4FECA

Crystal structure of htt36q3h
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
402
structure length
402
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQQQQQQHQHQHQQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein,Huntingtin
publication title Beta conformation of polyglutamine track revealed by a crystal structure of Huntingtin N-terminal region with insertion of three histidine residues.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Signaling protein
total genus 120
structure length 402
sequence length 402
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4fecA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4fecA02
3S9NC 2D3IA 4C1UA 1GTKA 3CRBA 1SI0A 5AA4A 3VDFA 4JDFA 2XD2A 3O6GA 2NWJA 1CE2A 1N7XA 1Q1KA 4ECFA 2HEUA 4XTCQ 4YB6A 3ONMA 1B52A 1EU8A 4F1VA 2AL4A 3KN3A 4NWDA 4KCCA 4GRKA 3FJMA 1ZU0A 2QRYA 4L17A 4DCYA 4OFJA 3H06B 1MRPA 3TTNA 3UA8A 3P7IA 3TCGA 3MUQA 4IO7A 2I0BA 4HS7A 1QVSA 1NH7A 5AA2B 1LFGA 3FV2A 2G29A 2QMXA 3K1MA 4IO2A 3MC2A 4R9FA 1OLCA 2A5TB 4QFNA 2AL5A 4YMAA 2G93A 1IQ7A 4H1XA 2I3WA 4KR5A 1SW2A 3LSLA 2P0SA 4OXVA 4F31B 3TCFA 2AIXA 4G4PA 2KLFA 1LLSA 4ELOA 3RLFE 3U72A 2DWJA 2Y7KA 1IIWA 1JEVA 4R9GA 4DIGA 1MQIA 2HAUA 3RQTA 1NFTA 3HPIA 5I56A 1FQBA 1II5A 1N76A 2DE4A 4ZS9A 1B5JA 4R74A 3ILTB 4QFLA 2Q2AA 2BJJX 5EHSA 3KZGA 1US4A 1UTHA 3FGSA 3VFJA 1GGGA 2Y7RA 3MP6A 3FJGA 4YKIA 4H0WA 2HZLA 3T9VA 3VV5A 2XXUA 2I4CA 3M3LA 4QSCA 3TUSA 4P0GA 3U93A 3ZSFA 4KYSA 1ATGA 5AA4B 3TQWA 2F97A 3W15C 3FD3A 1UIVA 3SDFA 3QAXA 1O64A 2DWIA 4QFPA 2ZYNA 3PMXA 3TMGA 2F36A 3SERA 3FASA 1URGA 1NNTA 3WAFA 3ODBA 4GL8A 1O7TA 3RY3A 3VVEA 4O3BA 3H7MA 3T22A 4GD5A 3DM0A 1D3KA 1WDNA 1MH4A 3JZJA 4R72A 5FHOA 2XX8A 3K6XA 1A40A 4F3PA 2I6EA 4PFYA 3KN8A 5AE4A 4NF5A 1QJMA 3N94A 1B5IA 2THIA 3MJNA 5BUUA 5KZTA 1M5BA 3OEMA 4LQ5A 3FVKA 1XC1A 4ZEDA 5CMBA 4UACA 2RKMA 3CSBA 2NVUB 1Y3PA 4NF6A 1M5DA 1LSTA 1J1NA 3B6QA 2LAOA 3OENA 1Y9UA 3PV0E 5I56B 2RC7A 3K01A 1ANFA 4HTGA 3RGYA 3OSQA 4JWOA 3PD9A 4MLVA 1UTHB 3QK6A 2HFBA 3EPEA 3FVNA 1MQHA 1HSEA 3H6VA 3MW0A 1MY2A 5KCJA 4N6PA 3E3KA 4H6DA 1XOCA 3IOWA 3DP4A 3C32A 2OLBA 5DT6A 3N6TA 4OFLA 4G8NA 2V3QA 4EXKA 4LA9A 3PPRA 4BDOA 4MF3A 1B0HA 1KWHA 4I1DA 1Q35A 3T9HB 4RPNA 2Q2CA 4JSDA 4GIZA 2GHBA 2V25A 3W9WA 2PBWA 3CR9A 3R7XA 3IX1A 5ISUA 5H8SA 3HHGA 4TLMB 3G3FA 1P1WA 1I69A 2ESNA 4F22A 4GXAA 2DWAA 1ZBMA 1NMUA 4F39A 3FVGA 1PB9A 4RA1A 3MPLA 3N26A 2RCBA 5CMKA 4U23A 4NF5B 2XXQA 4N07A 2O84X 1VSOA 1ELJA 3ZKLA 3UN6A 2QS4A 1MM6A 2H4IA 3K4UA 4C0RA 3OO6A 1LGBC 5CBSA 3VVDA 3K6UA 4NF6B 1YCJA 4H8IA 5M2VA 3MVZA 1D9YA 2X26A 3CFZA 3B6TA 5JK4A 3N5LA 5L9MA 1ZMGA 4QHQA 2ZNUA 3IB1A 3TEPA 2R9JA 3Q29A 4ELPA 3PPOA 5H8QA 5AA1A 3SKPA 1IXIA 4YKJA 4IGTA 1MY4A 3T93B 3U8QA 4OWDA 1H45A 5ICQA 4EQ7A 3GXAA 3BFTA 1POY1 2ANJA 1MDQA 1LAFE 5KCJB 4HCYA 3DP8A 3HN0A 4YB5A 4THIA 5EYFA 1M5CA 1FTLA 4EQBA 5I59A 3JYRA 3VLVA 4PETA 3IOVA 2OCUA 1FW0A 4H5FA 4X9TA 4BDLA 1OVBA 3FVOA 2A5SA 3H6WA 2UYEA 1MXZA 2PX1A 3TKDA 1GVCA 1UQWA 4RK9A 2D21A 4I62A 1IEJA 4OENA 1N04A 3RUMA 2Z8EA 3Q26A 4LATA 4G8MA 1LCTA 4GXSB 1QUKA 3KSXA 2F78A 1Y1MA 3WAEA 1B4HA 3KEIA 3PGFA 4X48A 2QS2A 4R75A 1DPEA 1BIYA 2Y84A 3FJ7A 1N3XA 1FTOA 4OERA 2HCAA 1Y1ZA 2GHAA 2OWSA 3LSXA 5H8HA 4RJZA 3ZS6A 3QSLA 1B58A 1ZJLA 3Q27A 2F5XA 4I9DA 1S9TA 4F2QA 4I8CA 4FEDA 1B3LA 1MY1A 1ZKBA 4GQOA 4U4SA 3KSJA 3C36A 3DLNA 2DE2A 2XXXA 4MH5A 4RXLA 3IL1B 5FHNA 1YPNA 1D9VA 4PP0A 3TPAA 4YMBA 4DLDA 4IGRA 5H8QB 3K00A 4MLQA 5I2KA 2I48A 2XD3A 3O66A 3PMVA 3KN7A 1A55A 1MPDA 2I0CA 3IAZA 3SESA 4Q30B 1N3WA 3RNNA 3TAJA 5JTYA 3MVWA 3VLUA 2QMWA 1OQGA 1LB8A 4JB7A 3I5OA 1B0LA 3CG3A 1HSLA 4JXIA 3G3HA 2E1SA 1A54A 4ZE8A 4M4GA 2DP8A 4ELQA 1BTJA 3TTMA 3FV1A 1PBQA 1R9QA 5CMCA 2PYYA 2V3UA 5I59B 4XKNA 5HPQA 4YZZA 3RTFB 3LSFB 3SEYA 3THIA 1MQGA 3EF7A 2VGQA 3TELA 3PUXE 5F1QA 4Q5TA 4F2OA 3C9HA 4KD5A 3IO6A 4JSOA 4XXUA 4LONB 4QSEA 2FA7A 3USDA 5I57A 4YKPA 1I6AA 2WKYA 2IEEA 4Z0IA 5ITPA 4LUBA 1FQAA 2QSXA 2YJPA 3PPQA 4X1BA 2M8CA 1LBBA 3E13X 1MY3A 2I3VA 5H8HB 1MQJA 1DPPA 4IY5A 5F7VA 3EHSA 4AB5A 1FQEA 3IJXB 4ZEBA 1QUIA 3OO8A 3TZAA 4X1DA 3V8XB 4O3AA 4ND9A 3HV1A 5DYHA 2Z8FA 2DXYA 3PUVE 2P1SA 1B05A 4YU0A 3MQ9A 4ZEKA 1GR2A 3TQLA 5KDTA 5I2KB 3TTKA 2PT1A 4U2RA 3UGWA 3I3VA 3D4CA 3FXUA 4GFRA 5JTYB 4NWCA 4BDQA 3MZBA 2DVZA 5L8DA 1ZTYA 1TFDA 3RTWB 4MBPA 4DXBA 4ESXA 4WKMA 3S9LC 1P1OA 2CZLA 3VE1B 3KOTA 1B6HA 3IK6B 1TXFA 5H8NA 1MS7A 2H5YA 3ILUB 4ELRA 4NF8A 1MXWA 4IO3A 3PUYE 3LC8A 3IORA 4ESWA 1XVXA 3VLWA 2O7UA 1PC3A 4U21A 1B3FA 1US5A 1URSA 2ZXTA 5I84A 1AMFA 5I57B 4H8JA 2H9BA 1Y4TA 4G2ZA 1P1NA 3KG2A 2UVHA 3LBSA 2VOZA 3M3KA 2REJA 4F3BA 2CMOA 3A3UA 1P99A 3BKIB 4FECA 2H99A 4NE4A 3S2VA 2Y7PA 1A8FA 1MM7A 4RK2A 4DE8A 5BWJA 4OQOA 1BKAA 2XX7A 2OWTA 1QULA 1Z7ME 3TFLA 3K0VA 2ZNSA 1N84A 4C1TA 4QSDA 1FCKA 1P1QA 4OTEA 1DTGA 1FTKA 3GBBA 4BLAA 4BDMA 1F9BA 4XKQA 2P2AA 4KYDA 4NTLA 1B4ZA 2F34A 1WVJA 4GOTA 1IXCA 4FJPA 1OIBA 3MAMA 2Q88A 4U1OA 1JVYA 1A99A 3MP8A 4Z7EA 5KDTB 2O6AA 1XHYA 3HSTA 3A09A 2UVJA 4ZZEA 4LVQA 3QYTA 4KI0E 2DYXA 2O1LA 3PUWE 2Z23A 2VHAA 3N6UA 4KFQA 4ZECA 3T9XB 4HCWA 4FE8A 5LOMA 5AA2D 2HAVA 3BBRA 3F11A 3CFXA 4DZ1A 4IB2A 1MH3A 5CC2A 4YKKA 5DVFA 1RYXA 2QS1A 2F6GA 5H8NB 1EZPA 2O69A 2IA4A 3BFUA 3SEWA 3S9MC 1MXXA 1JEUA 4YB7A 2F7BA 4ONYA 3RPWA 2RC8A 2XHDA 1B7UA 1B32A 1B51A 1B46A 4OYVA 3PPPA 1R1NA 4F29A 3GBAA 2Y7IA 3KGCA 2YLNA 4R6YA 5TPAA 3OO7A 5TP9A 2W7YA 5CMMA 3EHUA 4AQ4A 4MFIA 3QUFA 2AYSA 3O6IA 4N13A 3ECRA 3MBPA 3T66A 4JBZA 4KHZE 1VE4A 1LAHE 4IO6A 2VD2A 5FTHA 3CSGA 4WXJA 1MG1A 1BLFA 2GFEA 1USYE 3OELA 1NKXA 2QJEA 3S4UA 2RF1A 2ALUA 1BP5A 4KPTA 4F1YA 2OZZA 3VXCA 2REGA 3O29A 2ONKE 1IUDA 1R6ZA 2HZKA 3G3IA 1H3DA 1MPCA 3AXFA 4OETA 2XX9A 2GRVA 3EQ1A 3SETA 2ZYOA 5IKBA 1I6BA 2Q9TA 3U1OA 3Q25A 4R73A 1MPBA 5K2XA 1LFHA 1B3GA 2F8DA 3K6WA 3HO7A 1SW4A 1QUJA 1PEBA 1QKAA 1JW4A 5FTIA 1JQFA 4LP2B 1IXHA 1LBCA 2R6GE 4ZE9A 2ONRA 3RT8A 4FEBA 2F7CA 3SEUA 1Y3NA 4OEVA 2RC9A 1Z7NE 1N7WA 2D5WA 4GLIA 3C31A 1YAEA 1FQDA 3KFMA 1JW5A 4BDNA 4Q8RA 1OLAA 5TPAB 2ONSA 3UORA 3GLBA 2XXIA 5TP9B 1L5TA 4PQJA 4EUOA 3JV9A 4O3CA 3M8UA 1QW0A 2Y7WA 3KOSA 4JWXA 1AOVA 2GH9A 1GV8A 4H65A 1SD3A 2XXVA 2F35A 3HHFA 4OESA 3KJTA 1T0KA 1VR5A 3L6HA 4G68C 5H8FA 4PFTA 1H76A 4QRZA 4UA8A 4H5GA 4NMYA 3FZVA 4OZ9A 3FXRA 1S7YA 2Z8DA 4HW8A 3O97A 3OOAA 3T96B 4POWA 2YPNA 3FATA 1SQYA 3C4MA 3G3GA 1XS5A 1IZ1A 4R6KA 1M5FA 3IR1A 5CRYA 1RKMA 3E4RA 4GWOA 4LZ7A 1DMBA 2V93A 1JETA 4EXLA 4OHNA 4ZZAA 4E0XA 3FUZA 5DVJA 3GZGA 1FTMA 2I58A 2H25A 4EF1A 1NNKA 4OEUA 4ISUA 4GVOA 3IOUA 1Y3QA 3A3CA 2XXTA 1SW1A 1MXYA 3SEVA 3IB0A 3RN8A 1MXVA 2F6PA 3RT6B 3B6WA 4R2BA 5TU0A 4ZEFA 5A5XA 5L9SA 4FIMA 2ZYMA 4PE5B 4P11A 2ABHA 4DCXA 5I58A 2PVUA 1AIVA 4PFUA 4OFOA 1A8EA 5AA3A 3L6GA 3H6UA 3SEXA 1LB9A 4FAJA 3IB2A 1JNFA 2UYFA 3EHTA 5H8FB 3CFLA 2DVCA 3K6VA 3LUYA 1NL5A 1P1UA 2NXOA 2VP1A 1LCFA 1SYIA 1B9JA 3H03A 2FYIA 3I6VA 4G68A 1Y4CA 1OMPA 3KBRA 4TQUQ 3C33A 1VFEA 5JEIA 4EF2A 2ZNTA 3O6HA 1B1XA 1DTZA 4AB6A 1RYOA 3DP6A 2OBGA 3OEKA 3OXNA 4KQPA 3K2DA 4F1UA 5K2YA 2DS9A 2E0SA 4U22A 2VD3A 4E0WA 2ZYKA 3O9PA 5DVIA 2X7PA 1NH8A 5A5XB 1B40A 4EQ9A 1O63A 3IJOB 2UXAA 2XXYA 3CIJA 5I58B 2X7QA 2I49A 5I2NA 1M5EA 5B70A 1PBPA 1SVXB 3PU5A 4LZ8A 4PFWA 5CM6A 4P0IA 3OMBA 4BDRA 3K1NA 1LAGE 3MWBA 3C34A 3QXMA 3U92A 3MVYA 4XKRA 3V89B 2OK2A 3C35A 5EHMA 4XIGQ 2O51A 4QFKA 1I6QA 4LQ2A 4K3FA 2DXRA 2DOJA 1SDXA 4G68B 5CI5A 3KJ7A 1AH5A 1S50A 4XKPA 1FQFA 4QFOA 2DE3A 1UIUA 3PD8A 3M3FA 5L9OA 2B65A 4Q0CA 1A7LA 4KYEA 1SI1A 3CI8A 3MPKA 3OD7A 3TCHA 2UVGA 1B7ZA 1LAXA 3QIMA 4JWYA 3TDJA 1FTJA 2UVIA 2F7AA 4M1VA 3K02A 4U1ZA 4RNSA 1PB7A 4RY1A 2NOOA 4F3GA 1TFAA 3EN3A 2DWHA 1LFIA 5HBCA 2R71A 2QS3A 3W9VA 4NF8B 3TTRA 3VVFA 4GF8A 3T9UA 2V84A 4IO4A 4FORA 2FNCA 1IITA 5HM4B 4F18A 1FQCA 2Q8JA 5FHMA 1EZOA 4IO5A 4ZDMA 3S9EA 1H44A 5DTBA 1MQDA 5I2NB 1DSNA 2RINA 3O2AA 4U4XA 4DDDA 3E9XA 2NUVA 3DELB 3MP1A 3V83A 4WEPA 2XXPA 2OJTA 1SW5A 1XVYA 3MZ9A 3Q28A 3R6UA 1SBPA 2DSFA 4ZEIA 1UTBA 3TTLA 1WODA 3FXQA 4GL0A 2V3TA 1EH3A 3UK4A 3MVXA 5CBRA 2O68A 1JVXA 5DEXA 1DOTA 1B2HA 1QKBA 3LR1A 1ZIUA 3CVGA 3QUJA 2XXWA 1YTVA 4RYAA 1B5HA 3G3KA 3R26A 3G3JA 1MY0A 4R2FA 3B7DA 4G8HA 3O28A 3H3GA 4DXUA 2B3BA 1ZLQA 2PMSA 2HXWA 4WEDA 3LSWA 2ZMBA 4NEDA 1B3HA 4DXCA 3OO9A 1R9LA 1MDP1 1MXUA 4YICA 1POTA 4TLLB 3VXBA 3ZKKA 4NF4A 4LZ5A 5IAIA 2XXRA 3MZ1A 4YAHX 4KCDA 1B3EA 4FATA 3UIFA 2XXHA 4G77A 4OVJA 3UP9A 4H67A 3G7WA 1EZ9A 3HCQA 2Q89A 3CG1A 4QF9A 1OVTA 1USYH 5AA2A 3PUZE 2PT2A 3V5AA 4IY6A 1Y20A 1NNFA 1NNPA 2A5TA 1H43A 3FIRA 2H98A 4F3SA 1JW1A 2HQ0A 1OQHA 1PDAA 3D4GA 1TT1A 1UTBB 4POXA 3H6TA 2QL3A 2DQVA 4TOZA 4RPOA 1N0TA 5DEXB 5B7DA 5ITOA 1HSJA 1IXGA 3U94A 4F19A 3K1PA 3TYHA 1TWYA 5ICTA 5ELVA 3TODA 1D4NA 1AL3A 1PB8A 3PPNA 1VFDA 4OMBA 5J1DA 2O7IA 3PMWA 1B7HA 2RCAA 3H4ZA 1CB6A 2QPQA 4R6HA 3IO4A 1B1HA 4EDPA 2Z22A 3IOTA 3OSRA 2O1MA 1URDA 2I4BA 1XT8A 1SYHA 4NF4B 2B3FA
