2HKE A;  1UL3 A;  2VC0 A;  5A8W A;  1N34 F;  2F63 A;  4OYW A;  2GV1 A;  2YKN B;  4JV5 F;  2M2B A;  3OR1 B;  2CRL A;  2RML A;  3GYG A;  2FDN A;  3HO1 A;  2ZHA A;  1G4C A;  3W5Z A;  1HNV A;  2VG7 B;  4I56 A;  2M3D A;  2VOD A;  4KGK A;  2N4C A;  3UNG C;  2P9C A;  5KT6 A;  5GMD A;  1Q81 T;  1E6V A;  2DH7 A;  1Y7P A;  4MKY A;  4ILL A;  1FKO A;  3PNI A;  2IM2 A;  2AZ1 A;  3DMJ A;  2A6M A;  3G9C A;  1R6Y A;  1MU2 B;  1ZM3 A;  1JWW A;  4DS5 A;  4ZPB A;  4C0O C;  1M5K C;  3SSR A;  2FD2 A;  3I6P A;  4S0M A;  1J5E J;  2GQ2 A;  2E5L F;  2B0G A;  2W4D A;  4CO1 A;  2QA4 S;  5DS7 A;  1CJT A;  3C3L A;  1VLY A;  5E3A A;  2MKS A;  2RF2 B;  3BRE A;  3OD2 A;  1KTV A;  3UN5 A;  1NDL A;  1T0T V;  3MAH A;  1H73 A;  3FZ2 A;  2DIU A;  3M30 A;  2XLJ A;  1D1U A;  3CCT A;  4GVB A;  2QV6 A;  4Y28 C;  4HT5 A;  4CM2 A;  2HFO A;  4RBV A;  4F2S A;  1YZ6 A;  2WB4 A;  2ZKU A;  5KFY A;  3OHB A;  1RB0 A;  2N4D A;  3RBE A;  1VQ6 S;  1QLN A;  1G1X A;  3PZP A;  4G3I A;  1HNV B;  1M1G A;  2W01 A;  1FRK A;  2L41 A;  4C3L A;  2H51 B;  5E33 A;  3PRV A;  3TVZ A;  2MGZ B;  3PJ9 A;  2DIT A;  2VQF F;  1URR A;  3ET6 A;  2R8J A;  4M95 A;  3LP1 A;  1YJ7 A;  3B8H A;  1NHU A;  4FBT A;  3L95 X;  2DPJ A;  3OTC A;  3R27 A;  2CDR B;  2RQ4 A;  3I5C A;  2ZH6 A;  1JJ2 R;  4JV1 A;  2HZA A;  3RBX A;  4CZC A;  4DFM A;  1OSC A;  3V4M A;  3PO5 A;  4P75 A;  5KG1 A;  1KLM A;  3X3U A;  2B9W A;  3FRY A;  3VGS A;  5KT2 A;  3S7R A;  4DS4 A;  4Z37 A;  4NLQ A;  4K4U A;  3IFE A;  4LBI A;  1ZA2 B;  4N7T A;  5L46 A;  1NK8 A;  2U2F A;  1KC8 T;  4PYA A;  3BDP A;  4ZKA A;  3GJQ B;  5RUB A;  5F8L A;  1HNZ J;  1SIW B;  1TK8 A;  2E5G A;  4J9R A;  3M2V B;  2IAJ B;  4CYU B;  1FDN A;  2MEW A;  2YKM A;  1B0T A;  3ZZP A;  3CC2 S;  4RO0 A;  2AX0 A;  1PKU A;  1Z2L A;  2CXE A;  2K2P A;  2DCL A;  3N6N A;  3RYL A;  5K8P A;  1IM4 A;  3CCE S;  1D8Z A;  4K4S A;  4YDD B;  3UNY A;  3CMQ A;  2EWH A;  3IG1 B;  1Q4R A;  1QE1 A;  3OTO J;  3UQS A;  3H59 A;  4I6Y A;  4F3Q A;  4K4W A;  1Y5N B;  4DV1 J;  4C8Z A;  2HHV A;  2I6W A;  1BQN B;  3DNC A;  4O4G B;  4JI8 J;  2F8E X;  5DZ6 A;  5F0W A;  3R7S B;  3L3C A;  2ZC4 A;  5DQG A;  3L7P A;  1DLO A;  1SB6 A;  1FEH A;  2GIR A;  1F9H A;  2L9D A;  2VC1 A;  3D6T B;  4YQW A;  3LPE A;  3DGP B;  2DD8 S;  2E44 A;  1RKJ A;  1N32 J;  2MZQ A;  1TZ0 A;  1Y4Z B;  4NLD A;  1SPB P;  4CQ1 A;  1FXR A;  2CWX A;  3NNH A;  5KG5 A;  3M2U A;  4J5O A;  4DSL A;  5A8K A;  5EWG A;  1V9O A;  1IJE B;  2GHP A;  5HI7 A;  4RBT A;  2MZR A;  1MW7 A;  1N33 J;  2RT3 A;  1G7C B;  3V4I B;  3TAN A;  2WVB A;  1OMS A;  5GVQ A;  2ILZ A;  1N6Q A;  3H8Y A;  4CRJ A;  4QW9 A;  1M0S A;  4DL6 A;  1F0X A;  4K0K F;  1OSD A;  1RTI A;  9RUB A;  4Q8E A;  2IYG A;  2MQ8 A;  2OD6 A;  3BBC A;  3KJN B;  4DX7 A;  2V50 A;  4B3O B;  2ZHO A;  4PAA A;  4QWC A;  3EWG A;  1G6B A;  2VBY A;  3H20 A;  3SV3 A;  4F02 A;  1JLB A;  2KHC A;  1XTZ A;  3U02 A;  3PR4 A;  2RB7 A;  4H4K A;  4LR7 A;  1Y00 A;  2YNF B;  3F0N A;  3BGO P;  1F5B A;  1R0B G;  2LEB A;  2L9W A;  4OZ5 A;  3UD3 P;  4ED7 A;  1KKH A;  2Z4P A;  3HFK A;  4MK9 A;  5BXI A;  3MEG A;  2IRX A;  1VIX A;  4B3T F;  3B6B A;  3GFX A;  3C46 A;  3BSC A;  4NPO A;  2OPQ A;  1JNR B;  4C11 B;  4ZCK A;  2CVE A;  3H4D A;  2OML A;  1BUX A;  2DGW A;  2ZM6 F;  2RUS A;  4KV8 B;  2NXE A;  4RJV A;  2MKY A;  3H2V E;  2DNK A;  2M70 A;  5IS2 A;  1H98 A;  4O0N A;  2YXL A;  4OFZ A;  3MM7 B;  4QCL A;  2BZ2 A;  3BN7 A;  1T11 A;  3MPV A;  3W61 A;  1F9F A;  3M4X A;  2XC9 A;  1N36 F;  2RU9 A;  4MYU A;  1FXD A;  2IA6 A;  4LSN B;  3TP2 A;  3CT9 A;  1UA0 A;  1TR0 A;  2DH9 A;  4LR8 A;  3M8S A;  2CQG A;  2RRB A;  1RA7 A;  3V81 B;  1UWB B;  1Q7Y T;  4NI2 B;  2HHS A;  3ZZT A;  4KJI A;  4O4G A;  3VAI A;  4UST A;  3NMR A;  3CJ4 A;  2ZH4 A;  2JHE A;  4MKV A;  3PO4 A;  2SXL A;  3D0I E;  2LDY A;  2M9K A;  4NLV A;  2KVI A;  4UQG A;  2K1R B;  2NUU G;  5F3T A;  1DQA A;  1X4C A;  2ZC3 A;  1NPP A;  3BBB A;  4AXI A;  4U8Y A;  2ZJP Q;  4JI6 J;  1GX6 A;  4KIA A;  1UEV A;  1IKW B;  3WQP A;  4P10 A;  1QDU B;  1HR0 J;  1G2E A;  4WFZ A;  1TKX A;  3MMB A;  3FFI B;  4UOF A;  4A8M