4FFDA

Crystal structure of engineered protein. northeast structural genomics consortium target or48
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYGFKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF00702 DOMAIN PROTEIN
publication title Crystal structure of engineered protein. northeast structural genomics consortium target or48
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
total genus 86
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4ffdA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ffdA01
1MH9A 3L0BA 2D2VA 5ALTA 2FPXA 4Y2VA 4UMVA 3EF1A 5AI6A 4EX7A 2FPWA 1RPZA 4Y2TA 5ALUA 2WF7A 2P69A 1Z4LA 4BEVA 3L7YA 3PGVA 1RLTA 2FUCA 3DDHA 2HDOA 3ESRA 3ZX4A 4ZEWA 4Y2QA 2YY6A 3R9KA 2YN4A 5AKIA 1NF2A 1RLOA 3ET4A 1O08A 1ZD3A 3EF0A 3L0YA 3L0CA 5T41A 4UMFA 3NASA 2G80A 2QYHA 3AR2A 5AICA 3ZTWA 2B8JA 5AVUA 3U7GA 3FM9A 5ALKA 1QQ7A 5AK4A 2IYEA 4OFZA 5JJBA 3ZX5A 5AI0A 1NRWA 4IFTA 3OCYA 3I76A 4J03A 1X42A 3A1DA 3KBBA 3OCXA 3DV9A 2DQSA 1L6RA 2OYCA 4RESA 3W5CA 1RQNA 3IB6A 3NRJA 3QGMA 2Q5EA 1WR8A 4KX3A 3MPOA 4BX2A 3I6BA 1U2SA 3ZTYA 4FFDA 3CZ4A 4UASA 3RFUA 3WKAA 2VKQA 3BA6A 2BDUA 3WK9A 5IS2A 5AW9A 3ZUPA 3SMVA 1QQ6A 3QUBA 4YIKA 5ALZA 2EARA 4DW8A 3E84A 5AVYA 2I55A 4I9FA 2YMQA 1N8NA 4JDPA 4NFLA 1F5SA 3D6JA 4XOUA 1Z4IA 4OHFA 2RB5A 1J97A 1Z4KA 3OCZA 4HGRA 1J8DA 2R8EA 3ZU6A 2RBKA 3FPBA 2BY4A 3UM9A 3OCUA 1L7MA 1WPGA 1L8LA 4G9BA 2ZOSA 2HX1A 2WF8A 5AM2A 1SWVA 2C88A 5ALQA 1ZRMA 4NV0A 3QU7A 4BKMA 4YIHA 3ZVNA 4UAUA 3L5KA 5AKKA 2W43A 1K1EA 4KN8A 4EELA 3KZXA 2B0CA 2WM8A 3OPXA 3N28A 1FEZA 4HGOA 1RLMA 3W5BA 5AKZA 2YBDA 1RKQA 2AGVA 2B30A 1L7NA 3ZW7A 5AVSA 1U7OA 1RRCA 1VJ5A 5ALJA 1TJ5A 2BDEA 2GHQA 3L8FA 3N1UA 5ALYA 5IT0A 3WK7A 5A3SA 4ZEXA 1RMQA 3WKBA 4I9GA 3AR5A 3U13A 2MU1A 3FGOA 3OTQA 3W5DA 2W4MA 3MN1A 3QUCA 4CF3A 4UAVA 2GO7A 1L7OA 2R8ZA 2YFYA 1ZD4A 1N9KA 2OM6A 3L8GA 1EK1A 5AVVA 1YJ5A 2B1RA 2JARA 2WFAA 5AKLA 2HHLA 2CFSA 5ALDA 3WK6A 4AS2A 3U7EB 2OA0A 3I1YA 3WGUA 1Z4NA 3IRUA 2YJ5A 4CE6A 1T9ZA 2JAWA 1QQ5A 3B9RA 4C4SA 5AW4A 1PW5A 5ALLA 4KNWA 3ZWDA 5AESA 4XE5A 4C4TA 2W11A 1VFPA 3SKYA 1EK2A 5AVRA 2I6XA 2YMLA 2JAOA 3R4CA 4DFDA 5AW1A 2I34A 3UMGA 1JUDA 1S8OA 3N8GA 1WZCA 4Y2RA 1YNSA 5ALSA 5ALFA 2WHEA 5AI9A 4FYPA 3E8MA 4UM5A 2P9JA 3AR6A 2PKEA 2YJ3A 5AVTA 2HI0A 3QX7A 4YH1A 3N07A 4XQ0A 2HF7A 2Q4RA 4BNDB 5AW2A 3ZVMA 3W5AA 5AW5A 2JAUA 3WK4A 3B8EA 3TLMA 1VJRA 2R8YA 3A1EA 3DNPA 5AM1A 3WKEA 5ALXA 2G06A 2YMMA 4DCCA 5AI5A 5ALIA 2C8KA 2GFHA 4H1WA 4CNQA 3NALA 3ZI4A 4HGQA 2WF6A 3I28A 3L1VA 2AH5A 4Y2XA 3HYCA 2Q4TA 2PR7A 4KX5A 2YJ6A 5AHXA 1NNLA 2ZG6A 5FP0A 4UU0A 2QLTA 4B6JA 2G09A 4HGNA 5AK5A 2EAUA 4IG4A 2NO4A 5AKYA 4NABA 2FPUA 4NAVA 2HCFA 4HGPA 2ZBGA 2AMYA 2CFRA 2GHTA 3J7TA 3E58A 3F9RA 3BWVA 1Z5UA 4L6CA 1SWWA 4MWOA 5ALPA 2RARA 4UARA 4UATA 3AR7A 3SKXA 2RAVA 4UM7A 3ED5A 4NWIA 3U19A 3QUQA 2NYVA 5AK6A 1Z4QA 2G1AA 4J2TA 4ZEVA 3CNHA 5ALHA 3SD7A 3QYPA 2AUTA 4L6AA 2O9JA 3ET5A 2WF5A 5AK3A 1XPJA 3AR3A 3L8EA 5AI8A 3NIWA 1XP5A 1QYIA 3VAYA 3EWIA 4QQFA 1ZOLA 4EX6A 5ALRA 3B9BA 3OCWA 3FVVA 3E81A 1S2OA 4UMDA 3DAOA 4YCNA 5AIBA 5AIAA 2P27A 3PGLA 3GYGA 4O8CA 3AR8A 1KYTA 1O03A 4KYTA 2C4NA 3QU4A 3QUTA 4Y3UA 4BEWA 3M1YA 4MUMA 5AVZA 4YCLA 5AM0A 3S6JA 4OCZA 4XPZA 1YV9A 1LVHA 5AKJA 5IT4A 4GXTA 4UMEA 1RQLA 5A3RA 1TJ4A 4YCMA 5AW7A 3K1ZA 4PNHA 2GMWA 3A1CA 1ZD2P 3R09A 3NANA 1CR6A 3RF6A 4KNVA 5AVXA 2IOFA 3QNMA 1QH9A 5ALMA 2X4DA 1Z4OA 1Z4JA 4JB3A 3OCVA 2ZXEA 2C8LA 2I54A 4QJBA 5A3QA 2HSZA 2MU2A 1ZJJA 2B82A 3ESQA 2MSNA 3UMBA 4G63A 2ODAA 2FI1A 1RDFA 2IOFK 3SLRA 2I33A 3SF0A 3WKCA 3QU2A 4YGYA 4AS3A 4EENA 2PQ0A 4BX0A 4BBJA 4EZEA 4HYTA 3UMCA 3KDPA 3FPSA 3PDWA 3L1UA 1RKVA 3IJ5A 3QU9A 3ZWKA 4DWOA 1ZRNA 2CN1A 3N5KA 1U02A 1Z4MA 4GIBA 3KD3A 3L8HA 3AR4A 1T5TA 3AR9A 4F71A 2FEAA 5E0OA 4BYGA 5AM5A 4C4RA 1ZS9A 2HOQA 3QXGA 5ALWA 4BNDA 5AM4A 3NUQA 1Z4PX 5AW3A 3KOOA 3EPRA 4Y2SA 4Y2PA 2CFTA 4HAIA 1AQ6A 2G08A 5ALOA 1Q92A 2FUEA 1XVIA 1Q91A 2FPSA 3SHQA 1Z5GA 4EEKA 1RC8A 2C9MA 1YDFA 2OBBA 1Y8AA 2ZBEA 5AM3A 3QLEA 1U2TA 5AW8A 5AI4A 1RMYA 3P96A 1ZD5A 1L8OA 1IWOA 5ALEA 2B1QA 2YMPA 4E88A 3ONNA 1SU4A 5ALGA 3PCTA 2ZBFA 3WK8A 2IOHA 3KC2A 5AKGA 2P11A 2ZBDA 2WF9A 5AKEA 4CF5A 5ALNA 1T5SA 1RMTA 4Y2YA 2G07A 3M9LA 2EATA 4FE3A 4Y2UA 5ALVA 3U7HB 3U7FB 1TJ3A 3MMZA 4F72A 5AKXA 3QU5A 3WK5A 1YS9A 4Y2JA 3FZQA 2O2XA 5AW6A 1TA0A 1CQZA 2HF2A 1TE2A 1Z88A 5AW0A 2JGAA 1YMQA 3A3YA 2HO4A 2FDRA 4L57A 4OD0A 5AKHA 2HEGA 5AVWA 1L7PA 3WKDA 3U26A 4UU1A 5AVQA 1WVIA 4AP9A 2I7DA 4BX3A 4RETA 2IA5A 4CF4A 2YJ4A 3MC1A 2G0AA 2B8EA 3HLTA 1U7PA 1LTQA 3NAMA 2R8XA 1RKUA 3ZVLA 2FPRA 3WGVA 4UW9A 2NO5A
