4FEKA

Crystal structure of putative diflavin flavoprotein a 5 (fragment 1-254) from nostoc sp. pcc 7120, northeast structural genomics consortium target nsr435a , northeast structural genomics consortium (nesg) target nsr435a
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
255
structure length
252
Chain Sequence
b'KPRDVQVLPIATNTKVLRARSWSRLRFEIEYALERGTTSNSYVIEGDKTAIIDPPVESFMKIYLEALQQTVNLKKLDYVILGHFSPNRIPTFKALLELAPQITFVCSLPAAGDLRAAFPDDNLNILPMRGKETLDLGKGHVLKFLPIPSPRWPAGLCTYDVQTQILYTDKIFGAHICGDDVFDESFKEDQRYYFNCLMAPHAIHVEAALEKISDLQVRLYAVGHGPLVRTSLIALTQAYADWSKAQKLEHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative diflavin flavoprotein A 5
publication title Northeast Structural Genomics Consortium Target NsR435A
rcsb
source organism Nostoc sp. pcc 7120
molecule tags Oxidoreductase
total genus 75
structure length 252
sequence length 255
chains with identical sequence B
ec nomenclature ec 1.-.-.-:
pdb deposition date 2012-05-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.60.15.10 Alpha Beta 4-Layer Sandwich Metallo-beta-lactamase; Chain A Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 4fekA00
4RL0A 2I7TA 2P97A 4TYTA 5EWAA 4UWPB 2Q0JA 4XWWA 2ZO4A 5HIQA 3ZNBA 2BGAA 3F9OA 2QDTA 2FHXA 4PVTA 3DH8A 1SMLA 3ZR9A 3DHAA 2WYMC 2Y8AA 1XTOA 5AYAA 3PG4A 4LE6A 2P18A 4ZEJA 4Z5YA 2BTNA 5A0VA 4Z7RA 5FQAA 4GCWA 5LS3A 2P1EA 4D1VA 4EXYA 2NXAA 5AXOA 5DPXA 2CBNA 2WRSA 2BG6A 5AXRA 4RL2A 1DXKA 3IE2A 4HKYA 4EYLA 1BMCA 5IQKA 2Y87A 4ZO3A 5FQCA 5LMCA 1X8IA 3IEKA 4BP0A 3RPCA 5K4NA 2BG2A 3ZWFA 4Z67A 4D02A 3IE0A 4CHLA 5EH9A 5FQBA 5A87A 2A7MA 2YNTA 2GKLA 4RM5A 4UWSB 5LCFA 4Z6XA 2BFZB 4WD6A 5B3RA 4AD9A 4FEKA 4NQ2A 2NZFA 3DHBA 1JJTA 4AX1B 2E7YA 5LM6A 1YCHA 3I0VA 3X30A 3R2UA 4AX0B 1HLKA 1M2XA 5A5ZA 4ZNBA 5EVDA 2BIBA 4D1WA 1VGNA 3BC2A 2BC2A 5ACXA 1ZKPA 4H0DA 4YSBA 1WW1A 3IDZA 2FU7A 1QH3A 4Z60A 4YSLA 4EY2A 2YNVB 3RKJA 2ZNBA 5K4KA 3PY6A 5LCAA 1QH5A 2WYLA 1JJEA 3ZQ4A 2WHGA 2BFKA 2DOOA 4C09A 5ACWA 3AF6A 4TZEA 3T9MA 3WXCA 3KNRA 4ZO2A 5LE1A 2M5CA 2VW8A 3S0ZA 2QDSA 5AHOA 2BG8B 3I14A 4RAMA 2QJSA 2QEDA 2Q0IA 3SPUA 3SFPA 4YSKA 2QINA 3SRXA 3IELA 1VMEA 2XF4A 1P9EA 2I7XA 3KNSA 4DILA 4U4LA 2FM6A 5AEBA 2FK6A 3A4YA 5EW0A 4C1EA 3BK2A 2WYMA 3QH8A 2AZ4A 3BV6A 5EVKA 3IOFA 3H3EA 2GFJA 5A0TA 