P;  3DYA B;  2HHH J;  1S9F A;  2B4U A;  4WZM A;  3I0R A;  3QAT A;  3KLH A;  3BR8 A;  5H9E K;  2I38 A;  2BA9 A;  1ELO A;  5ETQ A;  4KQZ A;  5IQQ A;  1KLM B;  4JI6 F;  1S9G B;  4Q45 A;  4DV7 J;  4P9S A;  4DEZ A;  3F41 A;  1J2V A;  1Y3K A;  2CQI A;  3NWR A;  3AFG A;  2UVU A;  2B51 A;  1RBO B;  3B4D A;  2R9L A;  2V9W A;  1LW2 B;  1NLK L;  2AEM A;  3DDN A;  3HKW A;  3JTN A;  2F9J A;  4XAK A;  1YLX A;  5D15 A;  1N5T A;  2YKN A;  4XPC A;  3HT3 A;  3SIP B;  1KFS A;  1MNE A;  2X7I A;  1PYT A;  3SSS A;  2PD1 A;  2ASJ A;  1JLA A;  2LU1 A;  2YX4 A;  3M6W A;  3K5P A;  3SI8 A;  1T3N A;  2HSE B;  3MHY A;  1RHJ B;  1RWO B;  2DNH A;  2DPI A;  3FJ2 A;  5U47 A;  4NYZ A;  3KK2 A;  3VAH A;  1IKX A;  4PG5 A;  4DV4 F;  4P73 A;  2HND B;  3UDE A;  3ZZR A;  2FC8 A;  4ETZ A;  4ECW A;  1F2G A;  3G8S A;  2GJI A;  3KLI A;  5E7O B;  1KRP A;  3CTR A;  4X65 F;  1WD6 A;  4IDK B;  4I69 A;  2NYH A;  3DRP A;  4DG1 B;  3BJY A;  3DMJ B;  5HMX A;  2UXC F;  4U8V A;  1IJF B;  1RDR A;  5FII A;  2Y0B B;  1S1X A;  1VQK S;  4EBD A;  2BE2 A;  1I1G A;  1H2T Z;  2AP6 A;  2EFP A;  2X1G A;  3IS9 A;  3NCP A;  4RW9 A;  1RTZ A;  3TEH B;  3VF0 B;  2MKJ A;  5IT0 A;  3OVA A;  4JI3 J;  1XMQ J;  1WEL A;  2RKI B;  3K8V A;  3NS5 A;  3QGG A;  1T05 B;  1WEZ A;  3FCW A;  3A13 A;  2HMI A;  5MLC V;  4I2P B;  3OR1 A;  1XQI A;  1Q53 A;  3QMQ A;  1I94 J;  4DN9 A;  2QA2 A;  1EQ0 A;  2AJQ A;  4U7C A;  4WYL A;  3JAM U;  3FCV A;  3UR3 C;  2ZFH A;  3AJD A;  3SQO P;  1SJ1 A;  5GAE I;  1AUS L;  1F9E B;  4B9V A;  4KFB B;  2PA8 D;  3KG1 A;  1J5O A;  1ULR A;  3KXD A;  2DT9 A;  3RUB L;  4X4P A;  3KUG A;  3C15 B;  2LCW A;  3BM7 A;  4OV6 A;  4ZOS A;  4AE5 A;  3K7R A;  3N28 A;  2YX7 A;  4OHZ A;  4ZCI A;  2LXI A;  2R2S A;  3CF5 Q;  2MPU A;  2KH9 A;  2EK6 A;  5J1N A;  2M7S A;  5LJ5 Y;  1YVF A;  4P2M A;  4QWE A;  4PKD B;  4K59 A;  3IWN C;  1S6Q A;  3EDR B;  1PBU A;  1RLC L;  1SXL A;  2ZD1 B;  4ZVP B;  3TAM A;  2KM8 B;  2WON A;  2K7J A;  2HNZ A;  1RU2 A;  3NGU A;  1I51 B;  3HSD A;  3Q8P B;  4QWD A;  2CVI A;  3GIL A;  4ZPV R;  2M8H A;  2FYX A;  1VC6 A;  2G9O A;  2D3Z A;  2E7W A;  2G1D A;  3MUR P;  1SIZ A;  4UZC A;  4O3O A;  4B3M F;  2JEI A;  2GW8 A;  1UEU A;  2W2O P;  2XY7 A;  2B5J A;  1LWE A;  2CQ0 A;  2C3Y A;  1NM2 A;  1RAF B;  2BVZ A;  5L1J A;  5DGB A;  3BH6 B;  1HPZ A;  1HWI A;  5LXY A;  1HFE L;  1NKB A;  3OPK A;  1VJW A;  2PA3 A;  4IG3 A;  5HAO A;  3KG0 A;  1KQF B;  1SL1 A;  1FI4 A;  3VGV A;  3MI7 X;  3GSI A;  4K7Q A;  4F4W A;  3AH6 A;  4CDI A;  3RAQ A;  1L3S A;  3CDW A;  4LFA J;  3TUZ C;  3MF5 A;  4NLU A;  1FE0 A;  1KP6 A;  2CQD A;  2OEJ A;  2OP5 A;  1BHN A;  3GTY X;  4B9M A;  2YWG A;  1YJ9 S;  3DXS X;  1ZYQ A;  4TXS A;  3LAN A;  3OT9 A;  5AT1 B;  5L1L A;  4AL6 A;  1QSL A;  5DDQ C;  1CJV B;  1N5Y B;  1XMB A;  4DR7 J;  3POT B;  2GCF A;  1GTE A;  3CDE A;  4UZB A;  4ZIT A;  4DUY J;  1NPR A;  3IR6 B;  2LA6 A;  4ZPD A;  4U95 A;  1P9Q C;  5E3P A;  3W2W A;  7AT1 B;  4RX6 A;  1FWL A;  2W2P P;  4ICL A;  3LTO A;  5H1S V;  1HLW A;  3KJQ B;  4QZV B;  3NAI A;  4DPY A;  3KLE A;  1RCX B;  2CNN B;  2GO8 A;  1J5E F;  4LF6 F;  4N41 A;  1EAR A;  2NXN A;  3W9I A;  4DV2 J;  4ZLJ A;  3ILI A;  1VQ9 S;  4B17 A;  2YQ3 A;  5IV3 A;  3ENA A;  3CW2 C;  4ED3 A;  4GKJ F;  3JYT A;  4DPX A;  2B8Q A;  3D6H B;  3SFU A;  1NRK A;  2DNG A;  2CQ2 A;  2IVY A;  3Q24 A;  4FS1 A;  4CLK A;  3GWC A;  5IM0 A;  1FRL A;  2CPH A;  2MQM A;  3LOU A;  5CYJ A;  3OTB A;  3KK1 B;  3FK4 A;  3MPU B;  2B8P A;  2VQE J;  5E3C A;  2VIH A;  2VOO A;  4G1P A;  4CT8 A;  5G0R A;  4IOB A;  1U1R A;  4CIO A;  1IKX B;  1JLF B;  2Z0G A;  1UPM B;  2QTW A;  2Q6B A;  2VOP A;  1I6J A;  2HHU A;  3CCR S;  1GMV A;  2XM3 A;  4GKJ J;  4LF4 F;  4OI6 A;  3AOB A;  1RWX B;  1OIA A;  5FDL A;  2IHR 1;  1QUV A;  1TL3 B;  3THP A;  4E0D A;  4JI0 J;  2JDJ A;  3MPD A;  5DET A;  2H5E A;  2KYZ A;  4OYA A;  4RUH A;  1LXN A;  3M7V A;  2Y9H A;  3H0P A;  4ZMM A;  3QRP A;  3DXB A;  1REV A;  3CPW R;  1RAE B;  1RHU B;  2DK2 A;  2V8G A;  2VF3 A;  4F4Y A;  1GXT A;  2ZZN A;  2AX1 A;  2M0G B;  3AJ2 A;  3PJX A;  1IKY A;  3NOC A;  4ID5 