chains in the Genus database with same CATH superfamily
5M7EA 3JALB 4RBNA 1MAAA 2HBMA 3NV7A 1D3AA 1ZMRA 2PFPA 3OWOA 2B2XA 4LSWA 2HMXA 5HW0A 1RRFA 3BA1A 1NQWA 1GRQA 3ZX4A 1NBAA 3E9ZA 4M9NA 2W6NA 5EP1A 2E49A 1U2RA 3OIFA 4N9QA 4W8GA 2XJ4A 2YUTA 3A9CA 1N8KA 2GDJA 4JC5A 1B14A 4JA2A 3PNSA 3SVLA 3O0TA 3ZWQA 4M0CA 2JI8A 2O2CA 2NU7A 1UL1X 2KMDA 1LVUA 1WD7A 4NFHA 1DAMA 3UJ9A 4YAWA 2FPOA 5TEWA 4DL4A 1Z4IA 4F3CA 4B3HA 2WHRA 2R7MA 1F6DA 2LPMA 1VYUA 2GTPA 2PDAA 3ZDDA 1XLTA 5TEVA 2JAQA 1V45E 2I80A 2B36A 4DDHA 3KU4A 2FMPA 1KEKA 4R1OA 2IBSA 2WYUA 4TKUA 1GV0A 1FJXA 4WLOA 2IITA 4RPIA 3NRWA 3DOCA 3Q10A 4QQ8A 3PQ2A 5IMBA 4RD1A 3ILXA 2C0CA 5IABA 1IZ0A 4F6LA 3O2NA 2HHTA 1ZUHA 3T61A 4KAXA 1AUOA 3RRZA 3R0ZA 3FIJA 1NK9A 1O6CA 2HH9A 3H4VA 3NBAA 1Y8RA 3Q1KA 3AQFA 1PNQA 1NVXQ 1NVKA 1X1SA 3QEMB 3PW5A 1N5WA 2PKEA 2XNHA 4D0NA 1HWYA 4C8NA 2J6IA 2NX2A 3DHNA 1KAOA 3K8OE 1EA5A 1A2OA 2WYOA 2VSOA 2GFHA 5T14A 4IJQA 5BR7A 4M1KA 1G17A 3LXXA 4B6FA 5FP0A 1GUYA 3UC9A 1MNQA 2WMOB 4TZ0A 2VA2A 5CVEA 3V3TA 5ICCA 3TCKA 1JNXX 3UGQA 2HREA 4DL7A 3KZMA 2IOYA 1Q3KA 1TUEA 4E32A 3UWKA 3O0DA 3PZPA 3KQPA 3ENQA 3W2TA 1ENOA 1QP7A 2CMFA 1IM4A 3D7LA 3O73A 3L7LA 3I9NA 1E77A 3VISA 3TKAA 3F4BA 1A7UA 1JIJA 4F3KA 3UMSA 4FBUA 3A25A 2R6FA 3IDOA 3FB1A 4KR7A 4UUOA 1JIXA 1ESNA 1KI4A 2FWBA 4EJSA 1XSPA 4HDKB 5JDCA 3WZMA 4ZT6A 2C8LA 2LMRA 2HQRA 1M2NA 4RCYA 4F4IA 1C7FA 1M1ZA 2D5IA 1S96A 2WSSA 4R5HA 1ECFA 2FWIA 4L5BA 1NV8A 3ON5A 1D8LA 3HBMA 3LSTA 5C1DA 5KT7A 5E2AA 2FXIA 2GPBA 1KOLA 5DBGA 2BHRA 2C7PA 2ZCJA 2D00A 1L3SA 1Y9DA 2CD9A 4D9GA 3EZNA 2QV0A 4DG9A 1E3EA 4MWEA 5TF0A 4WY2A 2ZKLA 3VVCA 3N2KB 5HJ7A 2A1JB 1QCYA 3SQIA 3QLVA 3QPCA 1VFNA 2AQIA 1M34A 5FPQA 1N4AA 2V96A 2EGGA 4P4GA 1B1CA 3NYIA 3S68A 3AF6A 2HW8A 8ICRA 4JV5B 1N2CE 3C2LA 2C99A 4LHXA 3IPXA 2ZIFA 1NNUA 3FDJA 5CYFA 3SEZA 3R7DA 3HCCA 3NHJA 2Z8YM 4N82A 1HR0B 4G07A 5L4NA 2GR9A 5CP2A 3GWZA 4UD6A 3E3OA 1K0FA 3PTZA 1Z37A 5EIBC 4TKVA 4R2KA 2WLSA 2JEFA 5TMPA 1TC2A 4YJ2F 1KK3A 2BFDB 2O8CB 4ZOHC 1DMSA 5AVKA 4JOSA 1T25A 4MSUA 3ZNOA 4G0MA 2J31A 3VO1A 3F5MA 1U9IA 5DTJA 3TRFA 1I0LA 2RGXA 5C80A 2WSBA 4N7JA 5GINE 4ZT5A 3LT5A 2QGFA 3GDGA 1KDRA 4QYXA 5TISU 3NRJA 3SCZA 4Z53A 1K5DA 2AWOA 3U4QA 5BSWA 5ICSA 4YA6A 1P7VA 3DFFA 2PLNA 2H4HA 1Z39A 1EUZA 3EAQA 1WCLA 1Q20A 1AQLA 4IH1A 2F67A 3G6XA 1FIQA 2A0KA 1AMUA 2VAWA 8ABPA 1TJYA 2ZSUA 4NNPA 4DA6A 1JWLA 1JJVA 2GCPA 2IOQA 3KNZA 4RHEA 3X1JA 4LE2A 2R8RA 1SBZA 1DEOA 3UT5A 4NV0A 2ZT5A 3PJGA 3AM1A 3VYVA 1O5OA 1WCIA 4DR7B 3AUKA 1DDGA 4N4AA 2AGVA 2UUCB 4BDSA 1USWA 1G20B 1IH8A 1FMCA 1JMKC 1YR3A 2BI8A 2NTYC 2QVXX 3N97B 1SV0C 4MVWA 4ZGGA 3H0KA 5JAPA 3D5QA 1AJEA 5HCUA 1WB9A 1RYHA 3UICA 3TZBA 2Y66A 3I9JA 3GEBA 4OB6A 2O8BA 2HF8A 1Q95A 2XMZA 2VUIB 4ED9A 1IM5A 2JK0A 2AS0A 5FOTA 4GSLA 4G4SO 2JAOA 1JQ5A 3OLZA 5JE8A 4Q01A 9ICMA 4COKA 1YT5A 4EY7A 2P9JA 4V0NA 3PUJA 4D46A 3BK7A 3JVVA 4FJ0A 4LY0A 3TQFA 5TDHA 2C2EA 2AHOA 1W1IA 3N4MB 1YS6A 1QIHA 5TVGA 3ITEA 4IX1A 3B7WA 2C7RA 1J2UA 2HU2A 3QHPA 3AYXB 3T3GA 4US9A 2H9IA 3R0VA 4QDKA 4GOXA 3A9WA 2ZS8A 3H5VA 5HQTA 4H7DA 2HVHA 2MINA 4TTQA 2Q6KA 3H42B 4UUNA 2XNJA 1XPJA 1DUVG 4Q4CA 2RHTA 5I4IA 4I2IA 2F00A 3QW2A 3S99A 4TLLB 1ZGHA 1I7DA 2C4NA 2WJHA 1LQUA 3BVPA 4U3JB 3VZSA 1S77D 4NBUA 5EKDA 4K8RB 4KLGA 3EHDA 5EA2A 3V42A 3W5HA 4DLZA 4QJ4A 2QVLA 3O82A 3MTJA 1V6AA 2Y0BA 1VCHA 2L5YA 2XDYA 3QP9A 3L93A 3GQVA 3TFWA 3I92A 2HMSA 2XYQA 1S5LU 4MZDA 1VLMA 4DEXA 2V03A 1QLNA 3P2EA 1BKYA 4FYJA 1U94A 3WYBA 4TMYA 1Z6QA 4KN4A 4AY6A 4O5EA 1JLLB 2H9YA 1LWNA 4M1EA 4NZ9A 4IBOA 3PRHA 3UTDA 2XAAA 4DTCA 5EQFA 5JYCA 2ECFA 4DDWA 4F97A 3LYSA 3UT6A 4J0EA 1IWOA 2IZ0A 1NYLA 4JZKA 2HOIA 4X1KB 2AVNA 1R6VA 5EJ5A 4UBKA 4Y2UA 2R47A 3GGGA 4NM1A 3NXSA 3FZQA 3EA5A 2VUSA 1U0HC 1V1RA 2AL7A 1SJ9A 2P67A 1PWZA 2NVWA 1PD1A 1Z5NA 3MJ4A 2A0UA 3MC1A 3ONEA 5C0OE 4EJ6A 3NS1A 2XHZA 4LGCA 2FPRA 3QLTA 4IXTA 2NYUA 5DW0A 3GJ0A 1P2SA 9ICUA 5E79U 4PZCA 5KG6A 1BO6A 1SVWA 5IAAA 1KAGA 1ZYUA 1R0ZA 3ZW9A 2DFNA 3O0FA 1XBTA 3I9V6 1CJKC 1TIBA 3QOWA 4OLAA 2FYTA 2VJ5A 2WYIA 3FZNA 5H81A 4ZGBA 4JX8A 3BCRA 