chains in the Genus database with same CATH superfamily
4N6KA 3KBZA 3S9NC 2D3IA 4NQ8A 4C1UA 1GTKA 3CRBA 1SI0A 4PGNA 5AA4A 3VDFA 4JDFA 2XD2A 3O6GA 2NWJA 1CE2A 1N7XA 1Q1KA 4ECFA 2HEUA 4XTCQ 4YB6A 3ONMA 1B52A 1EU8A 2QVRA 4F1VA 2AL4A 3KN3A 4NWDA 4AS5A 4KCCA 4N91A 4GRKA 5EYGA 3FJMA 1ZU0A 2QRYA 4L17A 4DCYA 4OFJA 4GWYA 3H06B 1MRPA 3TTNA 3UA8A 1DCUA 3P7IA 3TCGA 3MUQA 4IO7A 4MIJA 2VT5A 2I0BA 4HS7A 1QVSA 1NH7A 5AA2B 3RPLB 2XWVA 1LFGA 3FV2A 2G29A 4NGUA 2QMXA 1LBYA 3K1MA 4IO2A 3MC2A 4R9FA 1OLCA 2A5TB 4AS4A 4QFNA 2AL5A 4P1LA 4YMAA 2G93A 4X04A 4QBAA 1IQ7A 4H1XA 2I3WA 2HXRA 3NOHA 4KR5A 1SW2A 1EYIA 3LSLA 2P0SA 4OXVA 4F31B 3TCFA 2AIXA 2L5VA 4G4PA 2KLFA 1LLSA 4ELOA 3RLFE 3U72A 2DWJA 2Y7KA 1IIWA 1JEVA 4R9GA 4DIGA 1MQIA 2HAUA 3RQTA 1NFTA 3LV0A 3HPIA 5I56A 1G0IA 1FQBA 1II5A 4X8RA 1N76A 2DE4A 4ZS9A 1B5JA 4R74A 3ILTB 4QFLA 2Q2AA 2BJJX 5EHSA 3KZGA 1US4A 1UTHA 3FGSA 3VFJA 1GGGA 2Y7RA 3MP6A 3FJGA 4YKIA 2Y5KA 4H0WA 2HZLA 3T9VA 3VV5A 4I3EA 2XXUA 2I4CA 3M3LA 4QSCA 3TUSA 2QFLA 4P0GA 3U93A 3ZSFA 4KYSA 1ATGA 5AA4B 3TQWA 2F97A 3W15C 3FD3A 1UIVA 3SDFA 3QAXA 1O64A 2DWIA 4QFPA 2ZYNA 3PMXA 3TMGA 2F36A 1FPIA 3SERA 3FASA 3FBPA 1URGA 1FPGA 1NNTA 3WAFA 3ODBA 4GL8A 1O7TA 3RY3A 3VVEA 1FBPA 4O3BA 3H7MA 3T22A 4GD5A 3DM0A 4JVIA 1D3KA 1WDNA 1MH4A 3JZJA 4R72A 5FHOA 2XX8A 3K6XA 1A40A 4F3PA 2I6EA 4PFYA 3KN8A 5AE4A 3GYYA 3B8BA 4NF5A 1QJMA 3N94A 4PF8A 1FJ9A 1B5IA 2HHMA 2THIA 3MJNA 5DW8A 5BUUA 5KZTA 1KZ8A 1M5BA 3OEMA 5J16A 4LQ5A 3FVKA 3KC1A 1XC1A 4ZEDA 5CMBA 4UACA 2RKMA 2XWOA 3CSBA 4NAPA 2NVUB 1Y3PA 4NF6A 1M5DA 1LSTA 1NUZA 1J1NA 3B6QA 2LAOA 3OENA 1Y9UA 3PV0E 3QMFA 5I56B 2RC7A 3K01A 1ANFA 2FHYA 4HTGA 3RGYA 3OSQA 4JWOA 2WX9A 4XF5A 3PD9A 4MLVA 1UTHB 3QK6A 2HFBA 3EPEA 3FVNA 4O8MA 1MQHA 1HSEA 2Q74A 3H6VA 3MW0A 1MY2A 5KCJA 1FBDA 4HE0A 4N6PA 3E3KA 4H6DA 1XOCA 3IOWA 3DP4A 3C32A 2OLBA 5DT6A 3N6TA 4OFLA 4G8NA 2V3QA 4EXKA 4LA9A 3PPRA 4P1EA 4BDOA 4O7MA 4MF3A 1IMBA 1B0HA 1KWHA 4I1DA 1Q35A 3T9HB 4RPNA 1FBEA 2Q2CA 4JSDA 4GIZA 1IMDA 2GHBA 2V25A 3W9WA 1RDZA 2PBWA 3CR9A 3R7XA 3IX1A 5ISUA 5H8SA 3HHGA 4TLMB 3G3FA 4GWSA 1P1WA 1I69A 2ESNA 4PAIA 4F22A 4GXAA 2DWAA 1ZBMA 1NMUA 4F39A 3FVGA 1PB9A 4RA1A 3MPLA 3N26A 2RCBA 5CMKA 4U23A 4NF5B 2XXQA 4N07A 2O84X 1VSOA 4DI4B 1ELJA 3A29A 3ZKLA 3UN6A 2QS4A 1MM6A 2H4IA 3K4UA 4C0RA 3OO6A 4HE1A 1LGBC 5CBSA 3VVDA 3K6UA 4H46A 4NF6B 1YCJA 2ZZXA 4H8IA 5M2VA 3MVZA 1D9YA 2X26A 3CFZA 3B6TA 5JK4A 3N5LA 5L9MA 1FPEA 1ZMGA 4QHQA 2ZNUA 3IB1A 4JVCA 1NV6A 3TEPA 2R9JA 3Q29A 4ELPA 3PPOA 5H8QA 5AA1A 3SKPA 1IXIA 3BIGA 4MNCA 4YKJA 4IGTA 1MY4A 3T93B 2WBDA 3U8QA 4OWDA 1H45A 5ICQA 4MJOA 4EQ7A 3GXAA 3BFTA 1POY1 2ANJA 1MDQA 1LAFE 5KCJB 4HCYA 3DP8A 2XA5A 3HN0A 4GWUA 5IGAA 4YB5A 4THIA 5EYFA 1M5CA 1FTLA 4EQBA 5LTCA 1KA1A 5I59A 3JYRA 3VLVA 4PETA 3IOVA 2OCUA 3HFUA 4FBPA 1FW0A 4H5FA 4NHBA 4X9TA 4N81A 4BDLA 1OVBA 3FVOA 1FJ6A 2A5SA 1IMFA 3H6WA 2UYEA 1MXZA 2PX1A 3TKDA 5F24A 2WEFA 1GVCA 1UQWA 4RK9A 2D21A 4I62A 1IEJA 4OENA 1N04A 3RUMA 2Z8EA 3Q26A 1NUYA 4LATA 4GX4A 4G8MA 1LCTA 4GXSB 1K9ZA 1QUKA 3KSXA 2F78A 1Y1MA 3WAEA 1B4HA 3KEIA 3PGFA 4X48A 2QS2A 1IMCA 4R75A 1DPEA 1BIYA 2Y84A 3FJ7A 1N3XA 1FTOA 4OERA 2HCAA 1Y1ZA 2GHAA 2OWSA 3LSXA 4NG7A 5H8HA 1LBWA 2CEYA 4RJZA 3ZS6A 3QSLA 1B58A 1ZJLA 3Q27A 4PGPA 2F5XA 1NV0A 4I9DA 1S9TA 4F2QA 4I8CA 4FEDA 1B3LA 1MY1A 1ZKBA 4GQOA 4U4SA 3KSJA 3C36A 4OVRA 3DLNA 2DE2A 1G0HA 2JJKA 2XXXA 4MH5A 4RXLA 3IL1B 5FHNA 1FPJA 1YPNA 1D9VA 4PP0A 3TPAA 4YMBA 4DLDA 4IGRA 5H8QB 3K00A 4MLQA 5I2KA 2I48A 2XD3A 3O66A 3PMVA 3KN7A 1A55A 2V4CA 1MPDA 2I0CA 3IAZA 3SESA 4Q30B 1N3WA 3RNNA 3TAJA 5JTYA 3MVWA 3VLUA 2QMWA 1OQGA 1LB8A 4JB7A 3I5OA 1B0LA 3CG3A 3E79A 1HSLA 4JXIA 3G3HA 2E1SA 1A54A 4ZE8A 4M4GA 2DP8A 4ELQA 1BTJA 3TTMA 3FV1A 1PBQA 1R9QA 5CMCA 2PYYA 1FPFA 2V3UA 4PFIA 5I59B 4XKNA 5HPQA 4YZZA 3RTFB 3LSFB 3SEYA 3THIA 1MQGA 4HXVA 3EF7A 2VGQA 3TELA 3PUXE 4PTKA 5F1QA 4Q5TA 1FBGA 4F2OA 3U65A 3C9HA 4KD5A 3IO6A 4JSOA 4XXUA 2DDKA 4LONB 4QSEA 2FA7A 3USDA 5I57A 4YKPA 1I6AA 2WKYA 2QVUA 2IEEA 4Z0IA 2F3DA 5ITPA 4LUBA 1FQAA 2QSXA 2YJPA 3PPQA 4X1BA 2M8CA 1LBBA 3E13X 2KR0A 1MY3A 2I3VA 5H8HB 1MQJA 1DPPA 1LBXA 4IY5A 5F7VA 1FPDA 3EHSA 4O94A 5ESYA 4AB5A 1FQEA 3IJXB 4ZEBA 1QUIA 3OO8A 4P3LA 3TZAA 4X1DA 3V8XB 4O3AA 4ND9A 3HV1A 5DYHA 2Z8FA 2DXYA 3PUVE 4HE2A 2P1SA 1B05A 4YU0A 3MQ9A 4ZEKA 1GR2A 3TQLA 5KDTA 4GX3A 5IZ3A 5I2KB 3TTKA 2PT1A 4U2RA 3UGWA 4PCDA 3I3VA 3D4CA 3FXUA 5EYHA 4GFRA 5JTYB 5FBPA 4NWCA 4BDQA 2GQ1A 3MZBA 2DVZA 5L8DA 1NUXA 1ZTYA 1TFDA 4OVQA 3RTWB 4MBPA 4DXBA 4ESXA 4UABA 4WKMA 3S9LC 1P1OA 2R8TA 2CZLA 3VE1B 3KOTA 1LBZA 1B6HA 3IK6B 1TXFA 5H8NA 1MS7A 1KA0A 2H5YA 3MYUA 3ILUB 4ELRA 3EKIA 4NF8A 1MXWA 4IO3A 3PUYE 3LC8A 4P9KA 3IORA 4ESWA 1XVXA 3VLWA 2O7UA 1PC3A 4U21A 1B3FA 1US5A 1URSA 2ZXTA 5I84A 1AMFA 5I57B 4H8JA 2H9BA 1Y4TA 4G2ZA 4N8GA 1P1NA 3KG2A 3E78A 2UVHA 3LBSA 2VOZA 3M3KA 2REJA 4F3BA 2CMOA 3A3UA 1NUWA 4XEQA 1P99A 2XWKA 3BKIB 4FECA 5LDZA 2H99A 4NE4A 3S2VA 2Y7PA 1A8FA 1MM7A 4RK2A 4DE8A 5BWJA 4OQOA 3ROJA 1BKAA 2XX7A 2OWTA 1QULA 1Z7ME 1FSAA 3TFLA 3K0VA 2ZNSA 1N84A 2PFYA 4C1TA 4QSDA 4PBHA 1FCKA 1P1QA 4OTEA 1DTGA 1FTKA 3GBBA 4BLAA 1YYZA 4BDMA 1F9BA 4XKQA 2P2AA 4KYDA 4NTLA 1B4ZA 2F34A 1WVJA 4GOTA 1IXCA 4FJPA 1OIBA 3MAMA 5A5LA 2Q88A 2XXKA 4U1OA 1JVYA 1A99A 4NN3A 3MP8A 4Z7EA 5KDTB 4GWXA 5IZ3B 4OA4A 1D9QA 2O6AA 4O7IA 1XHYA 3HSTA 3A09A 3D1RA 2UVJA 4ZZEA 4LVQA 3QYTA 4KI0E 2DYXA 2O1LA 3PUWE 2Z23A 4G61A 2VHAA 3N6UA 4KFQA 4ZECA 3T9XB 4HCWA 4FE8A 4PDDA 5LOMA 5AA2D 2HAVA 3BBRA 3F11A 3CFXA 4DZ1A 2WYPA 4IB2A 1MH3A 5CC2A 4NX1A 4YKKA 5T3JA 5DVFA 1RYXA 2QS1A 2F6GA 5H8NB 1EZPA 2O69A 2IA4A 3BFUA 3SEWA 1K9YA 3S9MC 1MXXA 1JEUA 4QXDA 4YB7A 2F7BA 4ONYA 3RPWA 2RC8A 2XHDA 1B7UA 1B32A 1B51A 1B46A 4OYVA 3PPPA 1R1NA 4F29A 3GBAA 2Y7IA 3KGCA 2YLNA 4R6YA 5TPAA 3OO7A 5TP9A 2W7YA 5CMMA 3EHUA 4AQ4A 4MNIA 4MFIA 3QUFA 2AYSA 3O6IA 4N13A 3ECRA 1SPIA 3MBPA 3T66A 4I3YA 4JBZA 2VPNA 4KHZE 1VE4A 1LAHE 1NV7A 4IO6A 2VD2A 5FTHA 3CSGA 1CNQA 4WXJA 1INPA 1MG1A 1BLFA 2GFEA 1USYE 3OELA 1NKXA 2QJEA 2P3NA 1FBCA 3S4UA 2RF1A 2ALUA 1BP5A 4KPTA 4F1YA 2OZZA 3VXCA 2REGA 3O29A 2ONKE 1IUDA 1R6ZA 1LBVA 2HZKA 2PFZA 3G3IA 1H3DA 1MPCA 3AXFA 4OETA 5EQ7A 2XX9A 2GRVA 4GBWA 3EQ1A 3SETA 2ZYOA 5IKBA 2FBPA 1I6BA 2Q9TA 1IMAA 3U1OA 3Q25A 2MKZA 4NF0A 4R73A 1MPBA 5K2XA 1LFHA 5I7IA 2VPOA 1B3GA 2F8DA 3K6WA 3HO7A 2BJIA 1SW4A 1QUJA 1PEBA 1QKAA 1JW4A 5FTIA 1JQFA 4LP2B 4LN5A 1IXHA 1LBCA 2R6GE 4ZE9A 2ONRA 3RT8A 4FEBA 2F7CA 3SEUA 1Y3NA 4OEVA 2RC9A 1Z7NE 1N7WA 4KXPA 2D5WA 4GLIA 3C31A 1YAEA 1FPKA 1FQDA 4H45A 3KFMA 1JW5A 4BDNA 4Q8RA 1OLAA 5TPAB 2ONSA 3UORA 3GLBA 2XXIA 5TP9B 1L5TA 4PQJA 4EUOA 3JV9A 4OVSA 4O3CA 3M8UA 2B4LA 1NV5A 1QW0A 2Y7WA 3KOSA 4JWXA 1NV1A 1AOVA 2GH9A 1GV8A 3BIHA 4H65A 1SD3A 2XXVA 2F35A 3HHFA 4OESA 3KJTA 1T0KA 1VR5A 3L6HA 2P3VA 4G68C 4PFTA 5H8FA 1H76A 4QRZA 4UA8A 4H5GA 4N6DA 4NMYA 3FZVA 4OZ9A 3FXRA 1S7YA 2Z8DA 2Q8MA 4HW8A 3O97A 3OOAA 3T96B 4POWA 2YPNA 3FATA 1SQYA 3C4MA 3FXBA 2ZZWA 3G3GA 1XS5A 1IZ1A 4R6KA 1M5FA 5IZZA 3IR1A 5CRYA 1RKMA 3E4RA 4GWOA 4LZ7A 1DMBA 2OX3A 1FPBA 2V93A 4N17A 1JETA 1NV2A 4EXLA 4OHNA 4ZZAA 4E0XA 3FUZA 5DVJA 3GZGA 1FTMA 2I58A 2H25A 4EF1A 1NNKA 4OEUA 4N15A 4ISUA 4GVOA 2F3BA 2WYKA 3IOUA 1EYJA 1Y3QA 3A3CA 2XXTA 1IMEA 1SW1A 1MXYA 3SEVA 3IB0A 3RN8A 2KQZA 4OVTA 1MXVA 2F6PA 1JP4A 3RT6B 1FRPA 2FIEA 3B6WA 4R2BA 2B4MA 5TU0A 4ZEFA 5A5XA 5L9SA 2XWIA 4IR8A 5ET6A 4FIMA 3SZPA 2ZYMA 4PE5B 4P11A 2ABHA 4DCXA 5I58A 4MHFA 2PVUA 1AIVA 4PAKA 4N8YA 5ET5A 4PFUA 4OFOA 1A8EA 5AA3A 3L6GA 3H6UA 3SEXA 1LB9A 4PFBA 4FAJA 3IB2A 1JNFA 2UYFA 3EHTA 5H8FB 3CFLA 2DVCA 3K6VA 3IFAA 3LUYA 1NL5A 4MEVA 1P1UA 2NXOA 2VP1A 2Y5LA 1LCFA 1SYIA 1B9JA 3H03A 2FYIA 1XI6A 3I6VA 4G68A 1Y4CA 2CZHA 1OMPA 3KBRA 4TQUQ 3C33A 1VFEA 5JEIA 1NV4A 4EF2A 2ZNTA 3O6HA 1AWBA 1B1XA 1DTZA 3IFCA 4AB6A 2QVVA 1RYOA 1RDYA 3DP6A 2OBGA 3OEKA 5ET8A 3OXNA 4KQPA 3K2DA 4F1UA 4OANA 5K2YA 3B50A 2DS9A 2E0SA 4U22A 2VD3A 5EQ9A 4E0WA 