A;  2KI2 A;  2CNO B;  2DNY A;  2MQL A;  1ZAW A;  3OXL A;  2HQI A;  1VCT A;  1FD2 A;  4KKO A;  5C25 B;  1MMN A;  2C2K B;  1MML A;  1SI9 A;  3BO3 A;  2MQO A;  3Q2T C;  3SZ2 A;  1YGY A;  5A0Y A;  3UE2 A;  1SJF A;  2E1P A;  1FVQ A;  3FBB A;  5IWA J;  1W7W A;  3BO4 A;  2AYG A;  2DH8 A;  3CD5 A;  1JLG B;  2VU5 A;  2JRS A;  3MDF A;  1WC6 A;  4NEY A;  5T41 A;  3TQE A;  5A8R B;  5KFL A;  2FJE B;  4M5H A;  4AND A;  3KNA A;  1GXU A;  3AQP A;  1SUQ A;  3R5G A;  5EWF A;  3BSN A;  1S48 A;  2EFN A;  3PDN A;  2NXJ A;  1WJ9 A;  2EG2 A;  5CYQ A;  4PG6 A;  4TVA B;  3PXG a;  4F8R A;  2AHO B;  4PYD A;  1X4E A;  1X0P A;  3DN9 A;  3W7B A;  1FEE A;  3KLE B;  2FC9 A;  2OPR B;  2V8H A;  5BYR A;  2IJN A;  5SUH A;  5HLF A;  1W26 A;  3QIP A;  3O6Q A;  2GFF A;  4LRD A;  2BAN A;  2QGF B;  2NZC A;  1U45 A;  2R8K A;  1U24 A;  2E9Z A;  4QWA A;  1HBM A;  1UZH A;  5KFI A;  3BPS P;  4ZVQ B;  2V6A A;  5C24 B;  1CJU A;  1UTA A;  3UFC X;  3KMS A;  4J9M A;  1RE1 B;  2HHX A;  4CLS A;  5HVG A;  1SJR A;  4C9D A;  1BWV A;  3QID A;  3I4P A;  1NK9 A;  3OUY A;  3CCL S;  2EKN A;  3SCL E;  4OIX A;  3H25 A;  3GCW P;  4ATN A;  1GMW D;  2OPS A;  1JLQ B;  5HBM A;  4JV0 A;  3THT A;  1F5A A;  2CPY A;  4BLG A;  3PYD A;  3VAF A;  4RW4 A;  3BB5 A;  2IBO A;  3MCO A;  1FRH A;  5GAH I;  4OZ1 A;  1Q7L B;  1SCJ B;  3I96 A;  4FKY A;  3CCQ S;  3EM1 A;  1C1B A;  2ZEJ A;  3LWM A;  1V3Z A;  3OR2 B;  4USK A;  3J80 Y;  3R6G B;  1NBE B;  4FPR A;  3DOM B;  4R0J A;  2DRA A;  1C1B B;  4CI0 B;  5BJR A;  4M5J A;  4O3S A;  3WX4 A;  2A6O A;  2DBB A;  3M1V B;  2H54 B;  2H5I B;  2WBR A;  5KFW A;  2W25 A;  5M2U A;  4NMX A;  4DLG A;  2HVI A;  2DO0 A;  2IYI A;  2Y3Y A;  1LWE B;  1X4A A;  4HTI A;  2BJE A;  1WC4 A;  4QIE A;  4JUZ A;  4B3S J;  3FQL A;  4YDX A;  2LXU A;  2V8D A;  4QYZ K;  5ETT A;  1DTQ A;  4ZVO B;  1FJ7 A;  2J0S D;  3KDN A;  5EX0 A;  3TVK A;  3KHH A;  4NCG B;  3D67 A;  4HI1 A;  4QW8 A;  4WYW A;  1PIE A;  1IVZ A;  1B7F A;  3TAQ A;  3FC9 A;  1NH7 A;  2CQC A;  3O8W A;  3OL6 A;  4FP9 A;  1ICE B;  4DL0 C;  1FJG J;  3DLK A;  3AA8 A;  2IFX A;  4OZ0 A;  3AD8 C;  2G2Z A;  3BQ2 A;  5HP1 B;  3TAM B;  4LF4 J;  5F8J A;  1NKC A;  1TMJ A;  3R5D A;  1OQ6 A;  3H40 A;  4M94 A;  2AWZ A;  2KTQ A;  5CH7 B;  4J9U E;  2VG6 B;  3MM6 B;  2E1A A;  2FJW A;  3HJV A;  2LMI A;  2ZNZ A;  3SCJ E;  1NK7 A;  2XMA A;  1WF2 A;  1WOP A;  2BJ8 A;  4ECU A;  1LK7 A;  2PEB A;  1CVJ A;  1VRT B;  3HHL B;  3NNA A;  1VFJ A;  3M2R B;  3P49 B;  4UOH A;  1UZD A;  4TYB A;  1VC0 A;  4CLW A;  2NR0 A;  3EXC X;  2DEJ A;  2DGU A;  3KK3 B;  4K2X A;  2BXJ A;  5ETM A;  2MHN A;  2N7C A;  3DRP B;  4LUB A;  4DG1 A;  3G8T A;  2CPI A;  5FLX Y;  4DSK A;  4O3P A;  1R8A A;  2VV5 A;  2X1F A;  3IBC B;  1U1M A;  5B0F A;  3LAK A;  5IFM A;  3AXM A;  4USI A;  3E2E A;  4PXC A;  4KH1 B;  3DM2 B;  4CCH A;  2HVZ A;  1S57 A;  2Y1L B;  2N82 B;  4OZL A;  2W8K A;  2HNY B;  3PCO B;  2EKY A;  3AA9 A;  3Q8U A;  1P9Y A;  3MR6 A;  4LFC J;  3DRS B;  5GAD I;  2BR0 A;  5FDL B;  1ZET A;  2MDA A;  2F8H A;  3GIM A;  2F4F A;  2GML A;  4KT0 C;  2DHA A;  3K5N A;  3TJA A;  3UR0 A;  3RB3 A;  5J2P B;  4DUZ F;  4CLL A;  2HS3 A;  2HQF A;  2LYV A;  2GAG C;  4C98 A;  3CC7 S;  1VQS A;  1S4E A;  1HAR A;  2H1Y A;  4DR2 J;  1DTT A;  3T1A A;  1XIQ A;  3EZO A;  1R31 A;  2GMH A;  5CZX A;  1HHS A;  3A8J A;  1E6Y B;  4LRC A;  1YSJ A;  3CVK A;  3ETO A;  3TEG A;  5I42 B;  4X4S A;  1HI0 P;  4UY8 5;  2GIQ A;  1HD1 A;  2BOP A;  1MU2 A;  2W7O A;  3CCW A;  2XY5 A;  1GTH A;  1IBK F;  4I2Q A;  2K8G A;  4B3R J;  4A47 A;  1R27 B;  1HBO B;  2HNY A;  4KE5 A;  2UVW A;  3OVB A;  1C1C B;  4ZVF A;  5HAN A;  3PKY A;  2BKO A;  2CDQ A;  1GQE A;  4A8O A;  1N34 J;  3OL9 A;  3T1Y J;  3MMC A;  1QD1 A;  2FJD B;  2F8M A;  3EGN A;  3I0R B;  5F8M A;  5A76 A;  2YH1 A;  1NJW A;  4F4K A;  3GMG A;  3HZG A;  2ZUA A;  1LWF B;  2K7K A;  3MED A;  3H4B A;  1GAO A;  4KTQ A;  1RAB B;  5CCM A;  4A8Q A;  1C0T A;  3E8O A;  2UUC J;  3EJM A;  1M5H A;  2R4F A;  5DLG A;  1WC3 A;  5CAB A;  1UVI A;  2B7B B;  1TL7 A;  4CLY A;  4F0K A;  5M2P A;  3FBC A;  1YIT S;  1V6H A;  2FIU A;  