3CNEA 3QSGA 1P3Y1 3R6DA 1H1LB 4H15A 3C87A 2PMZC 1P9RA 4XB2A 7ABPA 1OYWA 3BQ9A 1XTSA 4PSDA 1U2SA 5KBYA 2DT5A 3H6KA 3TLZA 4UFOA 3CZ4A 3DP7A 2GM4A 1ZBQA 2D4AA 2I99A 1M83A 4JUAA 1PN3A 1YT3A 3PEEA 4LFAB 1TQ2A 4N5MA 1XELA 4N5HX 2WF8A 5A9SB 2P6RA 1Z75A 3L1KA 5EERA 4DFPA 4YCDA 2V4MA 4PRYA 4DRYA 1X0XA 2WIJA 3G0DA 1XWIA 1K9SA 5JBIA 1LPMA 2R65A 2CMHA 5KFIA 5CIYA 3DJYA 5KMGB 5IT0A 1T0BA 3K73O 3SHFA 3L7AA 1MA7A 2BFBA 1G1MA 3OMXA 2FZVA 4M88A 6AT1A 4AUMA 3SXPA 1MRZA 4IXDA 2WE7A 4IIDA 2VL7A 2CFSA 1MFPA 2BFOA 5K0NA 2YVAA 1M6EX 5GIPE 5EHZA 1N2EA 3ANSA 1U28A 1P3DA 3SYLA 4F12A 4UUBA 3GILA 1JHZA 4WFQA 1A2QA 3FNBA 3SX2A 1JDNA 4QICA 1L3VA 4AKIA 3CF4G 3CPJB 4FDLA 4FOTA 3GNSA 1K2VN 2FZKA 2AFHE 1NY6A 4W9RA 4BIIA 1A4IA 5JJCA 5KOYA 2GERA 4PLHA 5K3SA 5EE3A 2OY0A 2XWPA 1NJWA 4AJLA 2BKXA 1RIFA 3LC1O 2PZJA 2UVPA 3LXUX 1T4DA 4PANA 5DGXA 4HFMA 2I22A 2O14A 4HB2A 4QZ8A 1ADBA 3NNDA 2IZOA 4DSUA 4Z49A 2XQGA 3ADDA 1DWUA 5DTMA 2GILA 3VJRA 4OJKA 5BVHB 2HZ7A 1QGZA 3CVJA 4Q43A 2IEDA 4G65A 1T2EA 4QJIA 5B3JA 1HI9A 1WQ3A 2AOXA 3K0EA 3NYWA 3CH6A 4WPGA 1NVWQ 3DH0A 3OE4A 3S6JA 3GAAA 4DFMA 2NSDA 1Z15A 3V2IA 2E4XA 2IEGA 1KA9H 1UQVA 5BYKA 3F3KA 4PXSA 1C9EA 3NHZA 3JSAA 5E7MA 5JRZA 2XV1A 5DOZA 4GWKA 4BN5A 4ND3A 4NBWA 2J85A 1Z0KA 4MW4A 3R3XA 3K0BA 2BC9A 4HLUC 1QH8B 1J8YF 2P40A 3MD9A 3DF9A 1QE3A 4AWAA 3QXGA 3OJEA 3WBJA 4XCQA 2JEJA 1NI4B 1RKBA 1SC6A 4DGQA 5JTTA 1JFRA 1CZUA 1D1QA 2ECOA 5LC1A 4D79A 4CFZA 3GGSA 5FA8A 5TS3A 1WTAA 1V8FA 3P96A 4P58A 5B66U 4I9NA 3MGVA 3HWSA 3H2SA 3OKFA 4BIMA 4D2IA 3MCVA 3OQIA 3GBPA 4IIYA 4Y2YA 2OFWA 3KOXA 2OESA 1DOAA 1P7PA 1PJ3A 4YUVA 2DECA 2Q5CA 3H5AA 9ICOA 2UV8A 1YJ8A 1Y3CE 1NLFA 3S70A 4DQIA 4KV9A 4XCXA 2IF2A 5E6RA 5LD2B 1MHPA 2Z08A 3V4ZA 2DERA 4IOLA 4Q9NA 5FADA 1CBUA 2P5TB 2FR8A 2VZLA 1P7CA 2PGLA 3DVLA 4J1TC 4O59O 3PGXA 1R6BX 2HDOA 4YN4A 4FGZA 1CJVC 1I7QB 2YZGA 4CKYA 3L5OA 3PX0A 1YWGO 3D7NA 3MUOA 1UXKA 1KE1A 3AVTA 3TARA 4RQ5A 4ZAVA 2B94A 4WJKB 3OZ7A 1E2DA 2BEWB 4CKEB 5JJKA 2E18A 3OUUA 4XJXA 4C06A 2P9HA 4W5WA 5IVIA 4FE7A 1D6JA 3F7NA 4G24A 1QRUA 2RC5A 3CZCA 2ZPTX 2KLHA 4UDOA 5EFZA 3BZUA 3KEGA 4J9UE 4D26A 3B6JA 4OV6B 3ZBUA 1VI6A 2Q62A 3OQJA 4B3RB 1Z5PA 3BQMB 4ZO8A 5C3MA 2QX9A 1Z5ZA 1J97A 1ZQVA 2D7JA 6YASA 2G76A 3LWDA 4L4RA 1B0ZA 1D0VA 4ECUA 1LQTA 1QX4A 1MG0A 2CDCA 3KQVA 2KI5A 5CDTA 1U04A 3YASA 5LM3A 1DJMA 5KVVA 3DULA 5EXDA 4JYPA 3DR3A 4ED8A 5D1NA 2F2TA 1Z35A 4D6YA 4Z54A 3FTQA 1KTIA 4WNAA 3D6FA 4MPPA 3U16A 2Z6UA 4ARZB 5CBPB 2G5IB 4LDJA 2FCAA 3FNFA 5BSUA 2VRNA 4QHYA 3H0MB 1G9XA 1ADJA 4ANFA 1XZAA 3TEMA 4RMGA 2JATA 1SVSA 1XO1A 3N2EA 4G0UA 5HIJA 4PXYA 2Q2WA 4CR8A 3TKLA 1ZQTA 4OXQA 4G1UC 2Z58A 2YMLA 3R4CA 3A31A 3NVZA 1WV0A 2IZZA 1SKWA 3P2YA 4X7PA 4QVIA 4BZPA 4YP3A 2LYAA 3V7KA 2VC2B 5C5IA 3QY9A 4URWR 2P9GA 4BVLA 2J7PA 4D9FA 2P8JA 4FQ5A 2XCOA 1QHFA 3RVKA 1X7YB 1J5PA 4A2WA 2WNIA 1XHLA 4IG4A 3RW9A 2O5CA 2W7PA 3E7FA 4MYRA 4KQ2A 2R79A 2CNWD 2YICA 1CE8A 3IP6A 5EXSA 4L9WA 3MEQA 5LP6A 3EXEA 1UJMA 4OGFA 4LOHA 4F5RA 1NQOA 4A0FA 5HFNA 4C0SA 5DW3A 1V9LA 4PO3X 4MVJG 4LHVA 5F5XA 1Z0UA 3HMKA 2CMGA 3R7WA 1Q7CA 2FGJA 1OC2A 1T35A 1JR3D 4DE5A 3AIIA 4GKVA 3LRPA 1Z47A 3FUXA 3LLUA 4I8XA 2JVJA 4MO2A 2LV8A 1QDUA 1C2TA 3JD3A 3QJGA 3P4UA 4GPIB 2AW5A 1PJAA 2XWSA 4H59A 4X54A 2QT1A 4M76B 3EDOA 1SHJA 2ISPA 4ZCIA 3F53A 3KS9A 3DOHA 4H4DA 3TRJA 4EUHA 1QG4A 5DM70 3NHPA 2OAEA 1BWSA 5CLGA 3EIEA 4JYCA 1O94A 1K7EB 1ZK0A 4XD2A 4BRWA 1IB0A 1TVKA 4XI9A 5JZ9A 3NAGA 4TQ9A 4Q4AB 4E88A 3H4TA 3OSNA 3WYNA 1FZQA 4EEZA 1P6XA 2YR0A 3MIZA 4M83A 4P4SB 5BN1A 4LYAA 5A4FS 2F1OA 3PHCA 3IODA 4DMMA 2QRZA 3PNOA 4DUZB 1Z3EB 1EFKA 3G2HA 1CQZA 3KOWA 3OO1A 1XTVA 1AA9A 2WTMA 4ASUD 2NVUB 5C5CA 1HTBA 1YOVB 1F1BA 2XYGA 1SZHA 3FTCA 2N3ZA 3OJWA 4PQEA 1GL6A 1EP1B 2C04A 2P2NA 2YY6A 1W5EA 3U44B 1O08A 3BXXA 4RKEA 1CUAA 4O5KA 3A70A 2JRZA 4EF5A 2Z09A 5CNIA 5JC1A 4GP6A 4AAYA 5L1MA 3RRMA 1FQKA 4DSKA 3QELB 1HUQA 3RB3A 3PD0A 2Q7OE 4NZMA 2Y0PA 1E6WA 3KJGA 1YVEI 1JXMA 3SZLA 7REQA 3PL5A 1WW3A 2W2VA 1F9AA 4V0QA 2IZ1A 4OHRA 2YX1A 2ZE8A 1NBWB 3W9SA 1BFUA 1XIVA 4XVRA 1NQVA 4XVCA 4EEXA 2JB9A 2QUIA 2G9UA 3PKIA 3RRGA 1YBAA 4DARA 2V7TA 1IHOA 3LBFA 3CYFA 5IJZA 3TQOA 1V8BA 1M6VB 4KUHA 4FHCA 1T9AA 1QM5A 4J4HA 4RUAA 3THWB 3BH6A 2Y1DA 1EDBA 1BQ4A 1FYDA 1GR1A 3ODGA 1VI5A 4UFNA 1M0WA 2DHDA 2ID8A 5DTRA 3MLBA 4YCAA 1V1MA 1O87A 3CN7A 3TMYA 4HVCA 