2CZKA 3ISPA 2ZYKA 3O9PA 5DVIA 5IZ1A 2X7PA 3PTYA 1NH8A 5A5XB 1B40A 5EQ8A 4EQ9A 1O63A 3IJOB 2UXAA 2XXYA 3CIJA 5I58B 2X7QA 2I49A 5I2NA 1M5EA 5B70A 1PBPA 1SVXB 3PU5A 4LZ8A 4PFWA 5CM6A 4P0IA 3OMBA 4BDRA 4PDHA 3K1NA 1LAGE 3MWBA 3C34A 3QXMA 5I3SA 3U92A 3MVYA 4XKRA 3V89B 4DI3D 5ET7A 2OK2A 4P8BA 3C35A 4PF6A 5EQAA 5EHMA 4XIGQ 2O51A 4MAGA 4QFKA 1I6QA 4LQ2A 4K3FA 2DXRA 2DOJA 1SDXA 4G68B 5CI5A 3KJ7A 1AH5A 1S50A 3RYDA 4XKPA 1FQFA 4QFOA 2DE3A 1UIUA 3PD8A 3M3FA 5L9OA 2B65A 4Q0CA 1A7LA 2HPGA 4KYEA 1SI1A 3CI8A 3MPKA 3OD7A 3TCHA 2UVGA 1B7ZA 1LAXA 3QIMA 4JWYA 3TDJA 2PCRA 1FTJA 4U1ZA 2UVIA 2F7AA 3K02A 4M1VA 4RNSA 1PB7A 4RY1A 2NOOA 4F3GA 1TFAA 3EN3A 4PFRA 4MX6A 2DWHA 1LFIA 3T1BA 5HBCA 4MMPA 1FTAA 2R71A 2QS3A 3W9VA 4NF8B 3KC0A 3TTRA 3VVFA 4GF8A 3T9UA 2V84A 4IO4A 4FORA 2FNCA 1IITA 5HM4B 4F18A 1FQCA 2Q8JA 5FHMA 1EZOA 4IO5A 1NV3A 4ZDMA 3S9EA 1H44A 5DTBA 1MQDA 5I2NB 1DSNA 2RINA 3O2AA 4U4XA 4DDDA 3E9XA 2NUVA 3DELB 3MP1A 4PBQA 3V83A 4WEPA 2XXPA 1FBHA 2FIXA 4MNPA 2OJTA 3LUZA 1SW5A 1XVYA 3MZ9A 3Q28A 3R6UA 1QGXA 1SBPA 2DSFA 4ZEIA 1UTBA 3TTLA 1WODA 3FXQA 4GL0A 2V3TA 1YXIA 1EH3A 3UK4A 3MVXA 5CBRA 2O68A 1JVXA 5DEXA 1DOTA 2WBBA 1B2HA 1QKBA 3T0JA 4XFEA 3LR1A 1ZIUA 3CVGA 3QUJA 2XXWA 1YTVA 4GWZA 4RYAA 1B5HA 3G3KA 3R26A 3G3JA 4PAFA 1MY0A 4R2FA 3B7DA 4G8HA 3O28A 3H3GA 4DXUA 1FPLA 2B3BA 1ZLQA 2PMSA 2HXWA 4WEDA 3LSWA 2ZMBA 4NEDA 1B3HA 4DXCA 3OO9A 4PE3A 1R9LA 1MDP1 1MXUA 4YICA 1POTA 5IM2A 2OWZA 4TLLB 3VXBA 3ZKKA 4NF4A 4LZ5A 5IAIA 2XXRA 1VDWA 2ZZVA 3MZ1A 4YAHX 4KCDA 1BK4A 1B3EA 4FATA 5I5PA 3UIFA 4MCOA 2XXHA 4G77A 4OVJA 3UP9A 4H67A 3G7WA 1LEVA 1EZ9A 3HCQA 2Q89A 3CG1A 4QF9A 1OVTA 1FBFA 1USYH 5AA2A 3PUZE 3RPLA 2PT2A 3V5AA 4IY6A 1Y20A 1NNFA 1NNPA 2A5TA 1H43A 3FIRA 1EYKA 1NI9A 2H98A 4P56A 4F3SA 1JW1A 2HQ0A 1OQHA 1PDAA 4JVDA 1YZ0A 3D4GA 1TT1A 1UTBB 4POXA 3H6TA 2QL3A 4N4UA 2DQVA 4TOZA 4RPOA 4P47A 1N0TA 4GWWA 5DEXB 1RDXA 5B7DA 5ITOA 1HSJA 1IXGA 4GBVA 3U94A 4F19A 3K1PA 4GX6A 3TYHA 1TWYA 5ICTA 5ELVA 3TODA 1D4NA 1AL3A 1PB8A 3PPNA 1VFDA 4OMBA 2CZIA 5J1DA 2FVZA 2O7IA 1DBZA 3PMWA 4PC9A 1B7HA 2RCAA 3H4ZA 1CB6A 2QPQA 3CHGA 1DK4A 4R6HA 3IO4A 1B1HA 4EDPA 2Z22A 3IOTA 3OSRA 1Q9DA 4OVPA 2O1MA 2CEXA 1URDA 2I4BA 4I40A 3MSTA 1XT8A 1SYHA 4NF4B 2B3FA
chains in the Genus database with same CATH topology
3S9NC 2D3IA 4C1UA 1GTKA 3CRBA 1SI0A 5AA4A 3VDFA 4JDFA 2XD2A 3O6GA 2NWJA 1CE2A 1N7XA 1Q1KA 4ECFA 2HEUA 4XTCQ 4YB6A 3ONMA 1B52A 1EU8A 4F1VA 2AL4A 3KN3A 4NWDA 4KCCA 4GRKA 3FJMA 1ZU0A 2QRYA 4L17A 4DCYA 4OFJA 3H06B 1MRPA 3TTNA 3UA8A 3P7IA 3TCGA 3MUQA 4IO7A 2I0BA 4HS7A 1QVSA 1NH7A 5AA2B 1LFGA 3FV2A 2G29A 2QMXA 3K1MA 4IO2A 3MC2A 4R9FA 1OLCA 2A5TB 4QFNA 2AL5A 4YMAA 2G93A 1IQ7A 4H1XA 2I3WA 4KR5A 1SW2A 3LSLA 2P0SA 4OXVA 4F31B 3TCFA 2AIXA 4G4PA 2KLFA 1LLSA 4ELOA 3RLFE 3U72A 2DWJA 2Y7KA 1IIWA 1JEVA 4R9GA 4DIGA 1MQIA 2HAUA 3RQTA 1NFTA 3HPIA 5I56A 1FQBA 1II5A 1N76A 2DE4A 4ZS9A 1B5JA 4R74A 3ILTB 4QFLA 2Q2AA 2BJJX 5EHSA 3KZGA 1US4A 1UTHA 3FGSA 3VFJA 1GGGA 2Y7RA 3MP6A 3FJGA 4YKIA 4H0WA 2HZLA 3T9VA 3VV5A 2XXUA 2I4CA 3M3LA 4QSCA 3TUSA 4P0GA 3U93A 3ZSFA 4KYSA 1ATGA 5AA4B 3TQWA 2F97A 3W15C 3FD3A 1UIVA 3SDFA 3QAXA 1O64A 2DWIA 4QFPA 2ZYNA 3PMXA 3TMGA 2F36A 3SERA 3FASA 1URGA 1NNTA 3WAFA 3ODBA 4GL8A 1O7TA 3RY3A 3VVEA 4O3BA 3H7MA 3T22A 4GD5A 3DM0A 1D3KA 1WDNA 1MH4A 3JZJA 4R72A 5FHOA 2XX8A 3K6XA 1A40A 4F3PA 2I6EA 4PFYA 3KN8A 5AE4A 4NF5A 1QJMA 3N94A 1B5IA 2THIA 3MJNA 5BUUA 5KZTA 1M5BA 3OEMA 4LQ5A 3FVKA 1XC1A 4ZEDA 5CMBA 4UACA 2RKMA 3CSBA 2NVUB 1Y3PA 4NF6A 1M5DA 1LSTA 1J1NA 3B6QA 2LAOA 3OENA 1Y9UA 3PV0E 5I56B 2RC7A 3K01A 1ANFA 4HTGA 3RGYA 3OSQA 4JWOA 3PD9A 4MLVA 1UTHB 3QK6A 2HFBA 3EPEA 3FVNA 1MQHA 1HSEA 3H6VA 3MW0A 1MY2A 5KCJA 4N6PA 3E3KA 4H6DA 1XOCA 3IOWA 3DP4A 3C32A 2OLBA 5DT6A 3N6TA 4OFLA 4G8NA 2V3QA 4EXKA 4LA9A 3PPRA 4BDOA 4MF3A 1B0HA 1KWHA 4I1DA 1Q35A 3T9HB 4RPNA 2Q2CA 4JSDA 4GIZA 2GHBA 2V25A 3W9WA 2PBWA 3CR9A 3R7XA 3IX1A 5ISUA 5H8SA 3HHGA 4TLMB 3G3FA 1P1WA 1I69A 2ESNA 4F22A 4GXAA 2DWAA 1ZBMA 1NMUA 4F39A 3FVGA 1PB9A 4RA1A 3MPLA 3N26A 2RCBA 5CMKA 4U23A 4NF5B 2XXQA 4N07A 2O84X 1VSOA 1ELJA 3ZKLA 3UN6A 2QS4A 1MM6A 2H4IA 3K4UA 4C0RA 3OO6A 1LGBC 5CBSA 3VVDA 3K6UA 4NF6B 1YCJA 4H8IA 5M2VA 3MVZA 1D9YA 2X26A 3CFZA 3B6TA 5JK4A 3N5LA 5L9MA 1ZMGA 4QHQA 2ZNUA 3IB1A 3TEPA 2R9JA 3Q29A 4ELPA 3PPOA 5H8QA 5AA1A 3SKPA 1IXIA 4YKJA 4IGTA 1MY4A 3T93B 3U8QA 4OWDA 1H45A 5ICQA 4EQ7A 3GXAA 3BFTA 1POY1 2ANJA 1MDQA 1LAFE 5KCJB 4HCYA 3DP8A 3HN0A 4YB5A 4THIA 5EYFA 1M5CA 1FTLA 4EQBA 5I59A 3JYRA 3VLVA 4PETA 3IOVA 2OCUA 1FW0A 4H5FA 4X9TA 4BDLA 1OVBA 3FVOA 2A5SA 3H6WA 2UYEA 1MXZA 2PX1A 3TKDA 1GVCA 1UQWA 4RK9A 2D21A 4I62A 1IEJA 4OENA 1N04A 3RUMA 2Z8EA 3Q26A 4LATA 4G8MA 1LCTA 4GXSB 1QUKA 3KSXA 2F78A 1Y1MA 3WAEA 1B4HA 3KEIA 3PGFA 4X48A 2QS2A 4R75A 1DPEA 1BIYA 2Y84A 3FJ7A 1N3XA 1FTOA 4OERA 2HCAA 1Y1ZA 2GHAA 2OWSA 3LSXA 5H8HA 4RJZA 3ZS6A 3QSLA 1B58A 1ZJLA 3Q27A 2F5XA 4I9DA 1S9TA 4F2QA 4I8CA 4FEDA 1B3LA 1MY1A 1ZKBA 4GQOA 4U4SA 3KSJA 3C36A 3DLNA 2DE2A 2XXXA 4MH5A 4RXLA 3IL1B 5FHNA 1YPNA 1D9VA 4PP0A 3TPAA 4YMBA 4DLDA 4IGRA 5H8QB 3K00A 4MLQA 5I2KA 2I48A 2XD3A 3O66A 3PMVA 3KN7A 1A55A 1MPDA 2I0CA 3IAZA 3SESA 4Q30B 1N3WA 3RNNA 3TAJA 5JTYA 3MVWA 3VLUA 2QMWA 1OQGA 1LB8A 4JB7A 3I5OA 1B0LA 3CG3A 1HSLA 4JXIA 3G3HA 2E1SA 1A54A 4ZE8A 4M4GA 2DP8A 4ELQA 1BTJA 3TTMA 3FV1A 1PBQA 1R9QA 5CMCA 2PYYA 2V3UA 5I59B 4XKNA 5HPQA 4YZZA 3RTFB 3LSFB 3SEYA 3THIA 1MQGA 3EF7A 2VGQA 3TELA 3PUXE 5F1QA 4Q5TA 4F2OA 3C9HA 4KD5A 3IO6A 4JSOA 4XXUA 4LONB 4QSEA 2FA7A 3USDA 5I57A 4YKPA 1I6AA 2WKYA 2IEEA 4Z0IA 5ITPA 4LUBA 1FQAA 2QSXA 2YJPA 3PPQA 4X1BA 2M8CA 1LBBA 3E13X 1MY3A 2I3VA 5H8HB 1MQJA 1DPPA 4IY5A 5F7VA 3EHSA 4AB5A 1FQEA 3IJXB 4ZEBA 1QUIA 3OO8A 3TZAA 4X1DA 3V8XB 4O3AA 4ND9A 3HV1A 5DYHA 2Z8FA 2DXYA 3PUVE 2P1SA 1B05A 4YU0A 3MQ9A 4ZEKA 1GR2A 3TQLA 5KDTA 5I2KB 3TTKA 2PT1A 4U2RA 3UGWA 3I3VA 3D4CA 3FXUA 4GFRA 5JTYB 4NWCA 4BDQA 3MZBA 2DVZA 5L8DA 1ZTYA 1TFDA 3RTWB 4MBPA 4DXBA 4ESXA 4WKMA 3S9LC 1P1OA 2CZLA 3VE1B 3KOTA 1B6HA 3IK6B 1TXFA 5H8NA 1MS7A 2H5YA 3ILUB 4ELRA 4NF8A 1MXWA 4IO3A 3PUYE 3LC8A 3IORA 4ESWA 1XVXA 3VLWA 2O7UA 1PC3A 4U21A 1B3FA 1US5A 1URSA 2ZXTA 5I84A 1AMFA 5I57B 4H8JA 2H9BA 1Y4TA 4G2ZA 1P1NA 3KG2A 2UVHA 3LBSA 2VOZA 3M3KA 2REJA 4F3BA 2CMOA 3A3UA 1P99A 3BKIB 4FECA 2H99A 4NE4A 3S2VA 2Y7PA 1A8FA 1MM7A 4RK2A 4DE8A 5BWJA 4OQOA 1BKAA 2XX7A 2OWTA 1QULA 1Z7ME 3TFLA 3K0VA 2ZNSA 1N84A 4C1TA 4QSDA 1FCKA 1P1QA 4OTEA 1DTGA 1FTKA 3GBBA 4BLAA 4BDMA 1F9BA 4XKQA 2P2AA 4KYDA 4NTLA 1B4ZA 2F34A 1WVJA 4GOTA 1IXCA 4FJPA 1OIBA 3MAMA 2Q88A 4U1OA 1JVYA 1A99A 3MP8A 4Z7EA 5KDTB 2O6AA 1XHYA 3HSTA 3A09A 2UVJA 4ZZEA 4LVQA 3QYTA 4KI0E 2DYXA 2O1LA 3PUWE 2Z23A 2VHAA 3N6UA 4KFQA 4ZECA 3T9XB 4HCWA 4FE8A 5LOMA 5AA2D 2HAVA 3BBRA 3F11A 3CFXA 4DZ1A 4IB2A 1MH3A 5CC2A 4YKKA 5DVFA 1RYXA 2QS1A 2F6GA 5H8NB 1EZPA 2O69A 2IA4A 3BFUA 3SEWA 3S9MC 1MXXA 1JEUA 4YB7A 2F7BA 4ONYA 3RPWA 2RC8A 2XHDA 1B7UA 1B32A 1B51A 1B46A 4OYVA 3PPPA 1R1NA 4F29A 3GBAA 2Y7IA 3KGCA 2YLNA 4R6YA 5TPAA 3OO7A 5TP9A 2W7YA 5CMMA 3EHUA 4AQ4A 4MFIA 3QUFA 2AYSA 3O6IA 4N13A 3ECRA 3MBPA 3T66A 4JBZA 4KHZE 1VE4A 1LAHE 4IO6A 2VD2A 5FTHA 3CSGA 4WXJA 1MG1A 1BLFA 2GFEA 1USYE 3OELA 1NKXA 2QJEA 3S4UA 2RF1A 2ALUA 1BP5A 4KPTA 4F1YA 2OZZA 3VXCA 2REGA 3O29A 2ONKE 1IUDA 1R6ZA 2HZKA 3G3IA 1H3DA 1MPCA 3AXFA 4OETA 2XX9A 2GRVA 3EQ1A 3SETA 2ZYOA 5IKBA 1I6BA 2Q9TA 3U1OA 3Q25A 4R73A 1MPBA 5K2XA 1LFHA 1B3GA 2F8DA 3K6WA 3HO7A 1SW4A 1QUJA 1PEBA 1QKAA 1JW4A 5FTIA 1JQFA 4LP2B 1IXHA 1LBCA 2R6GE 4ZE9A 2ONRA 3RT8A 4FEBA 2F7CA 3SEUA 1Y3NA 4OEVA 2RC9A 1Z7NE 1N7WA 2D5WA 4GLIA 3C31A 1YAEA 1FQDA 3KFMA 1JW5A 4BDNA 4Q8RA 1OLAA 5TPAB 2ONSA 3UORA 3GLBA 2XXIA 5TP9B 1L5TA 4PQJA 4EUOA 3JV9A 4O3CA 3M8UA 1QW0A 2Y7WA 3KOSA 4JWXA 1AOVA 2GH9A 1GV8A 4H65A 1SD3A 2XXVA 2F35A 3HHFA 4OESA 3KJTA 1T0KA 1VR5A 3L6HA 4G68C 5H8FA 4PFTA 1H76A 4QRZA 4UA8A 4H5GA 4NMYA 3FZVA 4OZ9A 3FXRA 1S7YA 2Z8DA 4HW8A 3O97A 3OOAA 3T96B 4POWA 2YPNA 3FATA 1SQYA 3C4MA 3G3GA 1XS5A 1IZ1A 4R6KA 1M5FA 3IR1A 5CRYA 1RKMA 3E4RA 4GWOA 4LZ7A 1DMBA 2V93A 1JETA 4EXLA 4OHNA 4ZZAA 4E0XA 3FUZA 5DVJA 3GZGA 1FTMA 2I58A 2H25A 4EF1A 1NNKA 4OEUA 4ISUA 4GVOA 3IOUA 1Y3QA 3A3CA 2XXTA 1SW1A 1MXYA 3SEVA 3IB0A 3RN8A 1MXVA 2F6PA 3RT6B 3B6WA 4R2BA 5TU0A 4ZEFA 5A5XA 5L9SA 4FIMA 2ZYMA 4PE5B 4P11A 2ABHA 4DCXA 5I58A 2PVUA 1AIVA 4PFUA 4OFOA 1A8EA 5AA3A 3L6GA 3H6UA 3SEXA 1LB9A 4FAJA 3IB2A 1JNFA 2UYFA 3EHTA 