2K1R A;  1RCO B;  2YWF A;  3ISZ A;  1YJN S;  1U4B A;  3DDK A;  4A4J A;  1QTM A;  1M5O C;  1QVF R;  1REG X;  3W64 A;  3KWM A;  3R1L A;  3HVR A;  2E5H A;  5EUH A;  1OY9 A;  3N79 A;  4P72 A;  4RNH A;  4GRS A;  2FVQ A;  1DY3 A;  4X4V A;  2B5J B;  3GYN A;  5GMK a;  2R8H A;  4F4A A;  4WKY A;  4UOC A;  1VR6 A;  5K8N A;  4K4X A;  4F3O A;  3UVJ A;  1IXK A;  1FA0 A;  3OSN A;  3H5Y A;  1D09 B;  5DDO C;  3E01 B;  2MY8 A;  3R2C J;  2KXH A;  3CJQ A;  3AD7 C;  3D54 A;  3TZW A;  2W9B A;  1SJ4 P;  4Y2A A;  3ENQ A;  4LFA F;  1K8A T;  3OLB A;  2DR8 A;  4M5M A;  5DJB A;  3QJJ A;  2H5J B;  3VAK A;  4DSI A;  1RAG B;  4YUD A;  5F3Z A;  4BC9 A;  4XDC A;  3ZTQ A;  1GFW B;  2E9R X;  1P1T A;  1DLO B;  1S1U A;  2MLY A;  1BLU A;  2YNH A;  3C66 A;  3QT6 A;  4TQR A;  5DO2 A;  1RT2 B;  3T3F A;  2FLL A;  2RDD A;  2ZKT A;  4O23 A;  2ZZT A;  4L3N A;  4OZ2 A;  1NB2 A;  3FRZ A;  4HHU A;  2F4V F;  3IRX A;  3IM8 A;  1WSV A;  3J7A N;  2HG4 A;  1KOO A;  4PXB A;  4CTA B;  1XNQ F;  4KGZ B;  5D0R A;  8RUC A;  3CGI A;  2ZH3 A;  4XIU A;  2QFI A;  2CJQ A;  3R2D J;  1C4C A;  1VI7 A;  4RU2 A;  3K17 A;  2PMZ D;  3AOD A;  4TQS A;  1KNZ A;  3L09 A;  4I6W A;  4WXW A;  6FD1 A;  2HGL A;  1NU4 A;  3W5X A;  2EBE A;  4OMF G;  4EU0 A;  3DDI A;  3BGR B;  3GSD A;  2DR6 A;  2WW4 A;  4R25 A;  5KFR A;  5HBM B;  4FBU A;  3VVT A;  4Z2X A;  2PGC A;  3RB6 A;  2V9K A;  5LMU J;  5F8H A;  3PEH A;  3HPO A;  2FHM A;  3BQ0 A;  4CH1 A;  2R7W A;  1F2H A;  3P6Y C;  3WBZ A;  4DR2 F;  2VA2 A;  4RW7 A;  2HLT A;  4ZVT B;  3K57 A;  4BWJ A;  4YY3 J;  3DOK A;  1JQG A;  3SFG A;  4C0B A;  1HNX J;  2OTL S;  5B0B A;  3DOL B;  1K44 A;  2B4O A;  2VPX B;  1H7W A;  4G1Q B;  3QLH B;  3SQG B;  4BDP A;  2HHH F;  4QYZ J;  5KFF A;  2C3U A;  2CUY A;  4RW8 B;  2W1B A;  4O3Q A;  4ZLL A;  2KJW A;  2CQH A;  1RWM B;  4CLF A;  2EFV A;  4LBP A;  3Q8Y A;  1Q79 A;  4XPE A;  2LEA A;  2RAQ A;  3NKY A;  1SUQ B;  3JQK A;  5KTQ A;  2DIS A;  3BR9 A;  5DGA A;  2EC0 A;  1X31 C;  5KFV A;  1W2B R;  2C2Z B;  4EMD A;  5KFZ A;  1LW2 A;  1D8Y A;  2MKK A;  2YKM B;  2CJX B;  1EX8 A;  3M8Z A;  3VAG A;  2J9D E;  3RGI A;  4L6V 3;  3BGF A;  2MKC A;  4X4U A;  4RUB A;  4DR4 J;  3WDO A;  1SC4 B;  2VPY B;  1N0V C;  3E01 A;  3FEX B;  3HI9 A;  1X4G A;  4OI4 A;  1OS5 A;  4JI5 J;  1PAU B;  6FDR A;  2G0C A;  2G0I A;  4IFV B;  2MGZ A;  2DRD A;  1S9E B;  4RPF A;  2ZM6 J;  1YBT A;  1FNX H;  2UUA J;  3Q2S C;  3VGU A;  4RR5 A;  4LF5 J;  1HW9 A;  1M1H A;  4DV2 F;  1L3K A;  2HIY A;  4Y2K A;  4XDD A;  4ZPW R;  3GU0 A;  1JB0 C;  1SBR A;  3F56 A;  3EVW A;  4NWB A;  5L9N A;  5CD4 H;  2HWT A;  4X64 F;  1HWU A;  2QA4 G;  3VAL A;  3PJW A;  2MB0 B;  2UXB J;  4X2B A;  2G2Y A;  1E6Y A;  3W9J A;  3CJ2 A;  1N5S A;  3MTK A;  1CJT B;  1WAC A;  2CQ4 A;  2J7W A;  1RT6 A;  5AXM A;  3F44 A;  4JB8 B;  4ZLN A;  5F8I A;  2Y1J A;  4NRU A;  4J91 A;  4TLQ A;  3MM6 A;  2NSC A;  1ZM4 A;  4KYZ A;  3G2X A;  5IM0 B;  3KK1 A;  3DRS A;  4YP3 A;  4DBQ A;  2PO4 A;  2J9C A;  4J9O A;  4W90 B;  2UXD J;  3PYE A;  3MR3 A;  2VJU A;  3L7U A;  3PX6 A;  5KT5 A;  1RHQ B;  1U6Z A;  2E7V A;  3NBP B;  4MAK A;  1FWK A;  4F4X A;  3EDQ B;  4IOC Q;  1PBA A;  3A1Y G;  2D74 B;  3HD2 A;  2HLU A;  3JAM Y;  1AW0 A;  2QIF A;  1TEL A;  2GQC A;  3O44 A;  2XYH B;  1IR2 A;  4J9P A;  4NXM F;  1ZH5 A;  4ID5 B;  3I82 A;  2COL A;  3M8P B;  2OEL A;  4QQB A;  1DFD A;  4WK1 A;  3CCM S;  2MZ1 A;  1U6F A;  4CLP A;  3ZNJ 1;  3N9U C;  4KSE B;  5HQ8 A;  3J7Z 5;  3PYF A;  4ZA1 A;  5EDW A;  3ZXW A;  1HA1 A;  4J9N A;  4DOZ A;  4DX8 H;  5C7P A;  3IRX B;  3T1Y F;  4HT7 A;  3AT1 B;  1UA1 A;  2OTJ S;  3TAP A;  2ZH8 A;  2X51 A;  2E5J A;  2ROP A;  3IR7 B;  1RI7 A;  2BDP A;  2AF6 A;  1FX2 A;  1H6K X;  1XJW B;  1H2U X;  2CNL B;  3CJ5 A;  4L75 A;  4M1K A;  5L8R C;  5LSO A;  3M30 B;  4LSZ B;  5KT7 A;  5DG8 A;  1VIO A;  3U7J A;  4FNH A;  3MAQ A;  2BUN A;  2FGC A;  3PW7 A;  1ZAX A;  3P96 A;  1GT8 A;  1JLC A;  2GC8 A;  3NCR A;  4EGL A;  1K0T A;  1VQL S;  3QYY A;  1NK6 A;  2BOA A;  3IGV A;  2VB6 A;  2R7T A;  3ELH A;  1WHY A;  4CNY A;  1RTJ B;  2X1B A;  4ECR A;  2PC6 A;  1YTY A;  2ROE