1C3LA 3AU8A 5C32A 1UBOS 4Q16A 3ZWDA 5IBCA 5JNTA 3V8NA 5EZSA 4OG2A 4L02A 3SKYA 1EK2A 5HTOA 1BX3A 3COVA 4QFCA 1SD2A 2FQYA 2HMWA 3G0BA 4B47A 2ORYA 5DNAA 4B85A 2CMDA 2W9CB 4ZQBA 5K8LA 1H8HD 4IYRA 2ID7A 4W7HA 3O94A 4TWBA 1IG3A 2QR3A 3NVKI 2G06A 4ZVOA 2WVHA 1JU9A 4B3XA 2Y77A 5EZ5A 2RD2A 2C84A 4KBYA 4KZKA 4D4MA 2FWNA 1KU6A 3OQ6A 4V3BA 1JB1A 3WLMA 4Z0PA 2EAUA 5DSXA 3KHSA 3UOWA 3T3EA 4PAMA 1Z5UA 4C0KA 5HZMA 5E6SA 2EIXA 1DBPA 4HP8A 5HSGA 3B60A 3ZV5A 2JIBA 4PHGA 4NP6A 4IVNA 3ZN2A 5TRTA 1SUWA 2XZDA 1K2WA 3EGWA 4ZIRB 2Z8XA 4TWRA 3CXUA 3GYGA 5A6VA 3AR8A 3WS7A 4FLMA 4LX0A 3U80A 5IC5A 3GN1A 1UZLA 1XTTA 1ZMTA 3IAS1 3L6UA 4QXRA 3VVLA 1AS0A 2V6BA 2ZJ0A 1XXLA 5E6UA 1X1QA 4HBGA 1EXMA 1C30A 1WUJS 4P4UA 1CULC 1I51A 3KO8A 1IN7A 2I7XA 3ETJA 4BC1A 5HGXA 4Y0AA 3WWZA 5J2JA 1B0XA 1YUNA 4WCFA 3GCWA 2WJ6A 1BNPA 3WSWA 3TD2A 1L7VC 3FIUA 4L50A 2KX7A 3JQPA 5IKMA 1XVIA 1U3FA 1C20A 1CR2A 1QYCA 221PA 4XPIA 2HU5A 2KKPA 2ZRJA 1TJPB 1U0BB 1PUJA 2ZUWA 3KTAA 3K9HA 1LLDA 5IDVA 2ZBFA 2G77B 2QOEA 4M1OA 2DFLA 1D6SA 4XYLA 3C7DB 5F2EA 1DAOA 2GCOB 3M9LA 4HEHA 4G3IA 5BOLA 3EW7A 1P4JA 3V5NA 3ZIAA 1CRPA 3LA6A 2GK3A 3NGMA 2XIJA 3E4CA 3I6YA 2YIMA 3SWWA 3MR5A 1X1DA 1A5SB 4IV0A 4PGGA 3IIMA 5DBBA 4ME6A 3VM6A 1G8MA 3K2BA 4GXKA 1YI8A 3UUFA 3RUPA 1DX4A 2JJ1A 4MKRA 3ODPA 1YRBA 3DG9A 3AIKA 5A4KA 1WXIA 4CLOA 2HMYB 1GIAA 4BGDA 1RWNA 1DCTA 1BEZA 5D49A 2XD9A 1RLOA 2GD1O 1RJDA 2RFLA 4DV0B 5JS6A 2FMQA 3F6RA 1P17A 4K86A 5GJCA 3VR2D 2YOHA 4KUGA 4XFKA 1SXJA 4BNKA 1Q3TA 5EQDA 2AQHA 5JJBA 4D45A 2IL1A 3W2GA 1SOAA 4OP3A 4F4WA 4AN1A 1E2JA 2BRUC 2VK4A 4QDOA 3OLYA 4FFDA 1E7MA 3DE6X 1YE5A 4UHDA 1X7ZA 4BKPA 3FUCA 1C7JA 5I4BA 5JO9A 4R64A 4PPGA 5KOHB 4GXRA 3SBOA 1E3JA 3KPVA 4ON9A 4MTCA 4IDDA 3WDKA 2NTVA 4BKMA 4UAUA 4FYMA 1VQ1A 2HK6A 4LNHA 4KE6A 2KSOB 5HR7A 1BW9A 5BXYA 1LI4A 5CFQA 1TVCA 2IBTA 1DAKA 4D3DA 1PLKA 4YCJA 3SOPA 4QT4A 2K4IA 3IDSA 1JXLA 3M83A 4YMIA 2YFHA 4I6GA 4AXXA 1Q1ZA 3C97A 2M6KA 1EK1A 4TROA 2B69A 3WMRA 3MGIA 4DYDA 3QZUA 3F90A 2H54A 4L08A 2OAP1 1I1OA 16PKA 4KAJA 3EJWA 5JXJA 2FLNA 3SAHA 5LB2A 1WKCA 4IIGA 4RA9B 3BTVA 3GPBA 1JQJC 4DMHA 4KYUA 1O7JA 4J9KA 2O2YA 5KU7A 1RJEA 3R1IA 1F60A 2YYSA 1A9SA 5CT8A 4ZT2A 3JQFC 3IR5A 4HADA 1X3SA 3L6RA 1HE1C 5LBUA 3THVA 4D02A 4GPEA 3H11A 4UQGA 1YZGA 4M9JA 4GNRA 4E1BA 3KDSE 1P3JA 4DNOA 2B37A 4R01A 3KKPA 1LKYA 4M0AA 3OEED 4EJFA 1E2LA 3OX2A 4O2AB 1Q1AA 3NTVA 3UCEA 3FCCA 4J2TA 1N6IA 1SIBE 2SHKA 1I4WA 1Q7RA 1K6MA 3SDSA 1Y4ZA 3EEBA 1UCFA 4Y9SA 2ATVA 3C3WA 3ZXYA 4LNUB 4E3ZA 3GDOA 4YD1A 1U8TA 1GPBA 1Z0DA 5LDGA 1MIOB 5TR9A 5KFHA 1VLLA 4D3XA 1M75A 2O7RA 4PNHA 1C9DB 3BHNA 2A57A 3QBJA 4NKRA 3I32A 4DABA 3O8OB 3GLVA 1Q17A 4D3SA 4DLRA 4KQHA 4QZVA 4YMOA 2RHWA 1BXRA 3GD7A 1G9TA 5DK4A 4U6PA 4QFDA 3PEUA 4K6OA 2R7AA 3F5SA 3Q5GA 1BS2A 1HORA 1GZVA 2EVWX 3CUKA 4QQRA 3VC2A 2D62A 5KFOA 1ATZA 3OZAA 4RJIA 4TQRA 1FTYA 1R0RE 5AUNB 5GM2A 3C2KA 1UFOA 2IS1A 1BE0A 3FPCA 5AI4A 4ZN6A 3FMIA 1P5HA 1L8OA 4LWOA 3OTWA 1Y63A 1E59A 2ACWA 1V5GA 1LC3A 1U7HA 2RH8A 3GFVA 4EO7A 1P8JA 4MGIR 3O95A 3BMCA 1Z2OX 1TD1A 2PY6A 4G56A 4W5OA 4GM1A 1NZJA 3DWIA 1YS9A 4Z4FA 2VHEA 1YVPA 1TA0A 2HJGA 3GUCA 1KMCA 2DF8A 4YDSA 4UB3A 2JBHA 2ZWPA 1YR2A 4KFUA 4Q3CA 4DXDA 1YMQA 4W82A 1Q0UA 3U3JA 1F17A 2VT2A 1QZUA 2GWSA 2GM3A 2XTMA 2WT4A 1R0CA 1VI2A 4WX2B 1HKUA 5SZHB 3BMQA 1FVXA 1R3DA 1K9VF 4KLJA 1JDPA 1A9RA 3MTAA 3KWMA 5SY9A 1KSJA 2FPWA 4ZCSA 3IOBA 4FBMA 5KX5B 2ZIZA 1XAIA 5FCDA 2H11A 2AG0A 3LM8A 3C2MA 3L0CA 3D4NA 3B1YA 3UJ3X 2B78A 1NDHA 2Q3HA 5G0UA 3TLXA 3HJEA 1HUZA 2JJQA 1Y4SA 1CUSA 2K8CB 1TTHA 2PFOA 3HACA 4EY8A 4BOYA 4HNVA 4V0ME 1YNOA 3K6SA 1V5EA 3KFUF 2OQRA 4A4DA 3WMGA 3AVVA 4WIAA 2AZ4A 1BVYF 4S2EA 1LNZA 1E1QD 2BTQB 4CMCA 2J9FB 4HAOA 2VDOB 4M9ZA 3GOQA 4NH4A 1AH2A 1F5SA 5JAOA 2VCEA 4YYZA 2NQ2C 3SAJA 1GKKA 1VKRA 2XXAB 2WEKA 3GC6A 4D81A 3OOJA 2J4CA 3RQSA 4LC0A 4QPCA 2VANA 4HBZA 2C9DA 2C5HA 3GUVA 4ED1A 4MEAA 3N28A 3UMMA 2RGAA 3ISCA 3H1PA 1FYXA 1P7ZA 4QG7A 3VXKA 1Y9ZA 1NLZA 3E2PA 3O83A 2J7KA 3WKBA 2CXUA 1NUPA 4C6SA 4RMNA 2QPOA 4R9VA 3ZDYB 4X5VA 1J21A 2C3MA 4TSKA 5FR2A 1NMQA 5ES4B 1G2IA 1AT1A 1YGPA 1BEUB 1QHEA 3SE7A 1RXUA 4BQNA 1Q84A 4ZCRA 5EVCA 5J0SA 2HWUA 3ZU3A 4YBRA 1ZISA 3IAM6 2A8YA 6ABPA 2ZVJA 1VP3A 3KEOA 2VF4X 3VGPA 3T9BA 2QBYB 2H1OA 3C1UA 3TKYA 1DIBA 1E63A 1ABBA 2R0QC 4RNNA 1ISHA 4DKXA 4QZCA 3PMNA 5CMLA 1COOA 