5H8FB 3CFLA 2DVCA 3K6VA 3LUYA 1NL5A 1P1UA 2NXOA 2VP1A 1LCFA 1SYIA 1B9JA 3H03A 2FYIA 3I6VA 4G68A 1Y4CA 1OMPA 3KBRA 4TQUQ 3C33A 1VFEA 5JEIA 4EF2A 2ZNTA 3O6HA 1B1XA 1DTZA 4AB6A 1RYOA 3DP6A 2OBGA 3OEKA 3OXNA 4KQPA 3K2DA 4F1UA 5K2YA 2DS9A 2E0SA 4U22A 2VD3A 4E0WA 2ZYKA 3O9PA 5DVIA 2X7PA 1NH8A 5A5XB 1B40A 4EQ9A 1O63A 3IJOB 2UXAA 2XXYA 3CIJA 5I58B 2X7QA 2I49A 5I2NA 1M5EA 5B70A 1PBPA 1SVXB 3PU5A 4LZ8A 4PFWA 5CM6A 4P0IA 3OMBA 4BDRA 3K1NA 1LAGE 3MWBA 3C34A 3QXMA 3U92A 3MVYA 4XKRA 3V89B 2OK2A 3C35A 5EHMA 4XIGQ 2O51A 4QFKA 1I6QA 4LQ2A 4K3FA 2DXRA 2DOJA 1SDXA 4G68B 5CI5A 3KJ7A 1AH5A 1S50A 4XKPA 1FQFA 4QFOA 2DE3A 1UIUA 3PD8A 3M3FA 5L9OA 2B65A 4Q0CA 1A7LA 4KYEA 1SI1A 3CI8A 3MPKA 3OD7A 3TCHA 2UVGA 1B7ZA 1LAXA 3QIMA 4JWYA 3TDJA 1FTJA 2UVIA 2F7AA 4M1VA 3K02A 4U1ZA 4RNSA 1PB7A 4RY1A 2NOOA 4F3GA 1TFAA 3EN3A 2DWHA 1LFIA 5HBCA 2R71A 2QS3A 3W9VA 4NF8B 3TTRA 3VVFA 4GF8A 3T9UA 2V84A 4IO4A 4FORA 2FNCA 1IITA 5HM4B 4F18A 1FQCA 2Q8JA 5FHMA 1EZOA 4IO5A 4ZDMA 3S9EA 1H44A 5DTBA 1MQDA 5I2NB 1DSNA 2RINA 3O2AA 4U4XA 4DDDA 3E9XA 2NUVA 3DELB 3MP1A 3V83A 4WEPA 2XXPA 2OJTA 1SW5A 1XVYA 3MZ9A 3Q28A 3R6UA 1SBPA 2DSFA 4ZEIA 1UTBA 3TTLA 1WODA 3FXQA 4GL0A 2V3TA 1EH3A 3UK4A 3MVXA 5CBRA 2O68A 1JVXA 5DEXA 1DOTA 1B2HA 1QKBA 3LR1A 1ZIUA 3CVGA 3QUJA 2XXWA 1YTVA 4RYAA 1B5HA 3G3KA 3R26A 3G3JA 1MY0A 4R2FA 3B7DA 4G8HA 3O28A 3H3GA 4DXUA 2B3BA 1ZLQA 2PMSA 2HXWA 4WEDA 3LSWA 2ZMBA 4NEDA 1B3HA 4DXCA 3OO9A 1R9LA 1MDP1 1MXUA 4YICA 1POTA 4TLLB 3VXBA 3ZKKA 4NF4A 4LZ5A 5IAIA 2XXRA 3MZ1A 4YAHX 4KCDA 1B3EA 4FATA 3UIFA 2XXHA 4G77A 4OVJA 3UP9A 4H67A 3G7WA 1EZ9A 3HCQA 2Q89A 3CG1A 4QF9A 1OVTA 1USYH 5AA2A 3PUZE 2PT2A 3V5AA 4IY6A 1Y20A 1NNFA 1NNPA 2A5TA 1H43A 3FIRA 2H98A 4F3SA 1JW1A 2HQ0A 1OQHA 1PDAA 3D4GA 1TT1A 1UTBB 4POXA 3H6TA 2QL3A 2DQVA 4TOZA 4RPOA 1N0TA 5DEXB 5B7DA 5ITOA 1HSJA 1IXGA 3U94A 4F19A 3K1PA 3TYHA 1TWYA 5ICTA 5ELVA 3TODA 1D4NA 1AL3A 1PB8A 3PPNA 1VFDA 4OMBA 5J1DA 2O7IA 3PMWA 1B7HA 2RCAA 3H4ZA 1CB6A 2QPQA 4R6HA 3IO4A 1B1HA 4EDPA 2Z22A 3IOTA 3OSRA 2O1MA 1URDA 2I4BA 1XT8A 1SYHA 4NF4B 2B3FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S9N C;  2D3I A;  4C1U A;  1GTK A;  3CRB A;  1SI0 A;  5AA4 A;  3VDF A;  4JDF A;  2XD2 A;  3O6G A;  2NWJ A;  1CE2 A;  1N7X A;  1Q1K A;  4ECF A;  2HEU A;  4XTC Q;  4YB6 A;  3ONM A;  1B52 A;  1EU8 A;  4F1V A;  2AL4 A;  3KN3 A;  4NWD A;  4KCC A;  4GRK A;  3FJM A;  1ZU0 A;  2QRY A;  4L17 A;  4DCY A;  4OFJ A;  3H06 B;  1MRP A;  3TTN A;  3UA8 A;  3P7I A;  3TCG A;  3MUQ A;  4IO7 A;  2I0B A;  4HS7 A;  1QVS A;  1NH7 A;  5AA2 B;  1LFG A;  3FV2 A;  2G29 A;  2QMX A;  3K1M A;  4IO2 A;  3MC2 A;  4R9F A;  1OLC A;  2A5T B;  4QFN A;  2AL5 A;  4YMA A;  2G93 A;  1IQ7 A;  4H1X A;  2I3W A;  4KR5 A;  1SW2 A;  3LSL A;  2P0S A;  4OXV A;  4F31 B;  3TCF A;  2AIX A;  4G4P A;  2KLF A;  1LLS A;  4ELO A;  3RLF E;  3U72 A;  2DWJ A;  2Y7K A;  1IIW A;  1JEV A;  4R9G A;  4DIG A;  1MQI A;  2HAU A;  3RQT A;  1NFT A;  3HPI A;  5I56 A;  1FQB A;  1II5 A;  1N76 A;  2DE4 A;  4ZS9 A;  1B5J A;  4R74 A;  3ILT B;  4QFL A;  2Q2A A;  2BJJ X;  5EHS A;  3KZG A;  1US4 A;  1UTH A;  3FGS A;  3VFJ A;  1GGG A;  2Y7R A;  3MP6 A;  3FJG A;  4YKI A;  4H0W A;  2HZL A;  3T9V A;  3VV5 A;  2XXU A;  2I4C A;  3M3L A;  4QSC A;  3TUS A;  4P0G A;  3U93 A;  3ZSF A;  4KYS A;  1ATG A;  5AA4 B;  3TQW A;  2F97 A;  3W15 C;  3FD3 A;  1UIV A;  3SDF A;  3QAX A;  1O64 A;  2DWI A;  4QFP A;  2ZYN A;  3PMX A;  3TMG A;  2F36 A;  3SER A;  3FAS A;  1URG A;  1NNT A;  3WAF A;  3ODB A;  4GL8 A;  1O7T A;  3RY3 A;  3VVE A;  4O3B A;  3H7M A;  3T22 A;  4GD5 A;  3DM0 A;  1D3K A;  1WDN A;  1MH4 A;  3JZJ A;  4R72 A;  5FHO A;  2XX8 A;  3K6X A;  1A40 A;  4F3P A;  2I6E A;  4PFY A;  3KN8 A;  5AE4 A;  4NF5 A;  1QJM A;  3N94 A;  1B5I A;  2THI A;  3MJN A;  5BUU A;  5KZT A;  1M5B A;  3OEM A;  4LQ5 A;  3FVK A;  1XC1 A;  4ZED A;  5CMB A;  4UAC A;  2RKM A;  3CSB A;  2NVU B;  1Y3P A;  4NF6 A;  1M5D A;  1LST A;  1J1N A;  3B6Q A;  2LAO A;  3OEN A;  1Y9U A;  3PV0 E;  5I56 B;  2RC7 A;  3K01 A;  1ANF A;  4HTG A;  3RGY A;  3OSQ A;  4JWO A;  3PD9 A;  4MLV A;  1UTH B;  3QK6 A;  2HFB A;  3EPE A;  3FVN A;  1MQH A;  1HSE A;  3H6V A;  3MW0 A;  1MY2 A;  5KCJ A;  4N6P A;  3E3K A;  4H6D A;  1XOC A;  3IOW A;  3DP4 A;  3C32 A;  2OLB A;  5DT6 A;  3N6T A;  4OFL A;  4G8N A;  2V3Q A;  4EXK A;  4LA9 A;  3PPR A;  4BDO A;  4MF3 A;  1B0H A;  1KWH A;  4I1D A;  1Q35 A;  3T9H B;  4RPN A;  2Q2C A;  4JSD A;  4GIZ A;  2GHB A;  2V25 A;  3W9W A;  2PBW A;  3CR9 A;  3R7X A;  3IX1 A;  5ISU A;  5H8S A;  3HHG A;  4TLM B;  3G3F A;  1P1W A;  1I69 A;  2ESN A;  4F22 A;  4GXA A;  2DWA A;  1ZBM A;  1NMU A;  4F39 A;  3FVG A;  1PB9 A;  4RA1 A;  3MPL A;  3N26 A;  2RCB A;  5CMK A;  4U23 A;  4NF5 B;  2XXQ A;  4N07 A;  2O84 X;  1VSO A;  1ELJ A;  3ZKL A;  3UN6 A;  2QS4 A;  1MM6 A;  2H4I A;  3K4U A;  4C0R A;  3OO6 A;  1LGB C;  5CBS A;  3VVD A;  3K6U A;  4NF6 B;  1YCJ A;  4H8I A;  5M2V A;  3MVZ A;  1D9Y A;  2X26 A;  3CFZ A;  3B6T A;  5JK4 A;  3N5L A;  5L9M A;  1ZMG A;  4QHQ A;  2ZNU A;  3IB1 A;  3TEP A;  2R9J A;  3Q29 A;  4ELP A;  3PPO A;  5H8Q A;  5AA1 A;  3SKP A;  1IXI A;  4YKJ A;  4IGT A;  1MY4 A;  3T93 B;  3U8Q A;  4OWD A;  1H45 A;  5ICQ A;  4EQ7 A;  3GXA A;  3BFT A;  1POY 1;  2ANJ A;  1MDQ A;  1LAF E;  5KCJ B;  4HCY A;  3DP8 A;  3HN0 A;  4YB5 A;  4THI A;  5EYF A;  1M5C A;  1FTL A;  4EQB A;  5I59 A;  3JYR A;  3VLV A;  4PET A;  3IOV A;  2OCU A;  1FW0 A;  4H5F A;  4X9T A;  4BDL A;  1OVB A;  3FVO A;  2A5S A;  3H6W A;  2UYE A;  1MXZ A;  2PX1 A;  3TKD A;  1GVC A;  1UQW A;  4RK9 A;  2D21 A;  4I62 A;  1IEJ A;  4OEN A;  1N04 A;  3RUM A;  2Z8E A;  3Q26 A;  4LAT A;  4G8M A;  1LCT A;  4GXS B;  1QUK A;  3KSX A;  2F78 A;  1Y1M A;  3WAE A;  1B4H A;  3KEI A;  3PGF A;  4X48 A;  2QS2 A;  4R75 A;  1DPE A;  1BIY A;  2Y84 A;  3FJ7 A;  1N3X A;  1FTO A;  4OER A;  2HCA A;  1Y1Z A;  2GHA A;  2OWS A;  3LSX A;  5H8H A;  4RJZ A;  3ZS6 A;  3QSL A;  1B58 A;  1ZJL A;  3Q27 A;  2F5X A;  4I9D A;  1S9T A;  4F2Q A;  4I8C A;  4FED A;  1B3L A;  1MY1 A;  1ZKB A;  4GQO A;  4U4S A;  3KSJ A;  3C36 A;  3DLN A;  2DE2 A;  2XXX A;  4MH5 A;  4RXL A;  3IL1 B;  5FHN A;  1YPN A;  1D9V A;  4PP0 A;  3TPA A;  4YMB A;  4DLD A;  4IGR A;  5H8Q B;  3K00 A;  4MLQ A;  5I2K A;  2I48 A;  2XD3 A;  3O66 A;  3PMV A;  3KN7 A;  1A55 A;  1MPD A;  2I0C A;  3IAZ A;  3SES A;  4Q30 B;  1N3W A;  3RNN A;  3TAJ A;  5JTY A;  3MVW A;  3VLU A;  2QMW A;  1OQG A;  1LB8 A;  4JB7 A;  3I5O A;  1B0L A;  3CG3 A;  1HSL A;  4JXI A;  3G3H A;  2E1S A;  1A54 A;  4ZE8 A;  4M4G A;  2DP8 A;  4ELQ A;  1BTJ A;  3TTM A;  3FV1 A;  1PBQ A;  1R9Q A;  5CMC A;  2PYY A;  2V3U A;  5I59 B;  4XKN A;  5HPQ A;  4YZZ A;  3RTF B;  3LSF B;  3SEY A;  3THI A;  1MQG A;  3EF7 A;  2VGQ A;  3TEL A;  3PUX E;  5F1Q A;  4Q5T A;  4F2O A;  3C9H A;  4KD5 A;  3IO6 A;  4JSO A;  4XXU A;  4LON B;  4QSE A;  2FA7 A;  3USD A;  5I57 A;  4YKP A;  1I6A A;  2WKY A;  2IEE A;  4Z0I A;  5ITP A;  4LUB A;  1FQA A;  2QSX A;  2YJP A;  3PPQ A;  4X1B A;  2M8C A;  1LBB A;  3E13 X;  1MY3 A;  2I3V A;  5H8H B;  1MQJ A;  1DPP A;  4IY5 A;  5F7V A;  3EHS A;  4AB5 A;  1FQE A;  3IJX B;  4ZEB A;  1QUI A;  3OO8 A;  3TZA A;  4X1D A;  3V8X B;  4O3A A;  4ND9 A;  3HV1 A;  5DYH A;  2Z8F A;  2DXY A;  3PUV E;  2P1S A;  1B05 A;  4YU0 A;  3MQ9 A;  4ZEK A;  1GR2 A;  3TQL A;  5KDT A;  5I2K B;  3TTK A;  2PT1 A;  4U2R A;  3UGW A;  3I3V A;  3D4C A;  3FXU A;  4GFR A;  5JTY B;  4NWC A;  4BDQ A;  3MZB A;  2DVZ A;  5L8D A;  1ZTY A;  1TFD A;  3RTW B;  4MBP A;  4DXB A;  4ESX A;  4WKM A;  3S9L C;  1P1O A;  2CZL A;  3VE1 B;  3KOT A;  1B6H A;  3IK6 B;  1TXF A;  5H8N A;  1MS7 A;  2H5Y A;  3ILU B;  4ELR A;  4NF8 A;  1MXW A;  4IO3 A;  3PUY E;  3LC8 A;  3IOR A;  4ESW A;  1XVX A;  3VLW A;  2O7U A;  1PC3 A;  4U21 A;  1B3F A;  1US5 A;  1URS A;  2ZXT A;  5I84 A;  1AMF A;  5I57 B;  4H8J A;  2H9B A;  1Y4T A;  4G2Z A;  1P1N A;  3KG2 A;  2UVH A;  3LBS A;  2VOZ A;  3M3K A;  2REJ A;  4F3B A;  2CMO A;  3A3U A;  1P99 A;  3BKI B;  4FEC A;  2H99 A;  4NE4 A;  3S2V A;  2Y7P A;  1A8F A;  1MM7 A;  4RK2 A;  4DE8 A;  5BWJ A;  4OQO A;  1BKA A;  2XX7 A;  2OWT A;  1QUL A;  1Z7M E;  3TFL A;  3K0V A;  2ZNS A;  1N84 A;  4C1T A;  4QSD A;  1FCK A;  1P1Q A;  4OTE A;  1DTG A;  1FTK A;  3GBB A;  4BLA A;  4BDM A;  1F9B A;  4XKQ A;  2P2A