5ACRA 4AWZA 4PVOA 4JO0A 1BC2A 1WUOA 4NQ5A 4UWRB 4XUKA 2FHXB 1Y44A 1WUPA 2I7VA 1XM8A 4J5HA 1A8TA 3T3NA 4HL1A 3KL7A 5HIPA 3MD7A 3AJ3A 3ESHA 2GMNA 5ACSA 5ACPA 3ADRA 3AF5A 3IE1A 3L6NA 1VJNA 5EV6A 2OHIA 2Q42A 2FU8A 1DDKA 4AWYB 3FAIA 5KILA 4D1UA 5EHTA 4GYQA 4GYUA 2Q9UA 4FR7A 5K0WA 5B1UA 2DKFA 3BK1A 2ZZIA 5HISA 5KIKA 4RAWA 3TP9A 4TYFA 1KR3A 1A7TA 2R2DA 4C1FA 5K4MA 1ZTCA 5ACUA 3SBLA 1X8HA 1ZNBA 3X2ZA 2YNTB 1MQOA 2OHJA 2BG7A 4BZ3A 1KO3A 4TZ9A 2BFZA 4EYBA 3SW3A 2P4ZA 3IOGA 2YCBA 4D1TA 4KEPA 2FU9A 2NZEA 1WRAA 3JXPA 2Y8BA 2AIOA 5HH5A 1E5DA 3DHCA 2UYXA 2BFLA 3RKKA 4C1GA 1L9YA 3LVZA 4B87A 2FU6A 4RBSA 3I15A 4NQ6A 3I11A 1K07A 1JT1A 2ZWRA 5AHRA 3FCZA 1YCGA 5EVBA 4C1CA 4P62A 3PY5A 4KEQA 4C1HA 4C1DA 4EXSA 4O98A 2GCUA 2YNVA 4F6HA 4UWOB 4J5FA 4EYFA 3SD9A 3VPEA 2OHHA 4TZBA 4UBQA 4FSBA 4V0HA 5LLDA 4XWTA 2BMIA 5EV8A 1X8GA 2HB9A 5ACQA 4HL2A 1YCFA 2XR1A 1KO2A 2BG8A 3G1PA 5HIOA 1BVTA 3VQZA 4DIKA 4TZFA 2YNWA 4NQ4A 4UA4A 3P2UA 4F6ZA 5LCHA 2NYPA 3X2YA 3I13A 5B15A 5HH6A 2YZ3A 4Z5ZA 2M5DA 5ACVA 3X2XA 4EFZA 3Q6VA 2YNUA 5LSCA 2GFKA 3T3OA 3IEMA 1DD6A 2H6AA 5ACTA 2BR6A 5HH4A 4UAMA
chains in the Genus database with same CATH superfamily
4RL0A 2I7TA 2P97A 4TYTA 5EWAA 4UWPB 2Q0JA 4XWWA 2ZO4A 5HIQA 3ZNBA 2BGAA 3F9OA 2QDTA 2FHXA 4PVTA 3DH8A 1SMLA 3ZR9A 3DHAA 2WYMC 2Y8AA 1XTOA 5AYAA 3PG4A 4LE6A 2P18A 4ZEJA 4Z5YA 2BTNA 5A0VA 4Z7RA 5FQAA 4GCWA 5LS3A 2P1EA 4D1VA 4EXYA 2NXAA 5AXOA 5DPXA 2CBNA 2WRSA 2BG6A 5AXRA 4RL2A 1DXKA 3IE2A 4HKYA 4EYLA 1BMCA 5IQKA 2Y87A 4ZO3A 5FQCA 5LMCA 1X8IA 3IEKA 4BP0A 3RPCA 4AXHA 5K4NA 2BG2A 3ZWFA 4Z67A 4D02A 3IE0A 4CHLA 5EH9A 5FQBA 5A87A 2A7MA 2YNTA 2GKLA 4RM5A 4UWSB 5LCFA 4Z6XA 2BFZB 4WD6A 5B3RA 4AD9A 4FEKA 4NQ2A 2NZFA 3DHBA 1JJTA 4AX1B 2E7YA 2CG2A 5LM6A 1YCHA 3I0VA 3X30A 3R2UA 4AX0B 1HLKA 4PDXA 1M2XA 5A5ZA 4ZNBA 5EVDA 2BIBA 4D1WA 1VGNA 4NURA 3BC2A 2BC2A 5ACXA 1ZKPA 4H0DA 4YSBA 1WW1A 3IDZA 2FU7A 1QH3A 4Z60A 4YSLA 4EY2A 2YNVB 3RKJA 2ZNBA 5K4KA 3PY6A 5LCAA 1QH5A 2WYLA 1JJEA 3ZQ4A 2WHGA 2BFKA 2DOOA 4C09A 5ACWA 3AF6A 4TZEA 3T9MA 3WXCA 3KNRA 4ZO2A 5LE1A 2M5CA 2VW8A 3S0ZA 2QDSA 5AHOA 2BG8B 3I14A 4RAMA 2QJSA 2QEDA 2Q0IA 3SPUA 3SFPA 4YSKA 2QINA 2YHEA 3SRXA 3IELA 1VMEA 2XF4A 1P9EA 2I7XA 3KNSA 4DILA 4U4LA 2FM6A 5AEBA 2FK6A 3A4YA 5EW0A 4C1EA 3BK2A 2WYMA 3QH8A 2AZ4A 3BV6A 5EVKA 3IOFA 3H3EA 