A;  1HYS A;  4QYR A;  2KKH A;  3HP6 A;  4YB5 A;  2YY3 A;  1FTR A;  2QA1 A;  2YKP A;  1UET A;  2ZVI A;  2G2O A;  2KZZ A;  2QN6 B;  1VBK A;  4UOG A;  3GV5 B;  1V3S A;  3SCI E;  3MAA A;  4DQS A;  1ZAV A;  2OO4 A;  4OI3 A;  5T7L A;  2AGQ A;  3HHL D;  1RT5 B;  2UXD F;  2B6A B;  4PWD A;  3A12 A;  3NP5 A;  3GPA A;  2XGP A;  5E0O A;  2D1C A;  4RU9 A;  3EYZ A;  1T94 A;  3M8Q A;  5HK4 A;  3PYG A;  5C2C A;  1YWX A;  1EAY C;  1QE1 B;  3QGI A;  2FTR A;  2V67 A;  5KG3 A;  3MEE A;  3CSK A;  1S76 D;  2H65 B;  1TTH B;  3OJU A;  1UEK A;  3T5L A;  3IO1 A;  4L3K A;  5L9X A;  2QSF A;  5CYQ B;  3A3N B;  3VWS A;  2AGP A;  4NLS A;  2C28 A;  2UUC F;  2R8I A;  4J9V A;  2R2T A;  2V2V A;  2CJY B;  1BD6 A;  2YBV A;  2OEM A;  2GVD A;  3IXQ A;  3HHN B;  1XMO J;  4DV5 F;  2XS5 A;  1PGZ A;  3HLU A;  3UDV A;  3RAX A;  3MXH P;  3HHK A;  3LGH A;  4WU3 A;  1ACM B;  4YME A;  1MG7 A;  3DI6 B;  3KMQ A;  2QLJ B;  4KBI A;  2A3J A;  4HH1 A;  2V0N A;  3MCN A;  4LJM A;  3L4B C;  2OD4 A;  5J1E B;  4ALZ A;  2GX8 A;  3I87 A;  1HBO A;  5FD1 A;  2KXF A;  4A48 A;  3ULH A;  1KBR A;  3W65 A;  3LP1 B;  1M90 T;  2WSC C;  5E3Q A;  3IBF B;  3MEC A;  3UD4 P;  4KC5 A;  3MCS A;  4LFB J;  2KFY A;  3AXK A;  1GH8 A;  2V2K A;  1SKS A;  2YNI A;  3T41 A;  2RS8 A;  2XG8 A;  3DRX A;  5CHC B;  1Q8K A;  2WB1 D;  4IG0 B;  3OL7 A;  1TL3 A;  3EX7 B;  1IBK J;  1PC5 A;  2J0X A;  4NYP A;  3DRY A;  4WIQ A;  3V6J A;  1BGX T;  2WAQ D;  1KON A;  3US5 A;  2XMW A;  4JOU A;  4NX9 A;  4OYO A;  5LMN J;  1WG1 A;  3QIP B;  2IRU A;  1TU0 B;  3LAL A;  3OFG A;  3CWJ A;  4PPZ A;  3Q86 A;  4C2M A;  2NPI A;  1XNR F;  1FNM A;  1N88 A;  2R7X A;  4JI4 F;  1FKP A;  1U09 A;  3AD9 C;  2JC1 A;  3LUY A;  5J2Q A;  4PUO B;  1WDD A;  1SKW A;  4AL5 A;  3L9Z A;  5KG2 A;  1MRO A;  2HRT A;  3CED A;  3TZZ A;  2HBZ B;  1IR1 A;  5KFJ A;  2R7U A;  4WFA Q;  3MEC B;  4F3M A;  1NHV A;  1CQM A;  1N0U A;  1YG0 A;  2P2C B;  4ANC A;  4B3S F;  4B08 A;  2C2E A;  4PQA A;  4YR3 A;  2AEF A;  2FB0 A;  5HO4 A;  3C14 A;  3QZ8 A;  2ZWP A;  1FRX A;  4C8K A;  3J7Y I;  4ILM A;  2DRB A;  2BQR A;  2XHW A;  4HTJ A;  4Q0B A;  1S97 A;  1WC1 A;  1W2I A;  2EK1 A;  2VFS A;  4P2X A;  2BM1 A;  2LQ5 A;  5EWE A;  2YNG B;  1CC7 A;  2FJA B;  2I9S A;  2J0W A;  2QLX A;  4DR3 F;  4IH7 A;  4ZHR A;  1JKH A;  1WC5 A;  3GJS B;  1MRO B;  2N3L A;  4NZ0 A;  4WBF A;  4Y2I A;  4JI5 F;  2KRR A;  4Y6I A;  3V5R A;  4YR2 A;  4PUO A;  1NPK A;  5GAH U;  1AXQ A;  1LEO A;  3SMZ A;  2YH0 A;  1PCA A;  2IC3 B;  4LRB A;  1XBW A;  3UDL A;  4LIR A;  1RSC A;  4R0E A;  1QAY A;  3KDO A;  3HK2 A;  2IA0 A;  2WZ1 A;  1R0A A;  4WZQ A;  2XYG B;  1W25 A;  4DR6 F;  3N6L A;  2V63 A;  4RNF A;  4IG3 B;  4HEA 9;  4P2S A;  3V6D B;  4IFY B;  2DO4 A;  3N4W A;  1LW0 A;  2Z2Y B;  2NRE A;  2OFH X;  5ETS A;  3ITH A;  4LF6 J;  2VPW B;  2MZJ A;  2GA7 A;  4OYX A;  2HIQ A;  1C2P A;  2VG5 B;  2XMM A;  4E8U A;  1VQO S;  2QL9 B;  2Z2L A;  3GV7 B;  4DLE A;  2DR5 A;  2EC2 A;  4K50 A;  1XR6 A;  3C8Y A;  4HH0 A;  2ZBI A;  4OHX A;  3S8S A;  1O8B A;  2BJ9 A;  2W9C B;  1A9N B;  1S5Z A;  1VYA A;  2HAF A;  4ECS A;  1TKZ A;  4ZDN A;  2RRA A;  2PE8 A;  1O5J A;  4KPY A;  2NLW A;  3NS7 B;  4C3K A;  1LKZ A;  3MMA B;  5AXN A;  1HKA A;  2HGN A;  2AZ3 A;  1WKL A;  1VQY A;  1RKI A;  2DNO A;  1UMJ A;  3RJM B;  8AT1 B;  1B0P A;  3KLF A;  3FDS A;  3RTV A;  1N33 F;  2JC0 A;  3M2R A;  2AJ2 A;  4LSL B;  1M5S A;  5AXL A;  1FJG F;  2OIH A;  4KHR A;  2XCP A;  3BKU A;  1JLB B;  4NLG A;  5IC4 B;  3CXC R;  1VK3 A;  4DL3 A;  2FVP A;  3FMB A;  1YIJ S;  4KGX B;  3IN5 A;  1WDT A;  3KG4 A;  1ZA1 B;  2D9P A;  4KFB A;  5D3G B;  5E2Q A;  5KFG A;  3MAA B;  1BE4 A;  5FJ4 A;  1K1S A;  3UO0 A;  1AB8 A;  2P8I A;  5L1K A;  3M8P A;  3DLB A;  2VG5 A;  4DU8 A;  2EFG A;  2Q79 A;  2V4J A;  3SQG A;  3P3D A;  4IR1 A;  5HQM A;  1IWG A;  2VFU A;  2QL7 B;  2XSJ B;  3EIC A;  4I2P A;  1SL2 A;  2RVJ A;  2HW3 A;  2GVZ A;  1TP7 A;  5EN1 A;  1IN0 A;  2IVF B;  2RHS B;  3U27 A;  3CO9 A;  2PT0 A;  3MM7 A;  2QFJ A;  4CLU A;  3ICL A;  3P45 B;  1HQ2 A;  3W2V A;  1S72 S;  2QC3 A;  4DUT A;  4H4O B;  4FYX B;  3I9Z