A;  4KYD A;  4NTL A;  1B4Z A;  2F34 A;  1WVJ A;  4GOT A;  1IXC A;  4FJP A;  1OIB A;  3MAM A;  2Q88 A;  4U1O A;  1JVY A;  1A99 A;  3MP8 A;  4Z7E A;  5KDT B;  2O6A A;  1XHY A;  3HST A;  3A09 A;  2UVJ A;  4ZZE A;  4LVQ A;  3QYT A;  4KI0 E;  2DYX A;  2O1L A;  3PUW E;  2Z23 A;  2VHA A;  3N6U A;  4KFQ A;  4ZEC A;  3T9X B;  4HCW A;  4FE8 A;  5LOM A;  5AA2 D;  2HAV A;  3BBR A;  3F11 A;  3CFX A;  4DZ1 A;  4IB2 A;  1MH3 A;  5CC2 A;  4YKK A;  5DVF A;  1RYX A;  2QS1 A;  2F6G A;  5H8N B;  1EZP A;  2O69 A;  2IA4 A;  3BFU A;  3SEW A;  3S9M C;  1MXX A;  1JEU A;  4YB7 A;  2F7B A;  4ONY A;  3RPW A;  2RC8 A;  2XHD A;  1B7U A;  1B32 A;  1B51 A;  1B46 A;  4OYV A;  3PPP A;  1R1N A;  4F29 A;  3GBA A;  2Y7I A;  3KGC A;  2YLN A;  4R6Y A;  5TPA A;  3OO7 A;  5TP9 A;  2W7Y A;  5CMM A;  3EHU A;  4AQ4 A;  4MFI A;  3QUF A;  2AYS A;  3O6I A;  4N13 A;  3ECR A;  3MBP A;  3T66 A;  4JBZ A;  4KHZ E;  1VE4 A;  1LAH E;  4IO6 A;  2VD2 A;  5FTH A;  3CSG A;  4WXJ A;  1MG1 A;  1BLF A;  2GFE A;  1USY E;  3OEL A;  1NKX A;  2QJE A;  3S4U A;  2RF1 A;  2ALU A;  1BP5 A;  4KPT A;  4F1Y A;  2OZZ A;  3VXC A;  2REG A;  3O29 A;  2ONK E;  1IUD A;  1R6Z A;  2HZK A;  3G3I A;  1H3D A;  1MPC A;  3AXF A;  4OET A;  2XX9 A;  2GRV A;  3EQ1 A;  3SET A;  2ZYO A;  5IKB A;  1I6B A;  2Q9T A;  3U1O A;  3Q25 A;  4R73 A;  1MPB A;  5K2X A;  1LFH A;  1B3G A;  2F8D A;  3K6W A;  3HO7 A;  1SW4 A;  1QUJ A;  1PEB A;  1QKA A;  1JW4 A;  5FTI A;  1JQF A;  4LP2 B;  1IXH A;  1LBC A;  2R6G E;  4ZE9 A;  2ONR A;  3RT8 A;  4FEB A;  2F7C A;  3SEU A;  1Y3N A;  4OEV A;  2RC9 A;  1Z7N E;  1N7W A;  2D5W A;  4GLI A;  3C31 A;  1YAE A;  1FQD A;  3KFM A;  1JW5 A;  4BDN A;  4Q8R A;  1OLA A;  5TPA B;  2ONS A;  3UOR A;  3GLB A;  2XXI A;  5TP9 B;  1L5T A;  4PQJ A;  4EUO A;  3JV9 A;  4O3C A;  3M8U A;  1QW0 A;  2Y7W A;  3KOS A;  4JWX A;  1AOV A;  2GH9 A;  1GV8 A;  4H65 A;  1SD3 A;  2XXV A;  2F35 A;  3HHF A;  4OES A;  3KJT A;  1T0K A;  1VR5 A;  3L6H A;  4G68 C;  5H8F A;  4PFT A;  1H76 A;  4QRZ A;  4UA8 A;  4H5G A;  4NMY A;  3FZV A;  4OZ9 A;  3FXR A;  1S7Y A;  2Z8D A;  4HW8 A;  3O97 A;  3OOA A;  3T96 B;  4POW A;  2YPN A;  3FAT A;  1SQY A;  3C4M A;  3G3G A;  1XS5 A;  1IZ1 A;  4R6K A;  1M5F A;  3IR1 A;  5CRY A;  1RKM A;  3E4R A;  4GWO A;  4LZ7 A;  1DMB A;  2V93 A;  1JET A;  4EXL A;  4OHN A;  4ZZA A;  4E0X A;  3FUZ A;  5DVJ A;  3GZG A;  1FTM A;  2I58 A;  2H25 A;  4EF1 A;  1NNK A;  4OEU A;  4ISU A;  4GVO A;  3IOU A;  1Y3Q A;  3A3C A;  2XXT A;  1SW1 A;  1MXY A;  3SEV A;  3IB0 A;  3RN8 A;  1MXV A;  2F6P A;  3RT6 B;  3B6W A;  4R2B A;  5TU0 A;  4ZEF A;  5A5X A;  5L9S A;  4FIM A;  2ZYM A;  4PE5 B;  4P11 A;  2ABH A;  4DCX A;  5I58 A;  2PVU A;  1AIV A;  4PFU A;  4OFO A;  1A8E A;  5AA3 A;  3L6G A;  3H6U A;  3SEX A;  1LB9 A;  4FAJ A;  3IB2 A;  1JNF A;  2UYF A;  3EHT A;  5H8F B;  3CFL A;  2DVC A;  3K6V A;  3LUY A;  1NL5 A;  1P1U A;  2NXO A;  2VP1 A;  1LCF A;  1SYI A;  1B9J A;  3H03 A;  2FYI A;  3I6V A;  4G68 A;  1Y4C A;  1OMP A;  3KBR A;  4TQU Q;  3C33 A;  1VFE A;  5JEI A;  4EF2 A;  2ZNT A;  3O6H A;  1B1X A;  1DTZ A;  4AB6 A;  1RYO A;  3DP6 A;  2OBG A;  3OEK A;  3OXN A;  4KQP A;  3K2D A;  4F1U A;  5K2Y A;  2DS9 A;  2E0S A;  4U22 A;  2VD3 A;  4E0W A;  2ZYK A;  3O9P A;  5DVI A;  2X7P A;  1NH8 A;  5A5X B;  1B40 A;  4EQ9 A;  1O63 A;  3IJO B;  2UXA A;  2XXY A;  3CIJ A;  5I58 B;  2X7Q A;  2I49 A;  5I2N A;  1M5E A;  5B70 A;  1PBP A;  1SVX B;  3PU5 A;  4LZ8 A;  4PFW A;  5CM6 A;  4P0I A;  3OMB A;  4BDR A;  3K1N A;  1LAG E;  3MWB A;  3C34 A;  3QXM A;  3U92 A;  3MVY A;  4XKR A;  3V89 B;  2OK2 A;  3C35 A;  5EHM A;  4XIG Q;  2O51 A;  4QFK A;  1I6Q A;  4LQ2 A;  4K3F A;  2DXR A;  2DOJ A;  1SDX A;  4G68 B;  5CI5 A;  3KJ7 A;  1AH5 A;  1S50 A;  4XKP A;  1FQF A;  4QFO A;  2DE3 A;  1UIU A;  3PD8 A;  3M3F A;  5L9O A;  2B65 A;  4Q0C A;  1A7L A;  4KYE A;  1SI1 A;  3CI8 A;  3MPK A;  3OD7 A;  3TCH A;  2UVG A;  1B7Z A;  1LAX A;  3QIM A;  4JWY A;  3TDJ A;  1FTJ A;  2UVI A;  2F7A A;  4M1V A;  3K02 A;  4U1Z A;  4RNS A;  1PB7 A;  4RY1 A;  2NOO A;  4F3G A;  1TFA A;  3EN3 A;  2DWH A;  1LFI A;  5HBC A;  2R71 A;  2QS3 A;  3W9V A;  4NF8 B;  3TTR A;  3VVF A;  4GF8 A;  3T9U A;  2V84 A;  4IO4 A;  4FOR A;  2FNC A;  1IIT A;  5HM4 B;  4F18 A;  1FQC A;  2Q8J A;  5FHM A;  1EZO A;  4IO5 A;  4ZDM A;  3S9E A;  1H44 A;  5DTB A;  1MQD A;  5I2N B;  1DSN A;  2RIN A;  3O2A A;  4U4X A;  4DDD A;  3E9X A;  2NUV A;  3DEL B;  3MP1 A;  3V83 A;  4WEP A;  2XXP A;  2OJT A;  1SW5 A;  1XVY A;  3MZ9 A;  3Q28 A;  3R6U A;  1SBP A;  2DSF A;  4ZEI A;  1UTB A;  3TTL A;  1WOD A;  3FXQ A;  4GL0 A;  2V3T A;  1EH3 A;  3UK4 A;  3MVX A;  5CBR A;  2O68 A;  1JVX A;  5DEX A;  1DOT A;  1B2H A;  1QKB A;  3LR1 A;  1ZIU A;  3CVG A;  3QUJ A;  2XXW A;  1YTV A;  4RYA A;  1B5H A;  3G3K A;  3R26 A;  3G3J A;  1MY0 A;  4R2F A;  3B7D A;  4G8H A;  3O28 A;  3H3G A;  4DXU A;  2B3B A;  1ZLQ A;  2PMS A;  2HXW A;  4WED A;  3LSW A;  2ZMB A;  4NED A;  1B3H A;  4DXC A;  3OO9 A;  1R9L A;  1MDP 1;  1MXU A;  4YIC A;  1POT A;  4TLL B;  3VXB A;  3ZKK A;  4NF4 A;  4LZ5 A;  5IAI A;  2XXR A;  3MZ1 A;  4YAH X;  4KCD A;  1B3E A;  4FAT A;  3UIF A;  2XXH A;  4G77 A;  4OVJ A;  3UP9 A;  4H67 A;  3G7W A;  1EZ9 A;  3HCQ A;  2Q89 A;  3CG1 A;  4QF9 A;  1OVT A;  1USY H;  5AA2 A;  3PUZ E;  2PT2 A;  3V5A A;  4IY6 A;  1Y20 A;  1NNF A;  1NNP A;  2A5T A;  1H43 A;  3FIR A;  2H98 A;  4F3S A;  1JW1 A;  2HQ0 A;  1OQH A;  1PDA A;  3D4G A;  1TT1 A;  1UTB B;  4POX A;  3H6T A;  2QL3 A;  2DQV A;  4TOZ A;  4RPO A;  1N0T A;  5DEX B;  5B7D A;  5ITO A;  1HSJ A;  1IXG A;  3U94 A;  4F19 A;  3K1P A;  3TYH A;  1TWY A;  5ICT A;  5ELV A;  3TOD A;  1D4N A;  1AL3 A;  1PB8 A;  3PPN A;  1VFD A;  4OMB A;  5J1D A;  2O7I A;  3PMW A;  1B7H A;  2RCA A;  3H4Z A;  1CB6 A;  2QPQ A;  4R6H A;  3IO4 A;  1B1H A;  4EDP A;  2Z22 A;  3IOT A;  3OSR A;  2O1M A;  1URD A;  2I4B A;  1XT8 A;  1SYH A;  4NF4 B;  2B3F A; 
#chains in the Genus database with same CATH topology
 4N6K A;  3KBZ A;  3S9N C;  2D3I A;  4NQ8 A;  4C1U A;  1GTK A;  3CRB A;  1SI0 A;  4PGN A;  5AA4 A;  3VDF A;  4JDF A;  2XD2 A;  3O6G A;  2NWJ A;  1CE2 A;  1N7X A;  1Q1K A;  4ECF A;  2HEU A;  4XTC Q;  4YB6 A;  3ONM A;  1B52 A;  1EU8 A;  2QVR A;  4F1V A;  2AL4 A;  3KN3 A;  4NWD A;  4AS5 A;  4KCC A;  4N91 A;  4GRK A;  5EYG A;  3FJM A;  1ZU0 A;  2QRY A;  4L17 A;  4DCY A;  4OFJ A;  4GWY A;  3H06 B;  1MRP A;  3TTN A;  3UA8 A;  1DCU A;  3P7I A;  3TCG A;  3MUQ A;  4IO7 A;  4MIJ A;  2VT5 A;  2I0B A;  4HS7 A;  1QVS A;  1NH7 A;  5AA2 B;  3RPL B;  2XWV A;  1LFG A;  3FV2 A;  2G29 A;  4NGU A;  2QMX A;  1LBY A;  3K1M A;  4IO2 A;  3MC2 A;  4R9F A;  1OLC A;  2A5T B;  4AS4 A;  4QFN A;  2AL5 A;  4P1L A;  4YMA A;  2G93 A;  4X04 A;  4QBA A;  1IQ7 A;  4H1X A;  2I3W A;  2HXR A;  3NOH A;  4KR5 A;  1SW2 A;  1EYI A;  3LSL A;  2P0S A;  4OXV A;  4F31 B;  3TCF A;  2AIX A;  2L5V A;  4G4P A;  2KLF A;  1LLS A;  4ELO A;  3RLF E;  3U72 A;  2DWJ A;  2Y7K A;  1IIW A;  1JEV A;  4R9G A;  4DIG A;  1MQI A;  2HAU A;  3RQT A;  1NFT A;  3LV0 A;  3HPI A;  5I56 A;  1G0I A;  1FQB A;  1II5 A;  4X8R A;  1N76 A;  2DE4 A;  4ZS9 A;  1B5J A;  4R74 A;  3ILT B;  4QFL A;  2Q2A A;  2BJJ X;  5EHS A;  3KZG A;  1US4 A;  1UTH A;  3FGS A;  3VFJ A;  1GGG A;  2Y7R A;  3MP6 A;  3FJG A;  4YKI A;  2Y5K A;  4H0W A;  2HZL A;  3T9V A;  3VV5 A;  4I3E A;  2XXU A;  2I4C A;  3M3L A;  4QSC A;  3TUS A;  2QFL A;  4P0G A;  3U93 A;  3ZSF A;  4KYS A;  1ATG A;  5AA4 B;  3TQW A;  2F97 A;  3W15 C;  3FD3 A;  1UIV A;  3SDF A;  3QAX A;  1O64 A;  2DWI A;  4QFP A;  2ZYN A;  3PMX A;  3TMG A;  2F36 A;  1FPI A;  3SER A;  3FAS A;  3FBP A;  1URG A;  1FPG A;  1NNT A;  3WAF A;  3ODB A;  4GL8 A;  1O7T A;  3RY3 A;  3VVE A;  1FBP A;  4O3B A;  3H7M A;  3T22 A;  4GD5 A;  3DM0 A;  4JVI A;  1D3K A;  1WDN A;  1MH4 A;  3JZJ A;  4R72 A;  5FHO A;  2XX8 A;  3K6X A;  1A40 A;  4F3P A;  2I6E A;  4PFY A;  3KN8 A;  5AE4 A;  3GYY A;  3B8B A;  4NF5 A;  1QJM A;  3N94 A;  4PF8 A;  1FJ9 A;  1B5I A;  2HHM A;  2THI A;  3MJN A;  5DW8 A;  5BUU A;  5KZT A;  1KZ8 A;  1M5B A;  3OEM A;  5J16 A;  4LQ5 A;  3FVK A;  3KC1 A;  1XC1 A;  4ZED A;  5CMB A;  4UAC A;  2RKM A;  2XWO A;  3CSB A;  4NAP A;  2NVU B;  1Y3P A;  4NF6 A;  1M5D A;  1LST A;  1NUZ A;  1J1N A;  3B6Q A;  2LAO A;  3OEN A;  1Y9U