2GFJA 5A0TA 5ACRA 4AWZA 4PVOA 4JO0A 1BC2A 2CFUA 1WUOA 4NQ5A 4UWRB 4XUKA 2FHXB 1Y44A 1WUPA 2I7VA 1XM8A 4J5HA 1A8TA 3T3NA 4HL1A 3KL7A 5HIPA 3MD7A 3AJ3A 3ESHA 2GMNA 5ACSA 5ACPA 3ADRA 3AF5A 3IE1A 3L6NA 1VJNA 5EV6A 2OHIA 2Q42A 2FU8A 1DDKA 4AWYB 3FAIA 5KILA 4D1UA 5EHTA 4GYQA 4GYUA 2Q9UA 4FR7A 5K0WA 5B1UA 5AIJA 2DKFA 3BK1A 2ZZIA 5HISA 2CFZA 5KIKA 4RAWA 4AV7A 3TP9A 4TYFA 5AJLA 1KR3A 1A7TA 2R2DA 4C1FA 5K4MA 1ZTCA 5ACUA 3SBLA 1X8HA 1ZNBA 3X2ZA 2YNTB 1MQOA 2OHJA 2BG7A 4BZ3A 1KO3A 4TZ9A 2BFZA 2CG3A 4EYBA 3SW3A 2P4ZA 3IOGA 2YCBA 4D1TA 4KEPA 2FU9A 2NZEA 5A23A 1WRAA 3JXPA 2Y8BA 2AIOA 5HH5A 1E5DA 3DHCA 2UYXA 2BFLA 3RKKA 4C1GA 1L9YA 3LVZA 4B87A 2FU6A 4RBSA 3I15A 4NQ6A 3I11A 1K07A 1JT1A 2ZWRA 5AHRA 3FCZA 1YCGA 5EVBA 4C1CA 4P62A 3PY5A 4KEQA 4C1HA 4C1DA 4EXSA 4O98A 2GCUA 2YNVA 4F6HA 4UWOB 4J5FA 4EYFA 3SD9A 3VPEA 2OHHA 4TZBA 4UBQA 4FSBA 4V0HA 5LLDA 4XWTA 2BMIA 5EV8A 1X8GA 2HB9A 5ACQA 4HL2A 1YCFA 2XR1A 1KO2A 2BG8A 3G1PA 5HIOA 1BVTA 3VQZA 4DIKA 4TZFA 2YNWA 4NQ4A 4UA4A 3P2UA 4F6ZA 5LCHA 2NYPA 3X2YA 3I13A 5B15A 5HH6A 2YZ3A 4Z5ZA 2M5DA 5ACVA 3X2XA 4EFZA 3Q6VA 2YNUA 5LSCA 2GFKA 3T3OA 3IEMA 1DD6A 2H6AA 5ACTA 2BR6A 5HH4A 4UAMA
chains in the Genus database with same CATH topology
4RL0A 2I7TA 2P97A 4TYTA 5EWAA 4UWPB 2Q0JA 4XWWA 2ZO4A 5HIQA 3ZNBA 2BGAA 3F9OA 2QDTA 2FHXA 4PVTA 3DH8A 1SMLA 3ZR9A 3DHAA 2WYMC 2Y8AA 1XTOA 5AYAA 3PG4A 4LE6A 2P18A 4ZEJA 4Z5YA 2BTNA 5A0VA 4Z7RA 5FQAA 4GCWA 5LS3A 2P1EA 4D1VA 4EXYA 2NXAA 5AXOA 5DPXA 2CBNA 2WRSA 2BG6A 5AXRA 4RL2A 1DXKA 3IE2A 4HKYA 4EYLA 1BMCA 5IQKA 2Y87A 4ZO3A 5FQCA 5LMCA 1X8IA 3IEKA 4BP0A 3RPCA 5K4NA 2BG2A 3ZWFA 4Z67A 4D02A 3IE0A 4CHLA 5EH9A 5FQBA 5A87A 2A7MA 2YNTA 2GKLA 4RM5A 4UWSB 5LCFA 4Z6XA 2BFZB 4WD6A 5B3RA 4AD9A 4FEKA 4NQ2A 2NZFA 3DHBA 1JJTA 4AX1B 2E7YA 5LM6A 1YCHA 3I0VA 3X30A 3R2UA 4AX0B 1HLKA 1M2XA 5A5ZA 4ZNBA 5EVDA 2BIBA 4D1WA 1VGNA 3BC2A 2BC2A 5ACXA 1ZKPA 4H0DA 4YSBA 1WW1A 3IDZA 2FU7A 1QH3A 4Z60A 4YSLA 4EY2A 2YNVB 3RKJA 2ZNBA 5K4KA 3PY6A 5LCAA 1QH5A 2WYLA 1JJEA 3ZQ4A 2WHGA 2BFKA 2DOOA 4C09A 5ACWA 3AF6A 4TZEA 3T9MA 3WXCA 3KNRA 4ZO2A 5LE1A 2M5CA 2VW8A 3S0ZA 2QDSA 5AHOA 2BG8B 3I14A 4RAMA 2QJSA 2QEDA 2Q0IA 3SPUA 3SFPA 4YSKA 2QINA 3SRXA 3IELA 1VMEA 2XF4A 1P9EA 2I7XA 3KNSA 4DILA 4U4LA 2FM6A 5AEBA 2FK6A 3A4YA 5EW0A 4C1EA 3BK2A 2WYMA 3QH8A 2AZ4A 