3CIOA 4FFLA 1VIYA 3A7DA 2CFRA 3BN3A 3WYDA 3AL0C 5E9QA 3PHGA 1K5OA 1SWWA 1Y42X 2DAPA 1ZY2A 2ZXUA 4WZAA 3N2GB 3R0QA 1ZUD1 2AMVA 2C82A 3MINB 1DRGA 1RRMA 4LZAA 3HEMA 3G0OA 1KFCB 4YCLA 2P6NA 1TEVA 5DWQA 2D1YA 2PLAA 4PGHA 3NOVA 4RFSA 4ED6A 1IHUA 3L4EA 1FLDA 4K9KA 1RPAA 1F0NA 3LDHA 4PZDA 4YONB 1NVFA 2C96A 8ICMA 3I2GA 2NSLA 3ONDA 2JS7A 2PZKA 2FU5C 4GVPA 4FFBA 3LZ6A 4GEKA 2BFEB 1ZN8A 1R4NA 4RC9A 4ZHSA 1NPDA 5FI3A 4E13A 2NU6B 3ZTTA 2YQEA 1INLA 2PKXA 5KFBA 1YQGA 2VNSA 2VHJA 3ANLA 4FW8A 4DCNA 2B4KA 2QMEA 1QIGA 2JLRA 1M73E 2FKNA 2GEVA 2PT6A 4GYJA 4AY3A 3B9QA 1LX6A 2PRKA 1EYZA 3OFNA 3RRNA 1DFIA 4EHLA 2Y93A 3JWIA 4OIFA 3H1TA 2VPIA 4Q7KA 4WOPA 2V58A 3O8NA 4GHWA 4JEUA 3DNMA 1ZH4A 3L02A 4KLQA 2X2OA 3GCDA 1THTA 3SVZA 4BVFA 1PVRA 5EVJA 3ANNA 1LTQA 4E94A 1RC1A 1WB4A 2ZVQX 3FHLA 1BDMA 3KZNA 3UB2A 2B8NA 4N49A 1BH6A 3LQ1A 2VWGA 2ZW9A 3AFOA 3MWEB 2NXWA 4R16A 5H83A 2BI4A 4X3CA 5JS7A 5A02A 4JU8A 4MS4B 2O2SA 3VTKA 5DM2A 5ALKA 3GEGA 1CF4A 4QOHA 3QBEA 2YY7A 2IYOA 2L0XA 5I8PA 2JFYA 1OFTA 4NCIA 1B76A 4B6QA 1SXQA 1QVVA 2BFPA 1HDOA 2YQ4A 3RFUA 3GJZA 5B6IA 2X5OA 2HDNB 1BTOA 1J39A 1MPXA 3REFA 3KQSA 4BLQA 3GLUA 3ADBA 1Q22A 4EYKA 1CVIA 4QBKA 2JMGA 4Q45A 5DULA 3RSQA 2NUAA 5L6MB 1I3LA 1IM8A 4ENRA 4QM6A 3DHVA 2RJ3A 3UUEA 3RBVA 3VBCA 2HWKA 2GT1A 2FP4B 1V4VA 5BQ3A 3MNFA 4BNFA 4CMBA 3IQHX 2PGJA 4MEXA 3N7UA 2POCA 5IJ0B 4NDZA 5F3XB 4MIEA 1OKKD 3FN4A 4B9UA 3ZJ5A 1WB6A 3ID6C 3L8FA 4MQLA 4R51A 1TPYA 5I7OA 3KQTA 1FO4A 4U39A 1KI8A 3CE6A 2FH5B 2YBEA 4HNAB 1B6SA 1MQ8B 5E9JA 2FJUA 2YUIA 2JARA 1HQKA 2QI9F 4W8OA 3BQ7A 1SKYB 4B4VA 3U7EB 4GNKA 4RQ2A 2RKOA 4PLWA 1YB4A 2QLNA 3C4JA 1OT3A 2YRWA 4NQZA 1VHTA 5GTHU 2ZI7A 4DLTA 1J9ZA 3T35A 5KL8B 2ZJ7A 2P68A 1CQIB 3WGHA 4GAEA 2P3QA 1WZCA 1F2UB 5HF6A 3GX1A 4LDRA 3MERA 4MW7A 3GLFE 2YJ3A 4IQGA 4JL5A 2B83A 4A5OA 4ED3A 4RADA 4DHEA 5HK9A 2HSEA 3IIIA 4MLZA 3B8EA 4PLZA 2BGNA 1IBSA 1F5NA 3C8DA 4ZKEA 3IOYA 1BX1A 2HHWA 3LY9A 3M5DA 3A6KA 1EFPB 3ANYB 3B9PA 4YRZA 1W73A 4HGNA 4KFCA 3BMOA 4A73A 2AC4A 1ONOA 1WEKA 2JFVA 5HXAA 3NNSA 1GL7A 2GPJA 1ZNWA 1MBZA 2QJFA 3AB8A 3W7BA 1P1FA 2V3VA 4NJ8A 2EGUA 1B15A 2YWEA 3F6SA 3BFVA 4P0QB 5BVGA 1WCWA 4JL8A 3RYIB 2I3DA 5J0RA 1YJCA 4R41A 4L07A 1KYTA 3WLRA 5FUYA 5EJ4A 3C6ZA 1F0KA 3SX4A 2CDNA 3Q8MA 3M82A 3NAQA 2F3UA 3HADA 1G66A 2I1WA 2MWMA 3TLGB 5FL7A 3FKSA 4RQ1A 2WBLC 4NCBA 1R64A 1X39A 1EIWA 3BJEA 3AHDA 2E4UA 1PEKE 4M9SA 4KXXA 4DILA 1HDGO 4RQNA 4BNTA 2FG5A 1SV4A 4H6XA 1EX6A 3B52X 3T9AA 5J8YC 4RYLA 1BS1A 4M2LA 3F4KA 3I9MA 1G8FA 1MX1A 5DHAA 3GAFA 3I04A 2D0IA 2Q5OA 5KNLA 2I3GA 5KFGA 1QS0B 2GEKA 1U0JA 1V16A 4S05A 4E3WA 3V9PA 3GJ5A 1C1YA 3OTGA 3RS4A 1E1DA 3IILA 5FEMA 2XEDA 3JPSA 1IN8A 3H4MA 1IK6A 1U6IA 2QP3A 1PFVA 4JJKA 4EMBA 1MTOA 1RI1A 3DEYX 4U5XA 5KJ1A 1WQ1R 1PZMA 2BPOA 5IM4F 5LMUB 3NO4A 3NHAA 2WJAA 4JVMA 4TL9A 2FR0A 1ZNQO 3WTCA 4OQNA 3AB7A 5DKFA 4ZANA 1JMSA 2WJ3A 2HEGA 5BV1A 4MAFA 4A0RA 4U7GA 2AWNA 1C50A 1WRBA 1RAAA 1GTMA 3AEQA 4CM4A 1X15A 5CHYA 3KKEA 3GN2A 1J9GA 4YJHB 1NVBA 1VG8A 1WO8A 4YRNA 4B7ZA 3GU3A 2IHMA 3PGVA 4O0IA 2FUCA 3BXFA 1PUZA 3G49A 4J3FA 1TVMA 4XDYA 1N5RA 4EBCA 1XZMA 2QV7A 1CB0A 4YAEA 1ZGAA 1P77A 3FPHA 4YROA 5H2FU 4NH0A 1W4ZA 1OB5A 3C16C 2B1IA 1FRZA 4EB3A 2H6EA 1X42A 1JSRA 3ZE0B 2M32A 5KHOC 5DT2A 3EWNA 4YASA 3LO5A 1AUQA 2BOVA 1KIMA 3H2BA 3PFIA 3OFVA 4II7A 3T3NA 2RKBA 3ETLA 5JSYA 4M38A 4LXYA 4FUTA 2Y1EA 4ZT4A 2UU9B 4F86A 2W8BB 4O2AF 3EASA 3MAGA 3HJUA 3FUVA 1GO3F 2ZBUA 4BBZA 1H1TA 4BV8A 3PX6A 2H0AA 1YS4A 4XWYA 2E8NA 5IXYA 3SIWA 3I1JA 2BM8A 1S01A 3RH0A 2DU8A 3QVMA 5C8VA 1RLIA 4DEYA 2O3UA 3TRHA 3CISA 3LU1A 1KJIA 3DZGA 2YBDA 4RV9A 4TN5A 4ND2A 2XUAA 3UYKA 3K9CA 3RB4A 1N5IA 4EFNA 4MF8A 2XBLA 1J7JA 5FUWA 3WHPA 4H7FA 1KP3A 3CLSC 4Z0HO 2XIDA 2NRVA 3K15A 4QJ5A 4K28A 2E3JA 4FNGA 1J99A 3AL2A 3HR7A 2ZI3A 2GA8A 5DI3B 3UEOA 1Q3VA 3UO8B 4RGQA 2WG1A 2WTNA 1EEHA 1DVRA 2ZYTX 1B23P 4GI5A 5CK4A 4WFJA 4F9FA 3UMGA 2I03A 3DTVA 4IKEA 1WJGA 3GLIA 5F35A 1PSWA 2CV0A 3PP8A 2ZQ5A 4IRDA 1XWFA 2A0XA 4I2DA 1SMKA 5BV7A 1L5ZA 1DHRA 2J41A 3DBRA 4OUDB 4NMMA 5AJZA 2HCBA 5J2FA 3B51X 1HT0A 1ZQ1A 1RACA 4MA0A 3FPEA 1J2TA 4IF4A 1Q0PA 1PR5A 4ZOCA 3CLTC 1B4DA 3K5WA 5FNVA 1XYYA 4MUXA 3HRIA 4C08A 1V5FA 4GPBA 5KNBD 1RCFA 5T57A 5KT5A 4HXEB 1Z1BA 2H57A 2L19A 4H3HB 4KHZA 2HHJA 4LJLA 5T4FA 3CKMA 1WU7A 4QVGA 5FQNA 3TDMA 3ZV4A 3ZJVA 4TMTA 1ZOLA 5E4YA 