A;  4MKA A;  2NS1 B;  3D1Q A;  3R7N B;  1EP4 A;  2BRK A;  1DHM A;  1YX2 A;  2XMK A;  3R5J B;  2YWH A;  3RZA A;  1RLD A;  5HMZ A;  1MSW D;  1U7L A;  1PJ6 A;  4HKQ A;  2LA4 A;  2OSR A;  3FQK A;  5KG7 A;  2XBP A;  3A3O B;  4OX8 A;  3Q8R B;  4DQI A;  4DR7 F;  2BW7 A;  1NO8 A;  2FJB B;  3CJ0 A;  4AQY J;  5A0Y B;  3M2V A;  4K5R A;  3PIO Q;  4V1A k;  4YS2 A;  4UW2 A;  3MUT P;  2LU2 A;  2CPJ A;  1U1P A;  4C8L A;  4OZ3 A;  2JFK A;  4C8O A;  2NSB A;  3H7H B;  1RTI B;  5T7L B;  1N56 A;  4XO0 A;  1HD0 A;  4IUF A;  1WNE A;  3QJL A;  4K4Z A;  2RQC A;  3JQJ A;  1S0N A;  4RKU C;  4DU7 A;  5ETP A;  4ER8 A;  1S6P A;  1T02 A;  5B0C A;  2CQB A;  1FDB A;  1LNQ A;  3VVU A;  1RWN B;  2DJW A;  8ATC B;  2W9B B;  4PG7 A;  1EKS A;  1HYS B;  2C3P A;  1RT4 B;  4AFF A;  5KT3 A;  1NJY A;  4LRA A;  3G96 A;  5J2Q B;  1B64 A;  2RU3 A;  4GVL A;  2AYM A;  1RJJ A;  3NRB A;  2E1C A;  4KAI A;  2BJD A;  2KT3 A;  4ZN1 A;  5CQG A;  2DGS A;  4NAS A;  4PPD A;  3OTD A;  7FD1 A;  3UCZ P;  4DCP B;  2IC3 A;  5IQ6 A;  3HZE A;  2B9X A;  5EHH A;  4CNZ A;  4UUW A;  4LFB F;  3MR7 A;  1IUJ A;  3JXO A;  2H4W B;  3PTW A;  4WFX A;  1HWL A;  1X5O A;  3UW1 A;  3W8P A;  4DMZ A;  2HFZ A;  3CJ8 A;  2HFN A;  3L7O A;  4FYW B;  4DL5 A;  4HYK A;  3KK2 B;  1D9A A;  2Z57 B;  4ZVU B;  2W2Q P;  3IC1 A;  4KHM A;  2YWK A;  3DLE A;  4I4B A;  3WIU A;  1SC1 B;  5K8M A;  3CUN A;  2KFN A;  5K14 A;  1DRZ A;  4DV5 J;  4MTP A;  2R7V A;  4Q0B B;  4WFB Q;  4Y0F A;  4OYP A;  4WP8 A;  3LP0 B;  4MIW A;  3UDC A;  2AKW B;  2ZVS A;  2AW0 A;  1TUW A;  1REV B;  1Y5I B;  4LQ3 A;  1X5T A;  3E3X A;  4DV7 F;  3PFO A;  4FPI A;  1BQM B;  1HMV B;  2LQJ A;  5BYS A;  1FT8 A;  1BWE A;  2AGO A;  3O3L A;  1PO6 A;  4CM0 A;  4FF2 A;  3WX8 A;  2BJ3 A;  2CAD A;  3HKZ D;  4PXE A;  4TKT A;  2MLX A;  4LVO P;  4ZLP A;  2RHQ B;  2UUT A;  3BPD A;  5M2R A;  4DR5 F;  4AT1 B;  3KHG A;  3FFI A;  3R6L B;  1HQU B;  1RXO B;  5F8N A;  1WF1 A;  4QIW D;  4X62 J;  3PR5 B;  2UV8 G;  4TYA A;  1IQT A;  3OV7 A;  4BC7 A;  1F6T A;  4O44 A;  5CYM A;  3IP0 A;  2FY8 A;  2GHW A;  3DKD A;  3MPW A;  4I7F B;  2UUB J;  3CO0 P;  5KFT A;  3S01 A;  4P74 A;  4M5G A;  3QRR A;  1Q5Y A;  2K3I A;  2ZWO A;  4DV3 F;  3WIV A;  1FER A;  4DF4 A;  2C2D A;  4NI2 A;  2XMV A;  4LRF A;  2HK3 A;  3RG6 A;  3FEY B;  2B3T B;  5LOQ A;  1ROF A;  3OXF A;  3Q89 A;  5C42 B;  5DG9 A;  1RHR B;  1Z1Z A;  1UVJ A;  2ZBR A;  1NSK L;  4JI7 F;  4DR6 J;  4NLO A;  2OPP A;  5J1E A;  2OPQ B;  4C11 A;  1VMB A;  4EBC A;  1WSR A;  3FEZ A;  2FJX A;  2XQC A;  1TUG B;  3HVW A;  3RB0 A;  4B3T J;  2FUG 9;  1H72 C;  2L08 A;  2MKI A;  1IBL F;  4NA1 A;  1RTD B;  2RIJ A;  2NUH A;  4DV3 J;  1I5O B;  3POT A;  4ED8 A;  2KG1 A;  3EGZ A;  5KAK A;  3C6T A;  5AE3 A;  3AHP A;  1X9S A;  4BCA A;  4QU6 A;  5ADZ A;  3MEG B;  3QFH A;  4RL1 A;  3V6K A;  3GCX P;  2XEX A;  1Z4U A;  2GQQ A;  3UCG A;  2L48 A;  4B3O A;  3HVA A;  3S6E A;  1S1V A;  2VFT A;  4AL7 A;  4HDH A;  5E3R A;  4EWT A;  3CCS S;  2HWI A;  2RQM A;  3TR5 A;  4U9R A;  4JI1 F;  1OY8 A;  2GZO A;  3QT7 A;  3AJ1 A;  1NB7 A;  3EZU A;  1PIL A;  2D3U A;  3BS9 A;  3H5U A;  3DOL A;  1YRX A;  3K89 A;  3GB0 A;  2YQ1 A;  3MM5 A;  4G1Q A;  4J7C A;  3THV A;  1N5V A;  3DOK B;  3GYX B;  2FPH X;  3FGV A;  3RBZ A;  3NBP A;  4HDG A;  3D3B J;  4WCE Q;  1JLE B;  4LF2 A;  5F41 A;  1U1L A;  1N4L A;  3KUH A;  2ZBQ A;  1FF2 A;  2NCK L;  1TKT B;  1TAQ A;  3PW2 A;  4OV1 A;  1UVL A;  1AA1 B;  3AOC A;  3C16 A;  4EI2 A;  4PWD B;  2UXB F;  4JI1 J;  4CLZ A;  3HDS A;  1ITP A;  1RQ0 A;  3T9Z A;  1C0U B;  3ET6 B;  1TVR A;  2XY6 A;  1R43 A;  1WI6 A;  1JXV A;  5E5N A;  4PR6 A;  4R8U B;  1RTD A;  4PRF A;  4QU7 A;  3MWB A;  3KLI B;  3VAJ A;  3WC0 A;  1SJQ A;  4DFJ A;  1S12 A;  3OQ2 A;  3FMW A;  1KD1 T;  1AUD A;  3CMA S;  2UXC J;  1WF0 A;  4HVZ A;  1RUS A;  4RWX A;  4HR2 A;  4ES3 A;  1TL1 A;  2ZE2 B;  3NCQ A;  5T14 A;  2A18 A;  4DV1 F;  3OVS A;  2HFV A;  1JLA B;  3D7S B;  1KHV A;  4KB7 A;  5I4M A;  1IBL J;  2FJV A;  2RF2 A;  3GFZ A;  4ZJL A;  4B02 A;  3GQC A;  4MIB A;  2VD3 A;  3H98 A;  5DRK A;  5KG6 A;  2KDO A;  4AXJ A;  4EBE A;  