A;  3PV0 E;  3QMF A;  5I56 B;  2RC7 A;  3K01 A;  1ANF A;  2FHY A;  4HTG A;  3RGY A;  3OSQ A;  4JWO A;  2WX9 A;  4XF5 A;  3PD9 A;  4MLV A;  1UTH B;  3QK6 A;  2HFB A;  3EPE A;  3FVN A;  4O8M A;  1MQH A;  1HSE A;  2Q74 A;  3H6V A;  3MW0 A;  1MY2 A;  5KCJ A;  1FBD A;  4HE0 A;  4N6P A;  3E3K A;  4H6D A;  1XOC A;  3IOW A;  3DP4 A;  3C32 A;  2OLB A;  5DT6 A;  3N6T A;  4OFL A;  4G8N A;  2V3Q A;  4EXK A;  4LA9 A;  3PPR A;  4P1E A;  4BDO A;  4O7M A;  4MF3 A;  1IMB A;  1B0H A;  1KWH A;  4I1D A;  1Q35 A;  3T9H B;  4RPN A;  1FBE A;  2Q2C A;  4JSD A;  4GIZ A;  1IMD A;  2GHB A;  2V25 A;  3W9W A;  1RDZ A;  2PBW A;  3CR9 A;  3R7X A;  3IX1 A;  5ISU A;  5H8S A;  3HHG A;  4TLM B;  3G3F A;  4GWS A;  1P1W A;  1I69 A;  2ESN A;  4PAI A;  4F22 A;  4GXA A;  2DWA A;  1ZBM A;  1NMU A;  4F39 A;  3FVG A;  1PB9 A;  4RA1 A;  3MPL A;  3N26 A;  2RCB A;  5CMK A;  4U23 A;  4NF5 B;  2XXQ A;  4N07 A;  2O84 X;  1VSO A;  4DI4 B;  1ELJ A;  3A29 A;  3ZKL A;  3UN6 A;  2QS4 A;  1MM6 A;  2H4I A;  3K4U A;  4C0R A;  3OO6 A;  4HE1 A;  1LGB C;  5CBS A;  3VVD A;  3K6U A;  4H46 A;  4NF6 B;  1YCJ A;  2ZZX A;  4H8I A;  5M2V A;  3MVZ A;  1D9Y A;  2X26 A;  3CFZ A;  3B6T A;  5JK4 A;  3N5L A;  5L9M A;  1FPE A;  1ZMG A;  4QHQ A;  2ZNU A;  3IB1 A;  4JVC A;  1NV6 A;  3TEP A;  2R9J A;  3Q29 A;  4ELP A;  3PPO A;  5H8Q A;  5AA1 A;  3SKP A;  1IXI A;  3BIG A;  4MNC A;  4YKJ A;  4IGT A;  1MY4 A;  3T93 B;  2WBD A;  3U8Q A;  4OWD A;  1H45 A;  5ICQ A;  4MJO A;  4EQ7 A;  3GXA A;  3BFT A;  1POY 1;  2ANJ A;  1MDQ A;  1LAF E;  5KCJ B;  4HCY A;  3DP8 A;  2XA5 A;  3HN0 A;  4GWU A;  5IGA A;  4YB5 A;  4THI A;  5EYF A;  1M5C A;  1FTL A;  4EQB A;  5LTC A;  1KA1 A;  5I59 A;  3JYR A;  3VLV A;  4PET A;  3IOV A;  2OCU A;  3HFU A;  4FBP A;  1FW0 A;  4H5F A;  4NHB A;  4X9T A;  4N81 A;  4BDL A;  1OVB A;  3FVO A;  1FJ6 A;  2A5S A;  1IMF A;  3H6W A;  2UYE A;  1MXZ A;  2PX1 A;  3TKD A;  5F24 A;  2WEF A;  1GVC A;  1UQW A;  4RK9 A;  2D21 A;  4I62 A;  1IEJ A;  4OEN A;  1N04 A;  3RUM A;  2Z8E A;  3Q26 A;  1NUY A;  4LAT A;  4GX4 A;  4G8M A;  1LCT A;  4GXS B;  1K9Z A;  1QUK A;  3KSX A;  2F78 A;  1Y1M A;  3WAE A;  1B4H A;  3KEI A;  3PGF A;  4X48 A;  2QS2 A;  1IMC A;  4R75 A;  1DPE A;  1BIY A;  2Y84 A;  3FJ7 A;  1N3X A;  1FTO A;  4OER A;  2HCA A;  1Y1Z A;  2GHA A;  2OWS A;  3LSX A;  4NG7 A;  5H8H A;  1LBW A;  2CEY A;  4RJZ A;  3ZS6 A;  3QSL A;  1B58 A;  1ZJL A;  3Q27 A;  4PGP A;  2F5X A;  1NV0 A;  4I9D A;  1S9T A;  4F2Q A;  4I8C A;  4FED A;  1B3L A;  1MY1 A;  1ZKB A;  4GQO A;  4U4S A;  3KSJ A;  3C36 A;  4OVR A;  3DLN A;  2DE2 A;  1G0H A;  2JJK A;  2XXX A;  4MH5 A;  4RXL A;  3IL1 B;  5FHN A;  1FPJ A;  1YPN A;  1D9V A;  4PP0 A;  3TPA A;  4YMB A;  4DLD A;  4IGR A;  5H8Q B;  3K00 A;  4MLQ A;  5I2K A;  2I48 A;  2XD3 A;  3O66 A;  3PMV A;  3KN7 A;  1A55 A;  2V4C A;  1MPD A;  2I0C A;  3IAZ A;  3SES A;  4Q30 B;  1N3W A;  3RNN A;  3TAJ A;  5JTY A;  3MVW A;  3VLU A;  2QMW A;  1OQG A;  1LB8 A;  4JB7 A;  3I5O A;  1B0L A;  3CG3 A;  3E79 A;  1HSL A;  4JXI A;  3G3H A;  2E1S A;  1A54 A;  4ZE8 A;  4M4G A;  2DP8 A;  4ELQ A;  1BTJ A;  3TTM A;  3FV1 A;  1PBQ A;  1R9Q A;  5CMC A;  2PYY A;  1FPF A;  2V3U A;  4PFI A;  5I59 B;  4XKN A;  5HPQ A;  4YZZ A;  3RTF B;  3LSF B;  3SEY A;  3THI A;  1MQG A;  4HXV A;  3EF7 A;  2VGQ A;  3TEL A;  3PUX E;  4PTK A;  5F1Q A;  4Q5T A;  1FBG A;  4F2O A;  3U65 A;  3C9H A;  4KD5 A;  3IO6 A;  4JSO A;  4XXU A;  2DDK A;  4LON B;  4QSE A;  2FA7 A;  3USD A;  5I57 A;  4YKP A;  1I6A A;  2WKY A;  2QVU A;  2IEE A;  4Z0I A;  2F3D A;  5ITP A;  4LUB A;  1FQA A;  2QSX A;  2YJP A;  3PPQ A;  4X1B A;  2M8C A;  1LBB A;  3E13 X;  2KR0 A;  1MY3 A;  2I3V A;  5H8H B;  1MQJ A;  1DPP A;  1LBX A;  4IY5 A;  5F7V A;  1FPD A;  3EHS A;  4O94 A;  5ESY A;  4AB5 A;  1FQE A;  3IJX B;  4ZEB A;  1QUI A;  3OO8 A;  4P3L A;  3TZA A;  4X1D A;  3V8X B;  4O3A A;  4ND9 A;  3HV1 A;  5DYH A;  2Z8F A;  2DXY A;  3PUV E;  4HE2 A;  2P1S A;  1B05 A;  4YU0 A;  3MQ9 A;  4ZEK A;  1GR2 A;  3TQL A;  5KDT A;  4GX3 A;  5IZ3 A;  5I2K B;  3TTK A;  2PT1 A;  4U2R A;  3UGW A;  4PCD A;  3I3V A;  3D4C A;  3FXU A;  5EYH A;  4GFR A;  5JTY B;  5FBP A;  4NWC A;  4BDQ A;  2GQ1 A;  3MZB A;  2DVZ A;  5L8D A;  1NUX A;  1ZTY A;  1TFD A;  4OVQ A;  3RTW B;  4MBP A;  4DXB A;  4ESX A;  4UAB A;  4WKM A;  3S9L C;  1P1O A;  2R8T A;  2CZL A;  3VE1 B;  3KOT A;  1LBZ A;  1B6H A;  3IK6 B;  1TXF A;  5H8N A;  1MS7 A;  1KA0 A;  2H5Y A;  3MYU A;  3ILU B;  4ELR A;  3EKI A;  4NF8 A;  1MXW A;  4IO3 A;  3PUY E;  3LC8 A;  4P9K A;  3IOR A;  4ESW A;  1XVX A;  3VLW A;  2O7U A;  1PC3 A;  4U21 A;  1B3F A;  1US5 A;  1URS A;  2ZXT A;  5I84 A;  1AMF A;  5I57 B;  4H8J A;  2H9B A;  1Y4T A;  4G2Z A;  4N8G A;  1P1N A;  3KG2 A;  3E78 A;  2UVH A;  3LBS A;  2VOZ A;  3M3K A;  2REJ A;  4F3B A;  2CMO A;  3A3U A;  1NUW A;  4XEQ A;  1P99 A;  2XWK A;  3BKI B;  4FEC A;  5LDZ A;  2H99 A;  4NE4 A;  3S2V A;  2Y7P A;  1A8F A;  1MM7 A;  4RK2 A;  4DE8 A;  5BWJ A;  4OQO A;  3ROJ A;  1BKA A;  2XX7 A;  2OWT A;  1QUL A;  1Z7M E;  1FSA A;  3TFL A;  3K0V A;  2ZNS A;  1N84 A;  2PFY A;  4C1T A;  4QSD A;  4PBH A;  1FCK A;  1P1Q A;  4OTE A;  1DTG A;  1FTK A;  3GBB A;  4BLA A;  1YYZ A;  4BDM A;  1F9B A;  4XKQ A;  2P2A A;  4KYD A;  4NTL A;  1B4Z A;  2F34 A;  1WVJ A;  4GOT A;  1IXC A;  4FJP A;  1OIB A;  3MAM A;  5A5L A;  2Q88 A;  2XXK A;  4U1O A;  1JVY A;  1A99 A;  4NN3 A;  3MP8 A;  4Z7E A;  5KDT B;  4GWX A;  5IZ3 B;  4OA4 A;  1D9Q A;  2O6A A;  4O7I A;  1XHY A;  3HST A;  3A09 A;  3D1R A;  2UVJ A;  4ZZE A;  4LVQ A;  3QYT A;  4KI0 E;  2DYX A;  2O1L A;  3PUW E;  2Z23 A;  4G61 A;  2VHA A;  3N6U A;  4KFQ A;  4ZEC A;  3T9X B;  4HCW A;  4FE8 A;  4PDD A;  5LOM A;  5AA2 D;  2HAV A;  3BBR A;  3F11 A;  3CFX A;  4DZ1 A;  2WYP A;  4IB2 A;  1MH3 A;  5CC2 A;  4NX1 A;  4YKK A;  5T3J A;  5DVF A;  1RYX A;  2QS1 A;  2F6G A;  5H8N B;  1EZP A;  2O69 A;  2IA4 A;  3BFU A;  3SEW A;  1K9Y A;  3S9M C;  1MXX A;  1JEU A;  4QXD A;  4YB7 A;  2F7B A;  4ONY A;  3RPW A;  2RC8 A;  2XHD A;  1B7U A;  1B32 A;  1B51 A;  1B46 A;  4OYV A;  3PPP A;  1R1N A;  4F29 A;  3GBA A;  2Y7I A;  3KGC A;  2YLN A;  4R6Y A;  5TPA A;  3OO7 A;  5TP9 A;  2W7Y A;  5CMM A;  3EHU A;  4AQ4 A;  4MNI A;  4MFI A;  3QUF A;  2AYS A;  3O6I A;  4N13 A;  3ECR A;  1SPI A;  3MBP A;  3T66 A;  4I3Y A;  4JBZ A;  2VPN A;  4KHZ E;  1VE4 A;  1LAH E;  1NV7 A;  4IO6 A;  2VD2 A;  5FTH A;  3CSG A;  1CNQ A;  4WXJ A;  1INP A;  1MG1 A;  1BLF A;  2GFE A;  1USY E;  3OEL A;  1NKX A;  2QJE A;  2P3N A;  1FBC A;  3S4U A;  2RF1 A;  2ALU A;  1BP5 A;  4KPT A;  4F1Y A;  2OZZ A;  3VXC A;  2REG A;  3O29 A;  2ONK E;  1IUD A;  1R6Z A;  1LBV A;  2HZK A;  2PFZ A;  3G3I A;  1H3D A;  1MPC A;  3AXF A;  4OET A;  5EQ7 A;  2XX9 A;  2GRV A;  4GBW A;  3EQ1 A;  3SET A;  2ZYO A;  5IKB A;  2FBP A;  1I6B A;  2Q9T A;  1IMA A;  3U1O A;  3Q25 A;  2MKZ A;  4NF0 A;  4R73 A;  1MPB A;  5K2X A;  1LFH A;  5I7I A;  2VPO A;  1B3G A;  2F8D A;  3K6W A;  3HO7 A;  2BJI A;  1SW4 A;  1QUJ A;  1PEB A;  1QKA A;  1JW4 A;  5FTI A;  1JQF A;  4LP2 B;  4LN5 A;  1IXH A;  1LBC A;  2R6G E;  4ZE9 A;  2ONR A;  3RT8 A;  4FEB A;  2F7C A;  3SEU A;  1Y3N A;  4OEV A;  2RC9 A;  1Z7N E;  1N7W A;  4KXP A;  2D5W A;  4GLI A;  3C31 A;  1YAE A;  1FPK A;  1FQD A;  4H45 A;  3KFM A;  1JW5 A;  4BDN A;  4Q8R A;  1OLA A;  5TPA B;  2ONS A;  3UOR A;  3GLB A;  2XXI A;  5TP9 B;  1L5T A;  4PQJ A;  4EUO A;  3JV9 A;  4OVS A;  4O3C A;  3M8U A;  2B4L A;  1NV5 A;  1QW0 A;  2Y7W A;  3KOS A;  4JWX A;  1NV1 A;  1AOV A;  2GH9 A;  1GV8 A;  3BIH A;  4H65 A;  1SD3 A;  2XXV A;  2F35 A;  3HHF A;  4OES A;  3KJT A;  1T0K A;  1VR5 A;  3L6H A;  2P3V A;  4G68 C;  4PFT A;  5H8F A;  1H76 A;  4QRZ A;  4UA8 A;  4H5G A;  4N6D A;  4NMY A;  3FZV A;  4OZ9 A;  3FXR A;  1S7Y A;  2Z8D A;  2Q8M A;  4HW8 A;  3O97 A;  3OOA A;  3T96 B;  4POW A;  2YPN A;  3FAT A;  1SQY A;  3C4M A;  3FXB A;  2ZZW A;  3G3G A;  1XS5 A;  1IZ1 A;  4R6K A;  1M5F A;  5IZZ A;  3IR1 A;  5CRY A;  1RKM A;  3E4R A;  4GWO A;  4LZ7 A;  1DMB A;  2OX3 A;  1FPB A;  2V93 A;  4N17 A;  1JET A;  1NV2 A;  4EXL A;  4OHN A;  4ZZA A;  4E0X A;  3FUZ A;  5DVJ A;  3GZG A;  1FTM A;  2I58 A;  2H25 A;  4EF1 A;  1NNK A;  4OEU A;  4N15 A;  4ISU A;  4GVO A;  2F3B A;  2WYK A;  3IOU A;  1EYJ A;  1Y3Q A;  3A3C A;  2XXT