3BV6A 5EVKA 3IOFA 3H3EA 2GFJA 5A0TA 5ACRA 4AWZA 4PVOA 4JO0A 1BC2A 1WUOA 4NQ5A 4UWRB 4XUKA 2FHXB 1Y44A 1WUPA 2I7VA 1XM8A 4J5HA 1A8TA 3T3NA 4HL1A 3KL7A 5HIPA 3MD7A 3AJ3A 3ESHA 2GMNA 5ACSA 5ACPA 3ADRA 3AF5A 3IE1A 3L6NA 1VJNA 5EV6A 2OHIA 2Q42A 2FU8A 1DDKA 4AWYB 3FAIA 5KILA 4D1UA 5EHTA 4GYQA 4GYUA 2Q9UA 4FR7A 5K0WA 5B1UA 2DKFA 3BK1A 2ZZIA 5HISA 5KIKA 4RAWA 3TP9A 4TYFA 1KR3A 1A7TA 2R2DA 4C1FA 5K4MA 1ZTCA 5ACUA 3SBLA 1X8HA 1ZNBA 3X2ZA 2YNTB 1MQOA 2OHJA 2BG7A 4BZ3A 1KO3A 4TZ9A 2BFZA 4EYBA 3SW3A 2P4ZA 3IOGA 2YCBA 4D1TA 4KEPA 2FU9A 2NZEA 1WRAA 3JXPA 2Y8BA 2AIOA 5HH5A 1E5DA 3DHCA 2UYXA 2BFLA 3RKKA 4C1GA 1L9YA 3LVZA 4B87A 2FU6A 4RBSA 3I15A 4NQ6A 3I11A 1K07A 1JT1A 2ZWRA 5AHRA 3FCZA 1YCGA 5EVBA 4C1CA 4P62A 3PY5A 4KEQA 4C1HA 4C1DA 4EXSA 4O98A 2GCUA 2YNVA 4F6HA 4UWOB 4J5FA 4EYFA 3SD9A 3VPEA 2OHHA 4TZBA 4UBQA 4FSBA 4V0HA 5LLDA 4XWTA 2BMIA 5EV8A 1X8GA 2HB9A 5ACQA 4HL2A 1YCFA 2XR1A 1KO2A 2BG8A 3G1PA 5HIOA 1BVTA 3VQZA 4DIKA 4TZFA 2YNWA 4NQ4A 4UA4A 3P2UA 4F6ZA 5LCHA 2NYPA 3X2YA 3I13A 5B15A 5HH6A 2YZ3A 4Z5ZA 2M5DA 5ACVA 3X2XA 4EFZA 3Q6VA 2YNUA 5LSCA 2GFKA 3T3OA 3IEMA 1DD6A 2H6AA 5ACTA 2BR6A 5HH4A 4UAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RL0 A;  2I7T A;  2P97 A;  4TYT A;  5EWA A;  4UWP B;  2Q0J A;  4XWW A;  2ZO4 A;  5HIQ A;  3ZNB A;  2BGA A;  3F9O A;  2QDT A;  2FHX A;  4PVT A;  3DH8 A;  1SML A;  3ZR9 A;  3DHA A;  2WYM C;  2Y8A A;  1XTO A;  5AYA A;  3PG4 A;  4LE6 A;  2P18 A;  4ZEJ A;  4Z5Y A;  2BTN A;  5A0V A;  4Z7R A;  5FQA A;  4GCW A;  5LS3 A;  2P1E A;  4D1V A;  4EXY A;  2NXA A;  5AXO A;  5DPX A;  2CBN A;  2WRS A;  2BG6 A;  5AXR A;  4RL2 A;  1DXK A;  3IE2 A;  4HKY A;  4EYL A;  1BMC A;  5IQK A;  2Y87 A;  4ZO3 A;  5FQC A;  5LMC A;  1X8I A;  3IEK A;  4BP0 A;  3RPC A;  5K4N A;  2BG2 A;  3ZWF A;  4Z67 A;  4D02 A;  3IE0 A;  4CHL A;  5EH9 A;  5FQB A;  5A87 A;  2A7M A;  2YNT A;  2GKL A;  4RM5 A;  4UWS B;  5LCF A;  4Z6X A;  2BFZ B;  4WD6 A;  5B3R A;  4AD9 A;  4FEK A;  4NQ2 A;  2NZF A;  3DHB A;  1JJT A;  4AX1 B;  2E7Y A;  5LM6 A;  1YCH A;  3I0V A;  3X30 A;  3R2U A;  4AX0 B;  1HLK A;  1M2X A;  5A5Z A;  4ZNB A;  5EVD A;  2BIB A;  4D1W A;  1VGN A;  3BC2 A;  2BC2 A;  5ACX A;  1ZKP A;  4H0D A;  4YSB A;  1WW1 A;  3IDZ A;  2FU7 A;  1QH3 A;  4Z60 A;  4YSL A;  4EY2 A;  2YNV B;  