3TJRA 1FUYB 2M6RA 4LAFA 1AKUA 4TQUS 1DCMA 4IKPA 2PUHA 5BNTA 5EN4A 5CVVA 2M9NA 1MENA 4OOEA 4TLDA 3UWDA 3E3MA 5KX5F 1KK2A 3KSUA 1II9A 3EXHC 2BKAA 4I1VA 3ZNPA 2ZR7A 5ICGA 3GPIA 4YRBA 1Z7EA 1UEXC 1WF3A 4BXOB 1JPVA 7ICIA 2LW7A 4R8SA 3MR2A 4L8FA 1P2TA 4OYYA 2ZIWA 5BQ5A 4RZIA 1NF3A 2VHVA 2X2FA 2CDAA 4CMIB 3E15A 4RZQA 3MR3A 1NASA 5JNWA 2XECA 2QMHA 3SR0A 1WZIA 4P54A 3WC4A 2IYWA 3DQQA 5LZ4A 1KI7A 4URVR 1NMYA 2O2HA 4CR6A 2GCGA 3HXPA 1Z5WA 2ZRMA 4BRZA 1XYVA 4E6PA 4JLBA 2OGUA 4AJPA 3OIYA 1O6BA 1MHTA 3NHMA 5AKXA 2V1XA 3UFXA 1J09A 1Z88A 3R7FA 2YWXA 3V33A 2NPOA 4LGMA 1QHHB 1YB6A 5FOUA 2XNSA 2VP2A 3ZI0A 2WPDD 2KBEA 1R8QA 1WVIA 2IIQA 1J0XO 2GN8A 3KYCA 4FCWA 4PIPA 4EZ6A 1LV7A 2ESRA 4Y9DA 2Y6VA 4R1QA 1NG1A 2DKOA 2AFHB 4YAJA 1RYUA 4WXEA 3S0JA 1NBIA 1YULA 5FWXB 1NK0A 1SXGA 2NT3A 1KHTA 4CIWA 2NACA 4QXQA 1E7RA 4YGXB 1MXFA 1O3YA 6GPBA 2BFWA 4CEJB 3K53A 5C8YB 1AKWA 4HEA6 3DOIA 3IIEA 3CRRA 3A1DA 3MILA 1TK5A 5KDDA 4Z2AA 3CRVA 3ORFA 2AFRA 1UCVA 3EZGA 4ZU3A 2HL6A 2IEAA 4FZ3A 5DYNA 3UJNA 2ZSAA 5IS2A 3EVEA 5F98A 3X1WA 4CRXA 4NVRA 5BSKA 4F2HA 4HTAA 4JI3B 4ZJZA 4V1CB 2BEUA 3AGQA 1CJBA 2OO3A 4EP1A 1TUGA 3O4RA 1O95D 1CIJA 2XB8A 3FCUB 3E1KA 5ALQA 3DYBA 1DKPA 3A3OA 4CCYA 3RF9A 5JDIA 4YR9A 3GMIA 4X44A 2GEUA 1RKQA 3WB1A 1K6EA 5CB4B 1L7NA 4U02A 4A2CA 4J9QA 4BP8A 2C42A 4AUKA 1K8QA 5ILOA 2IYZA 5EUMA 3MJCA 1F1JA 2J32A 3UXMA 3IPLA 4PPYA 1X6IA 1JAZA 1PVQA 2FZ5A 1E3LA 4G5GA 3ITNA 4M1SA 3SHOA 5IJ9A 3H17A 2PO7A 2W2KB 4CM3A 4PZYA 4DDVA 5HOEA 2XCIA 1P91A 4BAUA 1GWNA 2A9QA 4MV6A 5IAEA 4BNZA 4JY7A 4O4HB 2DPYA 1W93A 4AS1A 5SYNA 1JIUA 4HTFB 3UG6A 1N1GA 1AMOA 3SDZA 3FPLA 2A5YB 1RI3A 5L95A 3V6JA 3VZDA 2JVIA 1MQSA 3V32A 3HKDA 3K1YA 4NIMA 2PZLA 2XPCA 3NC1C 2F3PA 3IPYA 5J4YA 1V8PA 2ZYGA 5DGDA 1O2DA 3DB1A 3GVHA 1Z25A 3ROZA 4LQ4A 5HOQA 4ELTA 3MQ4A 4N65A 4DOCA 1QRAA 1Y5IA 1HO3A 3G2JA 2IU4A 5CRXA 5CJ7A 3RD5A 1ZQSA 3AJEA 3QVGB 1DG3A 1JB9A 3WL3A 5ALRA 2GRUA 3B9BA 2ZUEA 3UJHA 2W2LD 4G0NA 4C88A 1YFZA 3HS3A 2ZR0A 3VQTA 1SB3C 1XJQA 3BMXA 2HRBA 1NP3A 1U3CA 4NNJA 4DBVO 2JRCA 1ZD2P 3GLHA 5EMNA 3VVBA 3HE3A 4MK4A 1HNWB 3TI9A 1V37A 3PR1A 3NR2A 3N3BC 4AN0A 4ENUA 2FI1A 5IMSA 3OTOB 3FTNA 2C5SA 2YXEA 2YNMC 3KYDA 2JFOA 3MRXA 2WAOA 2PKWA 5KKCA 4MVJP 4HG2A 1QRSA 3SSAA 4MS3B 5H7XA 3BBPA 3E9EA 3GNLA 2NSHA 5ALOA 2WSLA 4TT8A 3RREA 5M29A 1FTGA 3EBPA 2AG1A 4MQFA 4PQYA 3PYLA 1WKVA 1NQ5A 4KITB 2X4IA 5A0FA 4DQXA 3ADCA 4ENSA 4AZ0A 1ISMA 1T9KA 4DR6B 3E03A 3WO1A 2XCRB 5B4UA 4I2AA 3NHSA 2XA1A 3IHLA 5UKDA 4G26A 4AG6A 2UYGA 2DQYA 3LT2A 3NEYA 4D44A 3MMZA 4IV8A 3C7CB 4ND7A 4M9LA 3ZK8A 3FWHA 2V7GA 5J2DA 2VJDA 3FOBA 4UE6A 1EBFA 1TMYA 1EDEA 4ZKDA 5FBVB 1ZW1A 4P0PB 2BGWA 2BFFA 2IUEA 3H2IA 4EFMA 4Q24A 1QOQB 1VPEA 4NPAA 5D5HA 4RQ0A 4J3JA 2UVWA 1GQQA 4DY4A 1CPYA 3TZHA 2NU8A 4RUKA 4IIJA 4YWJA 3SC4A 2RAPA 5GMOA 3EFOB 2JGEA 3RWMB 2F90A 3I8SA 2DM6A 2PRSA 1NU8A 2NO9A 5HDBB 2D0DA 4TMKA 2WFLB 3JYLA 1DBVO 4DIFA 1EK6A 3TZEA 4G97A 2ZBVA 3OMLA 4LK2A 2RHFA 4Q02A 4F21A 4M8KA 3FYUC 2HDHA 5KFSA 1PG5A 3RAGA 1PNOA 1Z36A 3R3UA 4YRIA 3KUCA 2KJQA 3HCEA 5FWYA 4INAA 3KXDA 3SMVA 3DNFA 4K26A 4DW8A 4XQ8A 4CN8A 1SIUA 3CVOA 5CA1B 5AUPB 2NIPA 4JDPA 4JJ6A 3BM5A 1ZR4A 4BNHA 2C9CA 2V54A 1LKZA 1P74A 1UBFA 1NKCA 4BLSA 1NVUQ 4NCJA 5EWMA 2ZJYA 2PTHA 3IA7A 4TV9B 1S9HA 4J9MA 1CTQA 1JEEA 2XF2A 5CK5A 2YV2A 2NTNA 4U7PB 1QTQA 1ZA1A 1Y1LA 2ONCA 3H9BA 1JI7A 4C6TB 4EVSA 2J3EA 5CU7A 2X0JA 1CNFA 4QYIB 2CLMB 1QE0A 4K6KA 2DKZA 2B8TA 4MVJI 3PNPA 3KR0A 1H05A 2EW2A 4X61A 3B9JA 2ZUVA 1T9GR 5A7HA 4X3PA 1V71A 3L18A 4IXMA 4P4LA 4OSEA 1TXGA 2HJ9A 3UUGA 1J2YA 2F8KA 1ILWA 2J0UB 5EYPB 3KB8A 1WZEA 3TIFA 4DV1B 2G3YA 1K8YB 2P77A 4IDHA 3LF1A 1SEPA 3AY0A 3LAWA 3I45A 3B78A 1ODJA 1OZAA 1TYDE 3FRJA 1I36A 5K3CA 1PZFA 2BI7A 3F8WA 1CFZA 3W6PA 3AM3A 2Q4TA 5A5GA 4IEEA 3IMKA 3UMJA 4DR3B 4KRFA 4JC8A 4IQTA 4PSKA 1AKNA 1N25A 2KVSA 4UARA 4Q3AA 4DCOA 5D7NA 1LPOA 3O7MA 4Q1CA 1ND6A 2ISSD 4JIMA 3L6OO 2EFJA 3VKFA 4RK0A 4L27A 2P6UA 4UNRA 1EJ2A 4WBXC 4Q1VA 2EIHA 3FHJA 3IUJA 3V7UA 3PF8A 3M7IA 4FNAA 3W90A 1WMFA 5DYGA 4O8CA 2NUTA 3QU4A 2PGIA 4LTNA 1JECA 3I23A 3PQFA 4P38A 1DRWA 2QSUA 4QGGA 1N56A 4LY9A 1AE1A 2AA3A 1WMSA 1QAQA 2FSVC 1CDDA 3GVXA 4F5PA 2NN3C 1ZQEA 5MN5A 2JLCA 2NNLD 2I54A 4D4IA 2MSNA 2DWCA 3VU9A 1QANA 3I61A 1EFAA 2I33A 3W0LB 1W94A 3HO1A 1JLHA 3PDWA 2C57A 1NDQA 2Z4SA 3VNVA 4P3XA 1KMHB 