A;  1IME A;  1SW1 A;  1MXY A;  3SEV A;  3IB0 A;  3RN8 A;  2KQZ A;  4OVT A;  1MXV A;  2F6P A;  1JP4 A;  3RT6 B;  1FRP A;  2FIE A;  3B6W A;  4R2B A;  2B4M A;  5TU0 A;  4ZEF A;  5A5X A;  5L9S A;  2XWI A;  4IR8 A;  5ET6 A;  4FIM A;  3SZP A;  2ZYM A;  4PE5 B;  4P11 A;  2ABH A;  4DCX A;  5I58 A;  4MHF A;  2PVU A;  1AIV A;  4PAK A;  4N8Y A;  5ET5 A;  4PFU A;  4OFO A;  1A8E A;  5AA3 A;  3L6G A;  3H6U A;  3SEX A;  1LB9 A;  4PFB A;  4FAJ A;  3IB2 A;  1JNF A;  2UYF A;  3EHT A;  5H8F B;  3CFL A;  2DVC A;  3K6V A;  3IFA A;  3LUY A;  1NL5 A;  4MEV A;  1P1U A;  2NXO A;  2VP1 A;  2Y5L A;  1LCF A;  1SYI A;  1B9J A;  3H03 A;  2FYI A;  1XI6 A;  3I6V A;  4G68 A;  1Y4C A;  2CZH A;  1OMP A;  3KBR A;  4TQU Q;  3C33 A;  1VFE A;  5JEI A;  1NV4 A;  4EF2 A;  2ZNT A;  3O6H A;  1AWB A;  1B1X A;  1DTZ A;  3IFC A;  4AB6 A;  2QVV A;  1RYO A;  1RDY A;  3DP6 A;  2OBG A;  3OEK A;  5ET8 A;  3OXN A;  4KQP A;  3K2D A;  4F1U A;  4OAN A;  5K2Y A;  3B50 A;  2DS9 A;  2E0S A;  4U22 A;  2VD3 A;  5EQ9 A;  4E0W A;  2CZK A;  3ISP A;  2ZYK A;  3O9P A;  5DVI A;  5IZ1 A;  2X7P A;  3PTY A;  1NH8 A;  5A5X B;  1B40 A;  5EQ8 A;  4EQ9 A;  1O63 A;  3IJO B;  2UXA A;  2XXY A;  3CIJ A;  5I58 B;  2X7Q A;  2I49 A;  5I2N A;  1M5E A;  5B70 A;  1PBP A;  1SVX B;  3PU5 A;  4LZ8 A;  4PFW A;  5CM6 A;  4P0I A;  3OMB A;  4BDR A;  4PDH A;  3K1N A;  1LAG E;  3MWB A;  3C34 A;  3QXM A;  5I3S A;  3U92 A;  3MVY A;  4XKR A;  3V89 B;  4DI3 D;  5ET7 A;  2OK2 A;  4P8B A;  3C35 A;  4PF6 A;  5EQA A;  5EHM A;  4XIG Q;  2O51 A;  4MAG A;  4QFK A;  1I6Q A;  4LQ2 A;  4K3F A;  2DXR A;  2DOJ A;  1SDX A;  4G68 B;  5CI5 A;  3KJ7 A;  1AH5 A;  1S50 A;  3RYD A;  4XKP A;  1FQF A;  4QFO A;  2DE3 A;  1UIU A;  3PD8 A;  3M3F A;  5L9O A;  2B65 A;  4Q0C A;  1A7L A;  2HPG A;  4KYE A;  1SI1 A;  3CI8 A;  3MPK A;  3OD7 A;  3TCH A;  2UVG A;  1B7Z A;  1LAX A;  3QIM A;  4JWY A;  3TDJ A;  2PCR A;  1FTJ A;  4U1Z A;  2UVI A;  2F7A A;  3K02 A;  4M1V A;  4RNS A;  1PB7 A;  4RY1 A;  2NOO A;  4F3G A;  1TFA A;  3EN3 A;  4PFR A;  4MX6 A;  2DWH A;  1LFI A;  3T1B A;  5HBC A;  4MMP A;  1FTA A;  2R71 A;  2QS3 A;  3W9V A;  4NF8 B;  3KC0 A;  3TTR A;  3VVF A;  4GF8 A;  3T9U A;  2V84 A;  4IO4 A;  4FOR A;  2FNC A;  1IIT A;  5HM4 B;  4F18 A;  1FQC A;  2Q8J A;  5FHM A;  1EZO A;  4IO5 A;  1NV3 A;  4ZDM A;  3S9E A;  1H44 A;  5DTB A;  1MQD A;  5I2N B;  1DSN A;  2RIN A;  3O2A A;  4U4X A;  4DDD A;  3E9X A;  2NUV A;  3DEL B;  3MP1 A;  4PBQ A;  3V83 A;  4WEP A;  2XXP A;  1FBH A;  2FIX A;  4MNP A;  2OJT A;  3LUZ A;  1SW5 A;  1XVY A;  3MZ9 A;  3Q28 A;  3R6U A;  1QGX A;  1SBP A;  2DSF A;  4ZEI A;  1UTB A;  3TTL A;  1WOD A;  3FXQ A;  4GL0 A;  2V3T A;  1YXI A;  1EH3 A;  3UK4 A;  3MVX A;  5CBR A;  2O68 A;  1JVX A;  5DEX A;  1DOT A;  2WBB A;  1B2H A;  1QKB A;  3T0J A;  4XFE A;  3LR1 A;  1ZIU A;  3CVG A;  3QUJ A;  2XXW A;  1YTV A;  4GWZ A;  4RYA A;  1B5H A;  3G3K A;  3R26 A;  3G3J A;  4PAF A;  1MY0 A;  4R2F A;  3B7D A;  4G8H A;  3O28 A;  3H3G A;  4DXU A;  1FPL A;  2B3B A;  1ZLQ A;  2PMS A;  2HXW A;  4WED A;  3LSW A;  2ZMB A;  4NED A;  1B3H A;  4DXC A;  3OO9 A;  4PE3 A;  1R9L A;  1MDP 1;  1MXU A;  4YIC A;  1POT A;  5IM2 A;  2OWZ A;  4TLL B;  3VXB A;  3ZKK A;  4NF4 A;  4LZ5 A;  5IAI A;  2XXR A;  1VDW A;  2ZZV A;  3MZ1 A;  4YAH X;  4KCD A;  1BK4 A;  1B3E A;  4FAT A;  5I5P A;  3UIF A;  4MCO A;  2XXH A;  4G77 A;  4OVJ A;  3UP9 A;  4H67 A;  3G7W A;  1LEV A;  1EZ9 A;  3HCQ A;  2Q89 A;  3CG1 A;  4QF9 A;  1OVT A;  1FBF A;  1USY H;  5AA2 A;  3PUZ E;  3RPL A;  2PT2 A;  3V5A A;  4IY6 A;  1Y20 A;  1NNF A;  1NNP A;  2A5T A;  1H43 A;  3FIR A;  1EYK A;  1NI9 A;  2H98 A;  4P56 A;  4F3S A;  1JW1 A;  2HQ0 A;  1OQH A;  1PDA A;  4JVD A;  1YZ0 A;  3D4G A;  1TT1 A;  1UTB B;  4POX A;  3H6T A;  2QL3 A;  4N4U A;  2DQV A;  4TOZ A;  4RPO A;  4P47 A;  1N0T A;  4GWW A;  5DEX B;  1RDX A;  5B7D A;  5ITO A;  1HSJ A;  1IXG A;  4GBV A;  3U94 A;  4F19 A;  3K1P A;  4GX6 A;  3TYH A;  1TWY A;  5ICT A;  5ELV A;  3TOD A;  1D4N A;  1AL3 A;  1PB8 A;  3PPN A;  1VFD A;  4OMB A;  2CZI A;  5J1D A;  2FVZ A;  2O7I A;  1DBZ A;  3PMW A;  4PC9 A;  1B7H A;  2RCA A;  3H4Z A;  1CB6 A;  2QPQ A;  3CHG A;  1DK4 A;  4R6H A;  3IO4 A;  1B1H A;  4EDP A;  2Z22 A;  3IOT A;  3OSR A;  1Q9D A;  4OVP A;  2O1M A;  2CEX A;  1URD A;  2I4B A;  4I40 A;  3MST A;  1XT8 A;  1SYH A;  4NF4 B;  2B3F A; 
#chains in the Genus database with same CATH homology
 3S9N C;  2D3I A;  4C1U A;  1GTK A;  3CRB A;  1SI0 A;  5AA4 A;  3VDF A;  4JDF A;  2XD2 A;  3O6G A;  2NWJ A;  1CE2 A;  1N7X A;  1Q1K A;  4ECF A;  2HEU A;  4XTC Q;  4YB6 A;  3ONM A;  1B52 A;  1EU8 A;  4F1V A;  2AL4 A;  3KN3 A;  4NWD A;  4KCC A;  4GRK A;  3FJM A;  1ZU0 A;  2QRY A;  4L17 A;  4DCY A;  4OFJ A;  3H06 B;  1MRP A;  3TTN A;  3UA8 A;  3P7I A;  3TCG A;  3MUQ A;  4IO7 A;  2I0B A;  4HS7 A;  1QVS A;  1NH7 A;  5AA2 B;  1LFG A;  3FV2 A;  2G29 A;  2QMX A;  3K1M A;  4IO2 A;  3MC2 A;  4R9F A;  1OLC A;  2A5T B;  4QFN A;  2AL5 A;  4YMA A;  2G93 A;  1IQ7 A;  4H1X A;  2I3W A;  4KR5 A;  1SW2 A;  3LSL A;  2P0S A;  4OXV A;  4F31 B;  3TCF A;  2AIX A;  4G4P A;  2KLF A;  1LLS A;  4ELO A;  3RLF E;  3U72 A;  2DWJ A;  2Y7K A;  1IIW A;  1JEV A;  4R9G A;  4DIG A;  1MQI A;  2HAU A;  3RQT A;  1NFT A;  3HPI A;  5I56 A;  1FQB A;  1II5 A;  1N76 A;  2DE4 A;  4ZS9 A;  1B5J A;  4R74 A;  3ILT B;  4QFL A;  2Q2A A;  2BJJ X;  5EHS A;  3KZG A;  1US4 A;  1UTH A;  3FGS A;  3VFJ A;  1GGG A;  2Y7R A;  3MP6 A;  3FJG A;  4YKI A;  4H0W A;  2HZL A;  3T9V A;  3VV5 A;  2XXU A;  2I4C A;  3M3L A;  4QSC A;  3TUS A;  4P0G A;  3U93 A;  3ZSF A;  4KYS A;  1ATG A;  5AA4 B;  3TQW A;  2F97 A;  3W15 C;  3FD3 A;  1UIV A;  3SDF A;  3QAX A;  1O64 A;  2DWI A;  4QFP A;  2ZYN A;  3PMX A;  3TMG A;  2F36 A;  3SER A;  3FAS A;  1URG A;  1NNT A;  3WAF A;  3ODB A;  4GL8 A;  1O7T A;  3RY3 A;  3VVE A;  4O3B A;  3H7M A;  3T22 A;  4GD5 A;  3DM0 A;  1D3K A;  1WDN A;  1MH4 A;  3JZJ A;  4R72 A;  5FHO A;  2XX8 A;  3K6X A;  1A40 A;  4F3P A;  2I6E A;  4PFY A;  3KN8 A;  5AE4 A;  4NF5 A;  1QJM A;  3N94 A;  1B5I A;  2THI A;  3MJN A;  5BUU A;  5KZT A;  1M5B A;  3OEM A;  4LQ5 A;  3FVK A;  1XC1 A;  4ZED A;  5CMB A;  4UAC A;  2RKM A;  3CSB A;  2NVU B;  1Y3P A;  4NF6 A;  1M5D A;  1LST A;  1J1N A;  3B6Q A;  2LAO A;  3OEN A;  1Y9U A;  3PV0 E;  5I56 B;  2RC7 A;  3K01 A;  1ANF A;  4HTG A;  3RGY A;  3OSQ A;  4JWO A;  3PD9 A;  4MLV A;  1UTH B;  3QK6 A;  2HFB A;  3EPE A;  3FVN A;  1MQH A;  1HSE A;  3H6V A;  3MW0 A;  1MY2 A;  5KCJ A;  4N6P A;  3E3K A;  4H6D A;  1XOC A;  3IOW A;  3DP4 A;  3C32 A;  2OLB A;  5DT6 A;  3N6T A;  4OFL A;  4G8N A;  2V3Q A;  4EXK A;  4LA9 A;  3PPR A;  4BDO A;  4MF3 A;  1B0H A;  1KWH A;  4I1D A;  1Q35 A;  3T9H B;  4RPN A;  2Q2C A;  4JSD A;  4GIZ A;  2GHB A;  2V25 A;  3W9W A;  2PBW A;  3CR9 A;  3R7X A;  3IX1 A;  5ISU A;  5H8S A;  3HHG A;  4TLM B;  3G3F A;  1P1W A;  1I69 A;  2ESN A;  4F22 A;  4GXA A;  2DWA A;  1ZBM A;  1NMU A;  4F39 A;  3FVG A;  1PB9 A;  4RA1 A;  3MPL A;  3N26 A;  2RCB A;  5CMK A;  4U23 A;  4NF5 B;  2XXQ A;  4N07 A;  2O84 X;  1VSO A;  1ELJ A;  3ZKL A;  3UN6 A;  2QS4 A;  1MM6 A;  2H4I A;  3K4U A;  4C0R A;  3OO6 A;  1LGB C;  5CBS A;  3VVD A;  3K6U A;  4NF6 B;  1YCJ A;  4H8I A;  5M2V A;  3MVZ A;  1D9Y A;  2X26 A;  3CFZ A;  3B6T A;  5JK4 A;  3N5L A;  5L9M A;  1ZMG A;  4QHQ A;  2ZNU A;  3IB1 A;  3TEP A;  2R9J A;  3Q29 A;  4ELP A;  3PPO A;  5H8Q A;  5AA1 A;  3SKP A;  1IXI A;  4YKJ A;  4IGT A;  1MY4 A;  3T93 B;  3U8Q A;  4OWD A;  1H45 A;  5ICQ A;  4EQ7 A;  3GXA A;  3BFT A;  1POY 1;  2ANJ A;  1MDQ A;  1LAF E;  5KCJ B;  4HCY A;  3DP8 A;  3HN0 A;  4YB5 A;  4THI A;  5EYF A;  1M5C A;  1FTL A;  4EQB A;  5I59 A;  3JYR A;  3VLV A;  4PET A;  3IOV A;  2OCU A;  1FW0 A;  4H5F A;  4X9T A;  4BDL A;  1OVB A;  3FVO A;  2A5S A;  3H6W A;  2UYE A;  1MXZ A;  2PX1 A;  3TKD A;  1GVC A;  1UQW A;  4RK9 A;  2D21 A;  4I62 A;  1IEJ A;  4OEN A;  1N04 A;  3RUM A;  2Z8E A;  3Q26 A;  4LAT A;  4G8M A;  1LCT A;  4GXS B;  1QUK A;  3KSX A;  2F78 A;  1Y1M A;  3WAE A;  1B4H A;  3KEI A;  3PGF A;  4X48 A;  2QS2 A;  4R75 A;  1DPE A;  1BIY A;  2Y84 A;  3FJ7 A;  1N3X A;  1FTO A;  4OER A;  2HCA A;  1Y1Z A;  2GHA A;  2OWS A;  3LSX A;  5H8H A;  4RJZ A;  3ZS6 A;  3QSL A;  1B58 A;  1ZJL A;  3Q27 A;  2F5X A;  4I9D A;  1S9T