3RKJ A;  2ZNB A;  5K4K A;  3PY6 A;  5LCA A;  1QH5 A;  2WYL A;  1JJE A;  3ZQ4 A;  2WHG A;  2BFK A;  2DOO A;  4C09 A;  5ACW A;  3AF6 A;  4TZE A;  3T9M A;  3WXC A;  3KNR A;  4ZO2 A;  5LE1 A;  2M5C A;  2VW8 A;  3S0Z A;  2QDS A;  5AHO A;  2BG8 B;  3I14 A;  4RAM A;  2QJS A;  2QED A;  2Q0I A;  3SPU A;  3SFP A;  4YSK A;  2QIN A;  3SRX A;  3IEL A;  1VME A;  2XF4 A;  1P9E A;  2I7X A;  3KNS A;  4DIL A;  4U4L A;  2FM6 A;  5AEB A;  2FK6 A;  3A4Y A;  5EW0 A;  4C1E A;  3BK2 A;  2WYM A;  3QH8 A;  2AZ4 A;  3BV6 A;  5EVK A;  3IOF A;  3H3E A;  2GFJ A;  5A0T A;  5ACR A;  4AWZ A;  4PVO A;  4JO0 A;  1BC2 A;  1WUO A;  4NQ5 A;  4UWR B;  4XUK A;  2FHX B;  1Y44 A;  1WUP A;  2I7V A;  1XM8 A;  4J5H A;  1A8T A;  3T3N A;  4HL1 A;  3KL7 A;  5HIP A;  3MD7 A;  3AJ3 A;  3ESH A;  2GMN A;  5ACS A;  5ACP A;  3ADR A;  3AF5 A;  3IE1 A;  3L6N A;  1VJN A;  5EV6 A;  2OHI A;  2Q42 A;  2FU8 A;  1DDK A;  4AWY B;  3FAI A;  5KIL A;  4D1U A;  5EHT A;  4GYQ A;  4GYU A;  2Q9U A;  4FR7 A;  5K0W A;  5B1U A;  2DKF A;  3BK1 A;  2ZZI A;  5HIS A;  5KIK A;  4RAW A;  3TP9 A;  4TYF A;  1KR3 A;  1A7T A;  2R2D A;  4C1F A;  5K4M A;  1ZTC A;  5ACU A;  3SBL A;  1X8H A;  1ZNB A;  3X2Z A;  2YNT B;  1MQO A;  2OHJ A;  2BG7 A;  4BZ3 A;  1KO3 A;  4TZ9 A;  2BFZ A;  4EYB A;  3SW3 A;  2P4Z A;  3IOG A;  2YCB A;  4D1T A;  4KEP A;  2FU9 A;  2NZE A;  1WRA A;  3JXP A;  2Y8B A;  2AIO A;  5HH5 A;  1E5D A;  3DHC A;  2UYX A;  2BFL A;  3RKK A;  4C1G A;  1L9Y A;  3LVZ A;  4B87 A;  2FU6 A;  4RBS A;  3I15 A;  4NQ6 A;  3I11 A;  1K07 A;  1JT1 A;  2ZWR A;  5AHR A;  3FCZ A;  1YCG A;  5EVB A;  4C1C A;  4P62 A;  3PY5 A;  4KEQ A;  4C1H A;  4C1D A;  4EXS A;  4O98 A;  2GCU A;  2YNV A;  4F6H A;  4UWO B;  4J5F A;  4EYF A;  3SD9 A;  3VPE A;  2OHH A;  4TZB A;  4UBQ A;  4FSB A;  4V0H A;  5LLD A;  4XWT A;  2BMI A;  5EV8 A;  1X8G A;  2HB9 A;  5ACQ A;  4HL2 A;  1YCF A;  2XR1 A;  1KO2 A;  2BG8 A;  3G1P A;  5HIO A;  1BVT A;  3VQZ A;  4DIK A;  4TZF A;  2YNW A;  4NQ4 A;  4UA4 A;  3P2U A;  4F6Z A;  5LCH A;  2NYP A;  3X2Y A;  3I13 A;  5B15 A;  5HH6 A;  2YZ3 A;  4Z5Z A;  2M5D A;  5ACV A;  3X2X A;  4EFZ A;  3Q6V A;  2YNU A;  5LSC A;  2GFK A;  3T3O A;  3IEM A;  1DD6 A;  2H6A A;  5ACT A;  2BR6 A;  5HH4 A;  4UAM A; 
#chains in the Genus database with same CATH topology