1MJNA 3FCSB 1SQ0A 1XTBA 1QU2A 2YJZA 2BMWA 1RPLA 5L3QA 5HJEA 4BYGA 3OQHA 3SS7X 4A9AA 1RU3A 5GADl 3ZCVA 1XHEA 5AHKA 1UDWA 2CXOA 3LOQA 2VJMA 3DDUA 3MBIA 3OFKA 4Q7LA 3RROA 5B4TA 5AM3A 3ADKA 4UNNA 1FF9A 2ZSDA 2BGMA 1QCZA 5HM8A 1O0BA 1A88A 4NFSA 3A9VA 3L79A 4FSXA 3L0SA 3NFYA 3HJFA 1XZLA 4HLCA 1JP7A 3UNXA 2C9BA 3AUJB 4H4EA 1K6IA 2WT8A 4MV8A 5KQSA 5CURA 3D43A 3ZWNA 5ISMA 4A26A 3P9KA 1TEXA 4G4SP 4C78A 5BWMA 5BN3B 1A9QA 2MSCB 3U6KA 4OO3A 4G9EA 2I2FA 2H2WA 3V7FA 4WCDA 1Y37A 2AZDA 3KKNA 4P4TA 1SAYA 4LF8B 1DX6A 1TGVA 2QN7A 1E1CA 3A3YA 1U1GA 4U7DA 1J5XA 1BS9A 3BE8A 1DLJA 3L01A 3PRJA 1MH9A 2BT4A 3JPQA 3HN7A 3G7SA 5EIWA 2P69A 4BEVA 3PE6A 1NNI1 4DUPA 5EESA 3VHXB 4EO4A 5J0TA 2NXEA 4UOZA 4DIOA 4KLTA 4G3XA 5CB1A 3SHVA 5JMOA 4RTJA 3A27A 4H7PA 1LPAB 2C7QA 1QORA 2X7HA 5EGNA 1MV5A 1XQWA 3KBBA 1EK0A 3DV9A 5L7YA 4ZI7A 4IHJB 4NK5A 3P9NA 4WZBB 1B93A 2HMVA 2WD7B 1N7GA 3WKAA 1G5QA 5C5JA 1C7ZA 3PK0A 1XQ1A 1ZCFA 4FM9A 1CLEA 4IIXA 1J0BA 1EA7A 4NFLA 3H18A 1JJAA 2J0VA 2X1LA 1K7CA 2GJSA 4CCWA 3NT5A 5A0VA 1JFTA 3QU7A 3HLKA 1ZO8A 4ZEOA 1JQBA 1YMVA 4HVLA 1GV1A 1GXSA 5J2HA 4GM4A 2W3SA 5LMNB 1YZNA 3WLNA 4XFDA 2ZZNA 2EH9A 1R9JA 4TS3A 2ADMA 3I5YA 1YC5A 5F7JA 4EG6A 3NS7A 1YRQA 3P32A 1AQNA 3NRBA 3GNTA 3DHEA 1XNGA 1NR7A 3DV2A 3NP9A 3ZQKA 1E60A 3KJQA 4CIAA 5FFFA 2ZZMA 2VH1A 621PA 4CG2A 4G81A 1X1CA 3LC7O 1GAXA 2W11A 1X9IA 3PU6A 2XSZD 4M7PA 4UTNA 2CXTA 3RIYA 1R4MB 5G4KA 4F6RB 3N07A 1TUBB 4FB5A 3V7WA 3KE8A 2H5IA 5AW2A 3T1TA 3GIKA 3BFPA 3N58A 4S1PA 2J0SA 2PD6A 5MFZA 4B9EA 2OR3A 4Y2XA 2YDYA 2JIOA 4LZZA 1SV0A 1KOJA 3ANXA 5AK5A 4ICIA 2GZ3A 3QWBA 1UKBA 4L6CA 2W8KA 4UM7A 2KFZA 4UCXA 4AJNA 4OHKA 2EKPA 8ICKA 3HC7A 1BHQ1 1QTMA 3VAYA 3IUQA 4Q18A 1R6UA 7ICNA 3U31A 4CWAA 3DP9A 3RJIA 5DGTA 4A3SA 3RYHA 3GGOA 3FAKA 1IY0A 5JHGB 4YO7A 4OMFG 3DFZA 1MKYA 2ZRNA 3TLYA 1Y1TA 2Y0CA 2BF4A 4NNOA 3GEPA 2L69A 3KQOA 2JEYA 4MW9A 2FE4A 3U3KA 4ETNA 1JYSA 2Y1KA 4PGMA 5JBQA 4ZTBA 1JDVA 1AKMA 1AD2A 4HF7A 2LP4Y 2I9PA 2QY6A 3AUFA 1WPRA 2NNWB 3RJEA 4NYMQ 1EDOA 3THSA 3Q5DA 4F45A 3OJUA 2VYCA 4FFOA 3DKVA 1W4RA 10MHA 4IC9A 1NULA 3OCJA 4ZVVA 1BC5A 3NUQA 2VTKA 3T7AA 3BULA 2TMGA 3RPEA 3ABIA 5PNTA 5HR6A 2IDZA 3DM9B 4BQRA 4H6WA 4MVCA 2I87A 4ES6A 1T3GA 3RYTC 4QDZA 5KYXB 4DA4A 2VFAA 1J2EA 4RE5A 1G98A 5DBOA 3DE1X 4RPCA 1DJLA 2FEKA 4G67A 2K4EA 4LV6A 3VHRA 5TMBA 3IBSA 4UB8U 3VNBA 6REQA 2R96A 1JHPA 3UH0A 2VHZA 4JVSB 4HUQB 2GAJA 4N3NA 2QJTA 3F2DA 2P6OA 1QF9A 3WMEA 1TZBA 2WINI 4RQMA 3MVEA 4F93B 4BB6A 1JZQA 5FBRB 4Q05A 1NSTA 4US2R 2GO1A 3KOYA 1YDHA 3HKCA 1FLAA 2FCRA 2IBKA 2YJ4A 5CA0B 3F6EX 2ODPA 3WGVA 3BORA 5JMPA 4CU5A 4YUAA 4BWYA 3F96A 1C1XA 2PGXA 1Z4LA 3L7YA 3FCEA 4CTMA 2ODGA 1CWUA 1RI4A 4O4HF 1AK9A 4EW3A 2NP7A 1O0SA 1JKFA 2XCPA 3MFQA 2D3TA 4DCPA 5U9CA 2ID4A 4KK4A 3TD9A 2MAXA 3JD1A 3QTTA 1CQWA 3MUNA 1TECE 3RVLA 4LUCA 3NUZA 2D2FA 1ZCJA 4BQFA 1JHMA 1PNVA 5TQ2B 1BXGB 2YHUA 3GJ8A 1FXUA 4FMBB 5J0YA 3CHYA 2Y1XA 2G9QA 1NGSA 4QOIA 3OTHA 2OFXA 3DW1X 3LCMA 5E1MA 4OHFA 3U39A 4Q12A 1ZHHA 4EMUA 1CF2O 2J3IA 1MOPA 4CIYA 4EB8A 4JI0B 3SSNA 3F6PA 4A1FA 2OVBA 1BU5A 2CHQA 1K68A 1VTKA 4UCWA 1HZZC 3HU3A 2IE0A 8ICSA 3G2LA 2EEZA 3MOIA 4KN9S 1KK1A 4F3NA 1M1YA 2OCXA 4GR4A 5IW8A 4REOA 1OLUA 2QTWB 3IMGA 1CK4A 1T8PA 2ANBA 1N9KA 3F3SA 2DB3A 1SPBS 1H0RA 1T36B 3U3MA 1QFZA 3EDRA 1XSEA 1FNDA 1E66A 2YJ5A 2A9KA 3ABQB 1CQJA 1OY1A 2DPLA 5TGDA 1SURA 4H60A 5H8WA 5JJIA 1AUVA 2B6HA 4YFKA 3TZ6A 2E8MA 1UDCA 2BZSA 2HWWA 3DDSA 3HL4A 4WTOA 2CL0X 1DEXA 4BZWA 2IYYA 4CQMB 4JKYA 2HRCA 3QX7A 3DDOA 4I28A 2YOGA 1C3EA 2XMSA 3W5AA 1WZNA 1T3SA 3AKCA 1TAMA 5DGIA 1MP0A 1IY9A 2QRJA 1W44A 5FWNA 4X8MA 2QN8A 4B6JA 3JATB 4GPAA 1OXJA 1USUA 4QPNA 1FBTA 4AJIA 2AJLI 4QUAA 4BO9A 3D59A 4RY8A 3ONFA 1E4EA 3I2YX 2IWRA 3BGIA 1C0IA 4TWIA 4AW9A 4BLTA 4ENVA 1WHSB 5KFNA 3EIOA 4B3MB 2NXJA 4LS3A 4I4CA 1I3NA 2IKSA 1AG9A 3K0FB 2BFNA 3AFMA 1PG2A 3OIVA 1L5RA 3W9BA 1RYFA 2X1MA 3IKLA 3OECA 5F52A 3H86A 4E46A 1C4XA 1TKBA 4X41A 1VJGA 1U0OC 1Y6GA 4MWBA 2ANCA 1PV4A 3KE9A 5HIMA 2NV0A 1GPUA 3B7PA 1JR4A 3WQSB 3HCWA 5E9WA 3UMBA 3T3HA 3O8QB 1UZNA 4UBCA 3V1YA 4BATA 2BCQA 4V0RA 2UVDA 3C1AA 2WAQF 5L1KA 4K87A 3UZUA 3QPDA 4AY2A 1GN8A 4ERXA 3FVWA 4YP0A 3REOA 5G0VA 4F7WA 2I1LA 3G5LA 3ME5A 2FPPB 3SM9A 1G3MA 2HMAA 3AZPA 1KZ1A 2HMUA 4TN1A 5KHLB 3UAVA 4QXAA 4NDAA 1ABFA 2M6LA 1Z26A 3IPCA 3UW1A 4C43A 4HNGA 2OXFA 5CA1F 