2QL5 B;  1VQ5 S;  4NXN F;  4KHP F;  1T9U A;  4OYB A;  1S0M A;  3R3T A;  3NGS A;  4N47 A;  4A8Y A;  2ZIT A;  1VQ8 S;  4N5S A;  5CZV A;  1SH3 A;  3PX0 A;  3HSG A;  1FKO B;  3KJF B;  1NJI T;  2AD9 A;  1OY6 A;  3M6V A;  4EYI B;  2ERR A;  4ZVG A;  2R7S A;  5BYQ A;  1SKU B;  3CC4 S;  3J7A 1;  1RHK B;  3DLJ A;  4K8R A;  4DR1 F;  2V69 A;  1S1V B;  3MD3 A;  3PV8 A;  4ED0 A;  1SJ3 P;  2FVS A;  5HRO B;  1U1N A;  4PCQ A;  5L39 A;  3MMJ A;  2BE2 B;  3A8K A;  5CXT A;  2BKN A;  4QPT A;  3MD1 A;  3MMB B;  5DZ7 A;  1T95 A;  3H42 A;  1QAI A;  4Q44 A;  2VAS A;  1QUP A;  4TNO A;  3DLE B;  4Y2C A;  2C2O B;  1HWJ A;  4KO0 A;  4NOH A;  1KQS R;  2IM3 A;  2NZ4 A;  1RWP B;  1FWP A;  2OUG A;  1VK8 A;  1ZOT A;  1Q78 A;  2CPD A;  2HWH A;  2LXF A;  2W4C A;  1RA6 A;  1YDL A;  3GG1 A;  4J37 A;  4GC7 A;  5J2P A;  4Q8F A;  2LQ8 A;  4Q2M A;  2BMB A;  1VQN S;  1YRU A;  1UW9 A;  2W2N P;  3QGH A;  5LSR A;  1UWB A;  5LMN F;  4NYO A;  2QEX S;  4D3G A;  3U1M A;  1LWF A;  4J90 A;  5D0E A;  3C16 B;  4I67 A;  1UVM A;  3VTI A;  1FCA A;  2C42 A;  4MK7 A;  3WHI A;  4F36 A;  5HP1 A;  3ZZU A;  1OJ4 A;  4JI0 F;  2J9E A;  3DM2 A;  4J9L A;  4KY3 A;  2DNQ A;  2O5D A;  3BBF A;  2O1P A;  5KFA A;  1CBK A;  3BKT A;  4DCJ B;  1UFK A;  3ISN D;  2HZV A;  4NLY A;  3HSJ A;  5D4L A;  1VQM S;  3MZI A;  3GJT B;  1X7V A;  4MYT A;  2B7C B;  1DTQ B;  1HNW J;  1Q8I A;  3M9O B;  2MZT A;  1SH2 A;  2V68 A;  1JXE A;  3LP2 A;  4IRC A;  5GAG I;  1RWU A;  4ZP9 A;  2BQ3 A;  3BGU A;  1SC6 A;  4HLB A;  5I3P A;  4A8S A;  1AFJ A;  4URQ U;  1KN6 A;  4X66 F;  2DHS A;  2CPX A;  4RNM A;  4PG4 A;  3J81 j;  4HAC B;  3OLA A;  3CCZ A;  3R1H A;  2ROG A;  2VBZ A;  4CO3 A;  5KFQ A;  4B9T A;  3K0J A;  1F1B B;  2C2N A;  1TL1 B;  1RGV A;  4HI2 A;  1VC5 A;  1KTQ A;  4Z7C A;  4YN3 B;  1OQ3 A;  4X4T A;  3H5S A;  5K9F A;  2VUG A;  3LP0 A;  5SZT A;  1M1K T;  3NGK A;  4LF1 A;  4UF4 A;  3MM5 B;  2ZHB A;  5F8G A;  1RWK B;  3WC2 A;  1S4F A;  3CJK A;  3NEK A;  5IOL A;  2BX6 A;  2EFO A;  1EKR A;  2ZOG A;  2M5Y A;  2CG8 A;  4H4O A;  1SQF A;  4U7U K;  4EUV A;  4K2J A;  4YR0 A;  1U1O A;  2ZE2 A;  3O1L A;  4ED4 A;  2XI3 A;  3N0V A;  2ZJR Q;  4N8O A;  2ALZ A;  4GKK J;  4OX7 A;  2BAB A;  1D3W A;  1CJK B;  2DIV A;  2VG7 A;  2DHG A;  5GAG U;  2J6U A;  1RTH A;  3ZTP A;  4I7F A;  4AQY F;  2E5L J;  2XUL A;  1KVK A;  1RAJ A;  4TY8 A;  1H0H B;  1JNZ B;  1TVR B;  2RRN A;  5BR8 J;  2WTF A;  4EYH B;  2JLE A;  4ITS A;  1JMT A;  1BC6 A;  1NDK A;  3Q8V A;  1S6U A;  1S10 A;  3PW4 A;  5I3Q A;  3VQT A;  5F9L A;  1V5I B;  3CJR A;  4EO8 A;  2HS4 A;  3DOM A;  2F1F A;  2Q66 A;  3QSI A;  3OR2 A;  5KFS A;  3NXZ A;  2YNF A;  1V3R A;  1SQE A;  1C0T B;  3JSR A;  1R3N A;  2AT1 B;  4C7Q A;  4LIW A;  1LWX A;  5GAD U;  2IAJ A;  1HIY A;  4CYU A;  3RB4 A;  3T1H J;  1JJC B;  3KKF A;  1P8G A;  2XMJ A;  1CUL A;  1FHT A;  1VLO A;  2KXN B;  4LRE A;  2XZW A;  1Y3J A;  4LT6 A;  3IRW P;  2VQE F;  1JLG A;  5A8R A;  4DQR A;  5C5J A;  2VA3 A;  1JLQ A;  1RT3 B;  1VS3 A;  2BAC A;  3MMC B;  3CIZ A;  1RBL A;  5ETN A;  2ZH5 A;  1M5V C;  2LVW A;  2BKP A;  1NJX A;  1LOU A;  2V34 A;  2Z30 B;  3V4I A;  5F9N A;  3QWU A;  1ZPW X;  2I2Y A;  2GJ2 A;  4MK8 A;  4QIF A;  1S6O A;  2U1A A;  1FDA A;  4WFY A;  3NY0 A;  4DZD A;  5AE1 A;  4M5L A;  4RWW A;  5D77 A;  3C2P A;  2O66 A;  3GR1 A;  1XMO F;  3K58 A;  1YBA A;  1WOR A;  4OYI A;  2XLK A;  3R97 A;  5KFK A;  2VQF J;  2V4Q A;  3QPI A;  4C8M A;  2XB2 D;  3KHL A;  4PAB A;  1VQ7 S;  5JVG Q;  4GKK F;  2WBM A;  2DR7 A;  1HBU B;  5B0G A;  2ZNY A;  2HNZ B;  3TW0 A;  1RAD B;  1BQM A;  1HMV A;  1S99 A;  4MFB B;  4O3R A;  1PJ5 A;  2QE5 A;  4GVB B;  3IR5 B;  1NAQ A;  1FJE B;  4DZ6 A;  5D4P A;  4ECV A;  1RAA B;  4YHH J;  4FXW A;  5G4D A;  3Q83 A;  2R7Q A;  3A3P B;  1Q5V A;  3IBW A;  4I1T A;  3CJ3 A;  4P7T A;  1U2C A;  2HBR B;  1WI8 A;  4CO5 A;  3GJR B;  1Y9O A;  2IIH A;  4N56 A;  3M05 A;  2RE1 A;  3DRR A;  5I3U A;  3OFF A;  1TK0 A;  4ZPT R;  3TA1 A;  1JXL A;  3K8W A;  3RRH A;  2YNG A;  4IR9 A;  3ZZZ A;  3PAC A;  4OX6 A;  4X66 J;  2AV5 A;  1TV6 A;  2VIC A;  2OPR A;  2MQQ A;  2AU0 A;  2BQU