 4RL0 A;  2I7T A;  2P97 A;  4TYT A;  5EWA A;  4UWP B;  2Q0J A;  4XWW A;  2ZO4 A;  5HIQ A;  3ZNB A;  2BGA A;  3F9O A;  2QDT A;  2FHX A;  4PVT A;  3DH8 A;  1SML A;  3ZR9 A;  3DHA A;  2WYM C;  2Y8A A;  1XTO A;  5AYA A;  3PG4 A;  4LE6 A;  2P18 A;  4ZEJ A;  4Z5Y A;  2BTN A;  5A0V A;  4Z7R A;  5FQA A;  4GCW A;  5LS3 A;  2P1E A;  4D1V A;  4EXY A;  2NXA A;  5AXO A;  5DPX A;  2CBN A;  2WRS A;  2BG6 A;  5AXR A;  4RL2 A;  1DXK A;  3IE2 A;  4HKY A;  4EYL A;  1BMC A;  5IQK A;  2Y87 A;  4ZO3 A;  5FQC A;  5LMC A;  1X8I A;  3IEK A;  4BP0 A;  3RPC A;  4AXH A;  5K4N A;  2BG2 A;  3ZWF A;  4Z67 A;  4D02 A;  3IE0 A;  4CHL A;  5EH9 A;  5FQB A;  5A87 A;  2A7M A;  2YNT A;  2GKL A;  4RM5 A;  4UWS B;  5LCF A;  4Z6X A;  2BFZ B;  4WD6 A;  5B3R A;  4AD9 A;  4FEK A;  4NQ2 A;  2NZF A;  3DHB A;  1JJT A;  4AX1 B;  2E7Y A;  2CG2 A;  5LM6 A;  1YCH A;  3I0V A;  3X30 A;  3R2U A;  4AX0 B;  1HLK A;  4PDX A;  1M2X A;  5A5Z A;  4ZNB A;  5EVD A;  2BIB A;  4D1W A;  1VGN A;  4NUR A;  3BC2 A;  2BC2 A;  5ACX A;  1ZKP A;  4H0D A;  4YSB A;  1WW1 A;  3IDZ A;  2FU7 A;  1QH3 A;  4Z60 A;  4YSL A;  4EY2 A;  2YNV B;  3RKJ A;  2ZNB A;  5K4K A;  3PY6 A;  5LCA A;  1QH5 A;  2WYL A;  1JJE A;  3ZQ4 A;  2WHG A;  2BFK A;  2DOO A;  4C09 A;  5ACW A;  3AF6 A;  4TZE A;  3T9M A;  3WXC A;  3KNR A;  4ZO2 A;  5LE1 A;  2M5C A;  2VW8 A;  3S0Z A;  2QDS A;  5AHO A;  2BG8 B;  3I14 A;  4RAM A;  2QJS A;  2QED A;  2Q0I A;  3SPU A;  3SFP A;  4YSK A;  2QIN A;  2YHE A;  3SRX A;  3IEL A;  1VME A;  2XF4 A;  1P9E A;  2I7X A;  3KNS A;  4DIL A;  4U4L A;  2FM6 A;  5AEB A;  2FK6 A;  3A4Y A;  5EW0 A;  4C1E A;  3BK2 A;  2WYM A;  3QH8 A;  2AZ4 A;  3BV6 A;  5EVK A;  3IOF A;  3H3E A;  2GFJ A;  5A0T A;  5ACR A;  4AWZ A;  4PVO A;  4JO0 A;  1BC2 A;  2CFU A;  1WUO A;  4NQ5 A;  4UWR B;  4XUK A;  2FHX B;  1Y44 A;  1WUP A;  2I7V A;  1XM8 A;  4J5H A;  1A8T A;  3T3N A;  4HL1 A;  3KL7 A;  5HIP A;  3MD7 A;  3AJ3 A;  3ESH A;  2GMN A;  5ACS A;  5ACP A;  3ADR A;  3AF5 A;  3IE1 A;  3L6N A;  1VJN A;  5EV6 A;  2OHI A;  2Q42 A;  2FU8 A;  1DDK A;  4AWY B;  3FAI A;  5KIL A;  4D1U A;  5EHT A;  4GYQ A;  4GYU A;  2Q9U A;  4FR7 A;  5K0W A;  5B1U A;  5AIJ A;  2DKF A;  3BK1 A;  2ZZI A;  5HIS A;  2CFZ A;  5KIK A;  4RAW A;  4AV7 A;  3TP9 A;  4TYF A;  5AJL A;  1KR3 A;  1A7T A;  