A;  4F2Q A;  4I8C A;  4FED A;  1B3L A;  1MY1 A;  1ZKB A;  4GQO A;  4U4S A;  3KSJ A;  3C36 A;  3DLN A;  2DE2 A;  2XXX A;  4MH5 A;  4RXL A;  3IL1 B;  5FHN A;  1YPN A;  1D9V A;  4PP0 A;  3TPA A;  4YMB A;  4DLD A;  4IGR A;  5H8Q B;  3K00 A;  4MLQ A;  5I2K A;  2I48 A;  2XD3 A;  3O66 A;  3PMV A;  3KN7 A;  1A55 A;  1MPD A;  2I0C A;  3IAZ A;  3SES A;  4Q30 B;  1N3W A;  3RNN A;  3TAJ A;  5JTY A;  3MVW A;  3VLU A;  2QMW A;  1OQG A;  1LB8 A;  4JB7 A;  3I5O A;  1B0L A;  3CG3 A;  1HSL A;  4JXI A;  3G3H A;  2E1S A;  1A54 A;  4ZE8 A;  4M4G A;  2DP8 A;  4ELQ A;  1BTJ A;  3TTM A;  3FV1 A;  1PBQ A;  1R9Q A;  5CMC A;  2PYY A;  2V3U A;  5I59 B;  4XKN A;  5HPQ A;  4YZZ A;  3RTF B;  3LSF B;  3SEY A;  3THI A;  1MQG A;  3EF7 A;  2VGQ A;  3TEL A;  3PUX E;  5F1Q A;  4Q5T A;  4F2O A;  3C9H A;  4KD5 A;  3IO6 A;  4JSO A;  4XXU A;  4LON B;  4QSE A;  2FA7 A;  3USD A;  5I57 A;  4YKP A;  1I6A A;  2WKY A;  2IEE A;  4Z0I A;  5ITP A;  4LUB A;  1FQA A;  2QSX A;  2YJP A;  3PPQ A;  4X1B A;  2M8C A;  1LBB A;  3E13 X;  1MY3 A;  2I3V A;  5H8H B;  1MQJ A;  1DPP A;  4IY5 A;  5F7V A;  3EHS A;  4AB5 A;  1FQE A;  3IJX B;  4ZEB A;  1QUI A;  3OO8 A;  3TZA A;  4X1D A;  3V8X B;  4O3A A;  4ND9 A;  3HV1 A;  5DYH A;  2Z8F A;  2DXY A;  3PUV E;  2P1S A;  1B05 A;  4YU0 A;  3MQ9 A;  4ZEK A;  1GR2 A;  3TQL A;  5KDT A;  5I2K B;  3TTK A;  2PT1 A;  4U2R A;  3UGW A;  3I3V A;  3D4C A;  3FXU A;  4GFR A;  5JTY B;  4NWC A;  4BDQ A;  3MZB A;  2DVZ A;  5L8D A;  1ZTY A;  1TFD A;  3RTW B;  4MBP A;  4DXB A;  4ESX A;  4WKM A;  3S9L C;  1P1O A;  2CZL A;  3VE1 B;  3KOT A;  1B6H A;  3IK6 B;  1TXF A;  5H8N A;  1MS7 A;  2H5Y A;  3ILU B;  4ELR A;  4NF8 A;  1MXW A;  4IO3 A;  3PUY E;  3LC8 A;  3IOR A;  4ESW A;  1XVX A;  3VLW A;  2O7U A;  1PC3 A;  4U21 A;  1B3F A;  1US5 A;  1URS A;  2ZXT A;  5I84 A;  1AMF A;  5I57 B;  4H8J A;  2H9B A;  1Y4T A;  4G2Z A;  1P1N A;  3KG2 A;  2UVH A;  3LBS A;  2VOZ A;  3M3K A;  2REJ A;  4F3B A;  2CMO A;  3A3U A;  1P99 A;  3BKI B;  4FEC A;  2H99 A;  4NE4 A;  3S2V A;  2Y7P A;  1A8F A;  1MM7 A;  4RK2 A;  4DE8 A;  5BWJ A;  4OQO A;  1BKA A;  2XX7 A;  2OWT A;  1QUL A;  1Z7M E;  3TFL A;  3K0V A;  2ZNS A;  1N84 A;  4C1T A;  4QSD A;  1FCK A;  1P1Q A;  4OTE A;  1DTG A;  1FTK A;  3GBB A;  4BLA A;  4BDM A;  1F9B A;  4XKQ A;  2P2A A;  4KYD A;  4NTL A;  1B4Z A;  2F34 A;  1WVJ A;  4GOT A;  1IXC A;  4FJP A;  1OIB A;  3MAM A;  2Q88 A;  4U1O A;  1JVY A;  1A99 A;  3MP8 A;  4Z7E A;  5KDT B;  2O6A A;  1XHY A;  3HST A;  3A09 A;  2UVJ A;  4ZZE A;  4LVQ A;  3QYT A;  4KI0 E;  2DYX A;  2O1L A;  3PUW E;  2Z23 A;  2VHA A;  3N6U A;  4KFQ A;  4ZEC A;  3T9X B;  4HCW A;  4FE8 A;  5LOM A;  5AA2 D;  2HAV A;  3BBR A;  3F11 A;  3CFX A;  4DZ1 A;  4IB2 A;  1MH3 A;  5CC2 A;  4YKK A;  5DVF A;  1RYX A;  2QS1 A;  2F6G A;  5H8N B;  1EZP A;  2O69 A;  2IA4 A;  3BFU A;  3SEW A;  3S9M C;  1MXX A;  1JEU A;  4YB7 A;  2F7B A;  4ONY A;  3RPW A;  2RC8 A;  2XHD A;  1B7U A;  1B32 A;  1B51 A;  1B46 A;  4OYV A;  3PPP A;  1R1N A;  4F29 A;  3GBA A;  2Y7I A;  3KGC A;  2YLN A;  4R6Y A;  5TPA A;  3OO7 A;  5TP9 A;  2W7Y A;  5CMM A;  3EHU A;  4AQ4 A;  4MFI A;  3QUF A;  2AYS A;  3O6I A;  4N13 A;  3ECR A;  3MBP A;  3T66 A;  4JBZ A;  4KHZ E;  1VE4 A;  1LAH E;  4IO6 A;  2VD2 A;  5FTH A;  3CSG A;  4WXJ A;  1MG1 A;  1BLF A;  2GFE A;  1USY E;  3OEL A;  1NKX A;  2QJE A;  3S4U A;  2RF1 A;  2ALU A;  1BP5 A;  4KPT A;  4F1Y A;  2OZZ A;  3VXC A;  2REG A;  3O29 A;  2ONK E;  1IUD A;  1R6Z A;  2HZK A;  3G3I A;  1H3D A;  1MPC A;  3AXF A;  4OET A;  2XX9 A;  2GRV A;  3EQ1 A;  3SET A;  2ZYO A;  5IKB A;  1I6B A;  2Q9T A;  3U1O A;  3Q25 A;  4R73 A;  1MPB A;  5K2X A;  1LFH A;  1B3G A;  2F8D A;  3K6W A;  3HO7 A;  1SW4 A;  1QUJ A;  1PEB A;  1QKA A;  1JW4 A;  5FTI A;  1JQF A;  4LP2 B;  1IXH A;  1LBC A;  2R6G E;  4ZE9 A;  2ONR A;  3RT8 A;  4FEB A;  2F7C A;  3SEU A;  1Y3N A;  4OEV A;  2RC9 A;  1Z7N E;  1N7W A;  2D5W A;  4GLI A;  3C31 A;  1YAE A;  1FQD A;  3KFM A;  1JW5 A;  4BDN A;  4Q8R A;  1OLA A;  5TPA B;  2ONS A;  3UOR A;  3GLB A;  2XXI A;  5TP9 B;  1L5T A;  4PQJ A;  4EUO A;  3JV9 A;  4O3C A;  3M8U A;  1QW0 A;  2Y7W A;  3KOS A;  4JWX A;  1AOV A;  2GH9 A;  1GV8 A;  4H65 A;  1SD3 A;  2XXV A;  2F35 A;  3HHF A;  4OES A;  3KJT A;  1T0K A;  1VR5 A;  3L6H A;  4G68 C;  5H8F A;  4PFT A;  1H76 A;  4QRZ A;  4UA8 A;  4H5G A;  4NMY A;  3FZV A;  4OZ9 A;  3FXR A;  1S7Y A;  2Z8D A;  4HW8 A;  3O97 A;  3OOA A;  3T96 B;  4POW A;  2YPN A;  3FAT A;  1SQY A;  3C4M A;  3G3G A;  1XS5 A;  1IZ1 A;  4R6K A;  1M5F A;  3IR1 A;  5CRY A;  1RKM A;  3E4R A;  4GWO A;  4LZ7 A;  1DMB A;  2V93 A;  1JET A;  4EXL A;  4OHN A;  4ZZA A;  4E0X A;  3FUZ A;  5DVJ A;  3GZG A;  1FTM A;  2I58 A;  2H25 A;  4EF1 A;  1NNK A;  4OEU A;  4ISU A;  4GVO A;  3IOU A;  1Y3Q A;  3A3C A;  2XXT A;  1SW1 A;  1MXY A;  3SEV A;  3IB0 A;  3RN8 A;  1MXV A;  2F6P A;  3RT6 B;  3B6W A;  4R2B A;  5TU0 A;  4ZEF A;  5A5X A;  5L9S A;  4FIM A;  2ZYM A;  4PE5 B;  4P11 A;  2ABH A;  4DCX A;  5I58 A;  2PVU A;  1AIV A;  4PFU A;  4OFO A;  1A8E A;  5AA3 A;  3L6G A;  3H6U A;  3SEX A;  1LB9 A;  4FAJ A;  3IB2 A;  1JNF A;  2UYF A;  3EHT A;  5H8F B;  3CFL A;  2DVC A;  3K6V A;  3LUY A;  1NL5 A;  1P1U A;  2NXO A;  2VP1 A;  1LCF A;  1SYI A;  1B9J A;  3H03 A;  2FYI A;  3I6V A;  4G68 A;  1Y4C A;  1OMP A;  3KBR A;  4TQU Q;  3C33 A;  1VFE A;  5JEI A;  4EF2 A;  2ZNT A;  3O6H A;  1B1X A;  1DTZ A;  4AB6 A;  1RYO A;  3DP6 A;  2OBG A;  3OEK A;  3OXN A;  4KQP A;  3K2D A;  4F1U A;  5K2Y A;  2DS9 A;  2E0S A;  4U22 A;  2VD3 A;  4E0W A;  2ZYK A;  3O9P A;  5DVI A;  2X7P A;  1NH8 A;  5A5X B;  1B40 A;  4EQ9 A;  1O63 A;  3IJO B;  2UXA A;  2XXY A;  3CIJ A;  5I58 B;  2X7Q A;  2I49 A;  5I2N A;  1M5E A;  5B70 A;  1PBP A;  1SVX B;  3PU5 A;  4LZ8 A;  4PFW A;  5CM6 A;  4P0I A;  3OMB A;  4BDR A;  3K1N A;  1LAG E;  3MWB A;  3C34 A;  3QXM A;  3U92 A;  3MVY A;  4XKR A;  3V89 B;  2OK2 A;  3C35 A;  5EHM A;  4XIG Q;  2O51 A;  4QFK A;  1I6Q A;  4LQ2 A;  4K3F A;  2DXR A;  2DOJ A;  1SDX A;  4G68 B;  5CI5 A;  3KJ7 A;  1AH5 A;  1S50 A;  4XKP A;  1FQF A;  4QFO A;  2DE3 A;  1UIU A;  3PD8 A;  3M3F A;  5L9O A;  2B65 A;  4Q0C A;  1A7L A;  4KYE A;  1SI1 A;  3CI8 A;  3MPK A;  3OD7 A;  3TCH A;  2UVG A;  1B7Z A;  1LAX A;  3QIM A;  4JWY A;  3TDJ A;  1FTJ A;  2UVI A;  2F7A A;  4M1V A;  3K02 A;  4U1Z A;  4RNS A;  1PB7 A;  4RY1 A;  2NOO A;  4F3G A;  1TFA A;  3EN3 A;  2DWH A;  1LFI A;  5HBC A;  2R71 A;  2QS3 A;  3W9V A;  4NF8 B;  3TTR A;  3VVF A;  4GF8 A;  3T9U A;  2V84 A;  4IO4 A;  4FOR A;  2FNC A;  1IIT A;  5HM4 B;  4F18 A;  1FQC A;  2Q8J A;  5FHM A;  1EZO A;  4IO5 A;  4ZDM A;  3S9E A;  1H44 A;  5DTB A;  1MQD A;  5I2N B;  1DSN A;  2RIN A;  3O2A A;  4U4X A;  4DDD A;  3E9X A;  2NUV A;  3DEL B;  3MP1 A;  3V83 A;  4WEP A;  2XXP A;  2OJT A;  1SW5 A;  1XVY A;  3MZ9 A;  3Q28 A;  3R6U A;  1SBP A;  2DSF A;  4ZEI A;  1UTB A;  3TTL A;  1WOD A;  3FXQ A;  4GL0 A;  2V3T A;  1EH3 A;  3UK4 A;  3MVX A;  5CBR A;  2O68 A;  1JVX A;  5DEX A;  1DOT A;  1B2H A;  1QKB A;  3LR1 A;  1ZIU A;  3CVG A;  3QUJ A;  2XXW A;  1YTV A;  4RYA A;  1B5H A;  3G3K A;  3R26 A;  3G3J A;  1MY0 A;  4R2F A;  3B7D A;  4G8H A;  3O28 A;  3H3G A;  4DXU A;  2B3B A;  1ZLQ A;  2PMS A;  2HXW A;  4WED A;  3LSW A;  2ZMB A;  4NED A;  1B3H A;  4DXC A;  3OO9 A;  1R9L A;  1MDP 1;  1MXU A;  4YIC A;  1POT A;  4TLL B;  3VXB A;  3ZKK A;  4NF4 A;  4LZ5 A;  5IAI A;  2XXR A;  3MZ1 A;  4YAH X;  4KCD A;  1B3E A;  4FAT A;  3UIF A;  2XXH A;  4G77 A;  4OVJ A;  3UP9 A;  4H67 A;  3G7W A;  1EZ9 A;  3HCQ A;  2Q89 A;  3CG1 A;  4QF9 A;  1OVT A;  1USY H;  5AA2 A;  3PUZ E;  2PT2 A;  3V5A A;  4IY6 A;  1Y20 A;  1NNF A;  1NNP A;  2A5T A;  1H43 A;  3FIR A;  2H98 A;  4F3S A;  1JW1 A;  2HQ0 A;  1OQH A;  1PDA A;  3D4G A;  1TT1 A;  1UTB B;  4POX A;  3H6T A;  2QL3 A;  2DQV A;  4TOZ A;  4RPO A;  1N0T A;  5DEX B;  5B7D A;  5ITO A;  1HSJ A;  1IXG A;  3U94 A;  4F19 A;  3K1P A;  3TYH A;  1TWY A;  5ICT A;  5ELV A;  3TOD A;  1D4N A;  1AL3 A;  1PB8 A;  3PPN A;  1VFD A;  4OMB A;  5J1D A;  2O7I A;  3PMW A;  1B7H A;  2RCA A;  3H4Z A;  1CB6 A;  2QPQ A;  4R6H A;  3IO4 A;  1B1H A;  4EDP A;  2Z22 A;  3IOT A;  3OSR A;  2O1M A;  1URD A;  2I4B A;  1XT8 A;  1SYH A;  4NF4 B;  2B3F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...