A;  3KLV A;  4J9Q A;  4OYZ A;  5ETK A;  3IA0 A;  1X4D A;  4FN5 A;  4FYV B;  4UTG A;  4AUK A;  4NXN J;  1URN A;  1N36 J;  5HSP A;  4KHP J;  2VON A;  3D0H E;  2PDA A;  1Q95 G;  2N3O A;  2HMI B;  1CJU B;  2EXU A;  1UP1 A;  3W2W B;  3HX9 A;  3NGR A;  1I3O B;  2RKI A;  1JK9 B;  3R7B B;  4M8L A;  4BWM A;  4DCO B;  4WWS A;  2Y8W A;  2WVE A;  3QNW B;  5KG4 A;  3IM9 A;  2PFD A;  2N7Y A;  4DJB A;  3BYR A;  2XI2 A;  3GIR A;  1VBX A;  1B3T A;  5IT9 Y;  2JVO A;  2VFR A;  2UV8 A;  3ONQ A;  2ZZM A;  2IRY A;  1R0A B;  2H9Z A;  1SV5 A;  1BXN A;  1Q8B A;  1V5V A;  2GGP B;  4K4V A;  2PEH A;  2RJZ A;  4N8N A;  3TRG A;  4UT4 A;  4A8F A;  3LQV A;  4V19 J;  1SL0 A;  4OI1 A;  2RDJ A;  4V19 X;  2DVI A;  2KB2 A;  1KQK A;  2YKA A;  1NEE A;  2HS0 A;  4RZR A;  4TU9 A;  2RDI A;  5J2N A;  1WC0 A;  2KJV A;  4DV6 J;  5IC6 B;  2XO6 A;  4DUY F;  5JUM A;  1ZTW A;  2DY9 A;  2HHQ A;  4Q2L A;  4IH6 A;  3M32 B;  4RNO A;  4YHH F;  2GVZ B;  2YKQ A;  3RR8 A;  2WRM A;  1XK8 A;  2FQQ B;  5KFE A;  1DJ0 A;  2K06 A;  4I0W A;  4P71 A;  2UUW A;  1X9M A;  4ICL B;  1SH0 A;  4RW6 A;  5FLX U;  5JJB A;  3JSY A;  4UQT A;  3QRQ A;  5H9F K;  2LLZ A;  1HHQ A;  2AEJ A;  3WZ0 A;  1X9W A;  2HBY B;  3CJS A;  1S9G A;  2WHO A;  4F26 A;  1KR4 A;  3G8Q A;  4JI3 F;  4C48 A;  2UZA A;  3P8B B;  3TA0 A;  1G3O A;  1S1T A;  2BYC A;  5LT5 A;  4IO9 Q;  4LF9 F;  1HI1 A;  2BM0 A;  2J6S A;  1UVK A;  2C2M B;  3BSA A;  4ZIW A;  1MN7 A;  5LMU F;  1U1Q A;  2M52 A;  1U2R A;  1B70 B;  1MWQ A;  3AB4 B;  3N01 A;  2FLN A;  1PJ7 A;  2FHJ A;  1OPZ A;  1RIS A;  3D66 A;  5B0D A;  3GFY A;  5ETR A;  1A7G E;  4M5K A;  3W63 A;  1N5Q A;  4A8W A;  1NDP A;  4F25 A;  1C4A A;  3U1N A;  3LO3 A;  5CCL A;  2DY1 A;  1ZZF A;  2XLI A;  1EHW A;  1LFP A;  2DGV A;  2QT7 A;  1X4B A;  2V8P A;  3HVT A;  4FNI A;  1A0O B;  3R8Y A;  3UI3 A;  2YNI B;  1EET B;  3LW5 C;  4HL9 A;  4X4N A;  2F4V J;  4KRW A;  3W5Y A;  5A6P A;  2I8E A;  2W24 A;  1KHW A;  2QMU B;  3CDA A;  1CJV A;  2HZC A;  2R42 A;  3AY0 A;  3ZZO A;  1AZS B;  2R2R A;  1N5Y A;  4OHY A;  3BDE A;  3NGD A;  2HVD A;  2AMC B;  3TUI C;  1DAR A;  2AQ4 A;  2V2Q A;  4F7V A;  3W60 A;  3JSM A;  4ERD A;  5IT9 U;  1Q0N A;  4USM A;  2WON B;  2ZOF A;  3GLJ A;  1X5S A;  1RAH B;  2D69 A;  1KSP A;  3U1L A;  2CAJ A;  2EFQ A;  3P4U B;  3VAM A;  4H4M A;  2FLP A;  3ZO7 A;  5HLF B;  4NLT A;  2ADC A;  1S1T B;  2EW9 A;  4PEO A;  4CP5 A;  3KYL A;  5B09 A;  2BV3 A;  4DDF A;  4WKR A;  2DGT A;  4N77 A;  1Y10 A;  1QY7 A;  5HJY A;  2O67 A;  2IJR A;  2DKO B;  1HBU A;  4NRT A;  4X84 A;  3MR5 A;  1TK5 A;  4EK2 A;  4DF8 A;  4RBU A;  3J80 U;  2KN4 A;  1WG4 A;  2HGM A;  4OHV A;  1SKR A;  4G1I A;  2H48 B;  4M5D B;  3KOA A;  2IDL A;  1CJK A;  1FD8 A;  2XSJ A;  3TVY A;  2XS2 A;  1HBN B;  1FK9 B;  1RP5 A;  4EFA C;  3HFZ B;  2APO A;  1NKE A;  3BYP A;  3M9M B;  3BV8 A;  1KFD A;  3EUN A;  5HQL A;  4IRK A;  2DGQ A;  3C15 A;  3SV4 A;  2Q6C A;  2F65 A;  1YJU A;  1CQN A;  1S7I A;  2CQ1 A;  2XYP B;  2H4Y B;  1UAW A;  3N6M A;  4P6Q A;  2W7P A;  2YQ0 A;  4YB7 A;  5KOW A;  4X64 J;  2I1R A;  1HL6 A;  4O4R A;  2CFX A;  4O3N A;  1KWM A;  1GEH A;  4QR1 A;  3GV8 B;  1RAI B;  1NK0 A;  2HYI B;  4RW9 B;  4LF7 J;  2BJ1 A;  4B3M J;  2OJ3 A;  4LVN P;  5HAT A;  4X65 J;  2QRR A;  2Z56 B;  1NND A;  2MZS A;  2ZBC A;  3MTJ A;  4Y3C A;  3J7Z T;  2ASD A;  1K9M T;  2F5G A;  4I6A A;  3G86 A;  4JBC A;  6AT1 B;  4USU A;  1RT7 A;  3HXM A;  1SQG A;  5KFU A;  1FXL A;  3G6V A;  1GMW A;  3DYA A;  2LEC A;  4DR4 F;  3TA2 A;  2J8A A;  3G6Y A;  2WCX A;  1Q8L A;  1T9V A;  1NZA A;  2Y8Y A;  4B3R F;  1U25 A;  5KFC A;  2BBE A;  2EG1 A;  3SEO A;  3ZTO A;  1HR0 F;  4DPT A;  1U47 A;  3FBF A;  3HHE A;  4C97 A;  5IT4 A;  4PZV A;  3UN2 A;  4E98 A;  4H4K C;  1X0F A;  1XNQ J;  3EGV A;  4K5S A;  2DXE A;  5GME A;  1IR0 A;  4ECT A;  2W8L A;  2DTJ A;  2IDE A;  2CKW A;  2HRY A;  3JTO A; 
#chains in the Genus database with same CATH homology
 2EKN A;  1EKR A;  2OHD A;  4PYD A;  3JQM A;  4PYA A;  3JQK A;  4FDF A;  2EEY A;  2IDE A;  3JQJ A;  1EKS A;  2IIH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...