2R2D A;  4C1F A;  5K4M A;  1ZTC A;  5ACU A;  3SBL A;  1X8H A;  1ZNB A;  3X2Z A;  2YNT B;  1MQO A;  2OHJ A;  2BG7 A;  4BZ3 A;  1KO3 A;  4TZ9 A;  2BFZ A;  2CG3 A;  4EYB A;  3SW3 A;  2P4Z A;  3IOG A;  2YCB A;  4D1T A;  4KEP A;  2FU9 A;  2NZE A;  5A23 A;  1WRA A;  3JXP A;  2Y8B A;  2AIO A;  5HH5 A;  1E5D A;  3DHC A;  2UYX A;  2BFL A;  3RKK A;  4C1G A;  1L9Y A;  3LVZ A;  4B87 A;  2FU6 A;  4RBS A;  3I15 A;  4NQ6 A;  3I11 A;  1K07 A;  1JT1 A;  2ZWR A;  5AHR A;  3FCZ A;  1YCG A;  5EVB A;  4C1C A;  4P62 A;  3PY5 A;  4KEQ A;  4C1H A;  4C1D A;  4EXS A;  4O98 A;  2GCU A;  2YNV A;  4F6H A;  4UWO B;  4J5F A;  4EYF A;  3SD9 A;  3VPE A;  2OHH A;  4TZB A;  4UBQ A;  4FSB A;  4V0H A;  5LLD A;  4XWT A;  2BMI A;  5EV8 A;  1X8G A;  2HB9 A;  5ACQ A;  4HL2 A;  1YCF A;  2XR1 A;  1KO2 A;  2BG8 A;  3G1P A;  5HIO A;  1BVT A;  3VQZ A;  4DIK A;  4TZF A;  2YNW A;  4NQ4 A;  4UA4 A;  3P2U A;  4F6Z A;  5LCH A;  2NYP A;  3X2Y A;  3I13 A;  5B15 A;  5HH6 A;  2YZ3 A;  4Z5Z A;  2M5D A;  5ACV A;  3X2X A;  4EFZ A;  3Q6V A;  2YNU A;  5LSC A;  2GFK A;  3T3O A;  3IEM A;  1DD6 A;  2H6A A;  5ACT A;  2BR6 A;  5HH4 A;  4UAM A; 
#chains in the Genus database with same CATH homology
 4RL0 A;  2I7T A;  2P97 A;  4TYT A;  5EWA A;  4UWP B;  2Q0J A;  4XWW A;  2ZO4 A;  5HIQ A;  3ZNB A;  2BGA A;  3F9O A;  2QDT A;  2FHX A;  4PVT A;  3DH8 A;  1SML A;  3ZR9 A;  3DHA A;  2WYM C;  2Y8A A;  1XTO A;  5AYA A;  3PG4 A;  4LE6 A;  2P18 A;  4ZEJ A;  4Z5Y A;  2BTN A;  5A0V A;  4Z7R A;  5FQA A;  4GCW A;  5LS3 A;  2P1E A;  4D1V A;  4EXY A;  2NXA A;  5AXO A;  5DPX A;  2CBN A;  2WRS A;  2BG6 A;  5AXR A;  4RL2 A;  1DXK A;  3IE2 A;  4HKY A;  4EYL A;  1BMC A;  5IQK A;  2Y87 A;  4ZO3 A;  5FQC A;  5LMC A;  1X8I A;  3IEK A;  4BP0 A;  3RPC A;  5K4N A;  2BG2 A;  3ZWF A;  4Z67 A;  4D02 A;  3IE0 A;  4CHL A;  5EH9 A;  5FQB A;  5A87 A;  2A7M A;  2YNT A;  2GKL A;  4RM5 A;  4UWS B;  5LCF A;  4Z6X A;  2BFZ B;  4WD6 A;  5B3R A;  4AD9 A;  4FEK A;  4NQ2 A;  2NZF A;  3DHB A;  1JJT A;  4AX1 B;  2E7Y A;  5LM6 A;  1YCH A;  3I0V A;  3X30 A;  3R2U A;  4AX0 B;  1HLK A;  1M2X A;  5A5Z A;  4ZNB A;  5EVD A;  2BIB A;  4D1W A;  1VGN A;  3BC2 A;  2BC2 A;  5ACX A;  1ZKP A;  4H0D A;  4YSB A;  1WW1 A;  3IDZ A;  2FU7 A;  1QH3 A;  4Z60 A;  4YSL A;  4EY2 A;  2YNV B;  3RKJ A;  2ZNB A;  5K4K A;  3PY6 A;  5LCA A;  1QH5 A;  2WYL A;  1JJE A;  3ZQ4 A;  2WHG A;  2BFK A;  2DOO A;  4C09 A;  5ACW A;  3AF6 A;  4TZE A;  3T9M A;  3WXC A;  3KNR A;  4ZO2 A;  5LE1 A;  2M5C A;  2VW8 A;  3S0Z A;  2QDS A;  5AHO A;  2BG8 B;  3I14 A;  4RAM A;  2QJS A;  2QED A;  2Q0I A;  3SPU A;  3SFP A;  4YSK A;  2QIN A;  3SRX A;  3IEL A;  1VME A;  2XF4 A;  1P9E A;  2I7X A;  3KNS A;  4DIL A;  4U4L A;  2FM6 A;  5AEB A;  2FK6 A;  3A4Y A;  5EW0 A;  4C1E A;  3BK2 A;  2WYM A;  3QH8 A;  2AZ4 A;  3BV6 A;  5EVK A;  3IOF A;  3H3E A;  2GFJ A;  5A0T A;  5ACR A;  4AWZ A;  4PVO A;  4JO0 A;  1BC2 A;  1WUO A;  4NQ5 A;  4UWR B;  4XUK A;  2FHX B;  1Y44 A;  1WUP A;  2I7V A;  1XM8 A;  4J5H A;  1A8T A;  3T3N A;  4HL1 A;  3KL7 A;  5HIP A;  3MD7 A;  3AJ3 A;  3ESH A;  2GMN A;  5ACS A;  5ACP A;  3ADR A;  3AF5 A;  3IE1 A;  3L6N A;  1VJN A;  5EV6 A;  2OHI A;  2Q42 A;  2FU8 A;  1DDK A;  4AWY B;  3FAI A;  5KIL A;  4D1U A;  5EHT A;  4GYQ A;  4GYU A;  2Q9U A;  4FR7 A;  5K0W A;  5B1U A;  2DKF A;  3BK1 A;  2ZZI A;  5HIS A;  5KIK A;  4RAW A;  3TP9 A;  4TYF A;  1KR3 A;  1A7T A;  2R2D A;  4C1F A;  5K4M A;  1ZTC A;  5ACU A;  3SBL A;  1X8H A;  1ZNB A;  3X2Z A;  2YNT B;  1MQO A;  2OHJ A;  2BG7 A;  4BZ3 A;  1KO3 A;  4TZ9 A;  2BFZ A;  4EYB A;  3SW3 A;  2P4Z A;  3IOG A;  2YCB A;  4D1T A;  4KEP A;  2FU9 A;  2NZE A;  1WRA A;  3JXP A;  2Y8B A;  2AIO A;  5HH5 A;  1E5D A;  3DHC A;  2UYX A;  2BFL A;  3RKK A;  4C1G A;  1L9Y A;  3LVZ A;  4B87 A;  2FU6 A;  4RBS A;  3I15 A;  4NQ6 A;  3I11 A;  1K07 A;  1JT1 A;  2ZWR A;  5AHR A;  3FCZ A;  1YCG A;  5EVB A;  4C1C A;  4P62 A;  3PY5 A;  4KEQ A;  4C1H A;  4C1D A;  4EXS A;  4O98 A;  2GCU A;  2YNV A;  4F6H A;  4UWO B;  4J5F A;  4EYF A;  3SD9 A;  3VPE A;  2OHH A;  4TZB A;  4UBQ A;  4FSB A;  4V0H A;  5LLD A;  4XWT A;  2BMI A;  5EV8 A;  1X8G A;  2HB9 A;  5ACQ A;  4HL2 A;  1YCF A;  2XR1 A;  1KO2 A;  2BG8 A;  3G1P A;  5HIO A;  1BVT A;  3VQZ A;  4DIK A;  4TZF A;  2YNW A;  4NQ4 A;  4UA4 A;  3P2U A;  4F6Z A;  5LCH A;  2NYP A;  3X2Y A;  3I13 A;  5B15 A;  5HH6 A;  2YZ3 A;  4Z5Z A;  2M5D A;  5ACV A;  3X2X A;  4EFZ A;  3Q6V A;  2YNU A;  5LSC A;  2GFK A;  3T3O A;  3IEM A;  1DD6 A;  2H6A A;  5ACT A;  2BR6 A;  5HH4 A;  4UAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...