1WW2A 5GZ1A 2N46A 1LDBA 1ZD5A 5K5EA 1OYYA 3PJFA 4L3WA 1G8HA 3HY4A 2JLUA 4PX9A 4DVGA 5DB6A 1EJ0A 4BNMA 3CVUA 4TV9F 4CTNA 2W00A 5DBFA 5JBNA 1ZJ6A 3CZPA 1HEYA 3ASUA 4JBIA 3FCOA 3UHAA 2NZ8A 3U4GA 5JCOC 1TLLA 3SNKA 5CEHA 4HLUA 3VR3A 3D1VA 5IFKA 4DCVA 4DL9A 1HV8A 5JZSA 2EAOA 1F2TA 1V85A 1VL1A 3KSAC 4F3TA 5BN4A 3MAAC 1QONA 3OZTA 3C6QA 5FWAA 1LS6A 2FPXA 4TV8B 4PH5A 3TAXA 3OOSA 1G2PA 3OAAA 4DMKA 4UVDA 2GN2A 5K0ZA 1Z19A 3NT2A 4FWTA 3X2EA 1UM9A 2FFAA 1RM3A 3CZQA 1JXQA 3TYXA 3DQZA 2AOWA 4HZUA 4BRUA 4GUAA 1FQWA 4OFZA 3EQ7A 1T34A 1PSZA 2OL4A 1U0NA 5KFVA 5IHXA 3UHOA 4BMSA 4IYJA 4JLNA 1EE1A 3OF2A 5KJ6A 1V4BA 4Y6GB 1VMKA 5REQB 3T34A 3JY6A 4E51A 3IURA 4MVJH 3VR1A 3CEJA 1NLYA 2CYCA 2XY4A 3SQLA 4YIKA 1D04A 1G19A 3Q3JB 3VR4H 1EP3B 4DYHA 2XRFA 3QBDA 3OA0A 3VNUA 4J1TA 2PFQA 4F0JA 2PUEA 2ZCUA 4CLRB 3QKUA 2COEA 4YJKA 3AHGA 2VQEB 1OGYA 4BEJA 2H92A 5KYGA 1P1CA 3IEMA 1ORDA 2NRZA 2IXEA 3TM4A 1ZM2A 4CM9A 4PAQA 1F2DA 4LVCA 1TIPA 2NZJA 3BE4A 2JGKA 4Z51A 3OHBA 3MT7A 4PG4A 3PPYA 1LDNA 7ICQA 3H5LA 1CS0A 4CQMD 2E9SA 4MFCA 1GAEO 3K0CC 3DMTC 1OYVA 2EFYA 5KVQA 3HB5X 3WK6A 4HS9A 3I1YA 1DQNA 1HY3A 1Z4NA 5IC6A 3L7IA 4B0PA 2N1MA 4AD8A 3OJLA 1VOTA 2BKEA 4XIFA 3L7KA 4NLCA 2Q9CA 5J40A 5TQJA 2WKPA 1IM2A 3ZD7A 1E6CA 5E1OA 3BL5A 4N6OA 1MW9X 4OXRA 2ZT7A 9ICEA 2VF5X 3BQTA 4AECA 1MOZA 4MRPA 1T0UA 4W9NC 1VPLA 4JUCA 4JWNA 3BERA 3TLMA 4OBEA 2II6A 4RQ8A 2PT9A 2PXHA 3A05A 1A9ZA 3T9DA 5JAMA 5KFXA 3DVAB 4KX5A 4Y6RA 1RZRD 4AIIA 4LF6B 5IYZA 2LM1A 1SCQA 5KWEA 2IU6A 4RGYA 1DJOA 5JROA 1MO4A 4W4TA 5ENDA 5ALPA 1GGFA 1RPJA 3TB4A 2WJIA 4IDGA 3L7NA 2Q1WA 4GZMA 3CCFA 4EL0A 4BJHB 2BZ1A 3OPNA 2D4HA 1KI1A 2NXCA 1EUYA 4GWGA 1L0BA 4ITRC 5TPZD 1QIJA 4K6CA 2D8MA 1JDBC 4KAAA 3MJEA 3PUKA 3QKWA 1MT3A 2K7FA 4H7KA 4RELA 3SXJA 4KPUB 3I30X 3SAGA 2H3FA 2NO6A 5CXSA 2W3RA 4IJVA 1S0OA 2PV7A 1TQ8A 2CL6X 2QUAA 3KUUA 4K9QA 3SQOA 3C3BA 4QGBA 1ESZA 3P20A 4MICA 4UQPA 3DFIA 4HDQB 3MTEA 3ZIDA 5AJXA 4EZEA 1XZFA 4HYTA 1GLNA 5JSUA 5HUQA 2QL6A 4HFNA 3RB8A 1X6VA 5B30A 1MX9A 1JVNA 4UHCA 4IHJF 1UMDA 4DNFA 1NVEA 3F5DA 4CODB 1T26A 2FMIA 3OE7D 3TINA 2YXNA 4FQ7A 5K45A 4EK9A 4M22A 1GRCA 3KQQA 4B75A 5AVJA 4MR9A 2BDPA 5E3JA 4N47A 2AI1A 5AJVB 4YXFA 3OZBA 3PC7A 5JTIA 3U5ZB 2HMTA 1KO7A 4UULA 4FGKA 2QYTA 1R8SA 1W25A 1AB6A 3KFVA 3N7AA 2ZRHA 4FT2A 3UQ2A 2VPZA 4J1SA 1PDWA 1ZVVA 3BBLA 2H5XA 4XJVA 4CG0A 1OXMA 3GRVA 2RHLA 1I3CA 3ANMA 2W03A 5L3ZA 4H6VA 2PVCA 3K1AA 3RVPA 3ZOZA 4MRNA 4EB6A 1BWRA 2QARB 3IEKA 4UW9A 1L5UA 1LWOA 2VNIA 1Z2EA 2XXBA 3D9QX 4KXMA 3SJZA 1LTKA 4YRDA 5DP1A 5LYJA 1ZQKA 1E89A 2JR5A 4C2AA 1HDCA 4R7TA 3CJRA 5F9FA 3U56A 2DPJA 4D6XA 4DNQA 2OYRA 2TS1A 3DDZX 3D0RA 3IEVA 1X7XA 4R8UB 1U4OA 1VLQA 1BXZA 1QIDA 1NXQA 1RJ9B 2E37A 3PC4A 5C8ZA 3G8CA 1N2CB 2A9FA 3LG2A 2IK8A 3M3PA 3PLAE 1M2OB 1D5WA 5DQGA 1K5GA 4J7XA 5BUCA 1P33A 2XI9A 5FBKA 1I2DA 5EJEA 3CR7A 3X1DA 1IK4A 2P6PA 1E98A 2HU8A 3E7DA 5JD6A 4M98A 3DZ8A 4WKOA 3UJPA 3ZVRA 1T0HB 2P2DA 4P82A 1LC0A 4G0WA 1LUAA 2AFVA 3ZVNA 3DMPA 4A2PA 3BKXA 1WABA 3N2NA 4UEKA 1BPXA 4EB0A 3GLGA 3P19A 1Z62A 1WXDA 1PR1A 1EFRD 3GVCA 4HWGA 1XUOA 5LJLA 5CX1B 1N5KA 3P7MA 4L5YA 5L3VA 5BWBA 3OT1A 4XX0A 5AKLA 3NTRA 1TO1E 1JG7A 4MUAA 1TMOA 5K8UA 1Z33A 1RTTA 1TKDA 1MGOA 4B3TB 2M0NA 1T5DX 2WFMA 4LK3A 3W77A 3MHTA 4ZOLB 2NU9A 4XDGA 4ER3A 4MAAA 4ZT7A 2Y1CA 1RZUA 3KX2A 3QNWA 1I8TA 2QRGA 1JFSA 3TZCA 4E4YA 3OZVA 2AXTU 2JCSA 1L7XA 4LECA 2ZYVX 4I36A 5G1PA 2I76A 4QU8A 4QARA 1RM6C 3OPMA 2C8KA 4MGHA 1YBVA 2ASVA 5I4CA 4KLAA 2FJ0A 1AHNA 3ZNQA 2AXNA 3V4PB 1YS2X 2XKKA 4L74A 7ICEA 4MWOA 1JAXA 4ECQA 1KYVA 3GK3A 3U81A 1KEWA 2P2SA 3KVNA 4BGUA 2HHQA 1IWBB 4AJEA 2EFHB 2G17A 3D0QA 1GKIA 3AIMA 1JG4A 4Q4DA 4U2BA 4QATA 1SPXA 1FU8A 3DT6A 3QE9Y 1GARA 2PU5A 3O26A 3SX0A 2E1RA 7ICHA 3K6RA 4Z7JA 1ECGA 3PGLA 4NONA 1MGPA 2C9ZA 4KSYA 3NCTA 5BORA 1N60A 5AW7A 3EGXA 2Q5FA 2PANA 2OBLA 5CYGA 2ORWA 5AVXA 4JUBA 1EUQA 4TURA 2K87A 2J08A 2H7YA 3RB0A 1XVUA 3CCBA 4X0EA 1FFYA 1EGHA 1JQLB 4D4GA 4KDEA 3C7AA 3V3KA 2OMKA 1KPIA 2GXAA 3VA7A 3K70C 1MIHA 3FPSA 1OI4A 3PICA 1V4NA 3QG5A 3SFTA 4RZRA 2VAXA 3JYQA 1PS0A 3HT3A 2HYIC 4OSPA 1IZ9A 5FQOA 5IIJA 4L9AA 4Y2SA 3RJKA 4DQKA 3NTLA 5JCPA 3F2VA 3V4OA 3HV2A 1TT5A 1VSUA 2RAUA 3HNOA 3ZU5A 3G9XA 3MBOA 5JSZA 4BUGA 2XWQA 3D8BA 3PVCA 2H2AA 4R8VA 4Y6QA 4W1QA 2QEQA 3E9DA 4YTEA 1UP4A 1QTRA 2KK0A 2XJ9A 3DPSA 2IQ5A 4G8CA 3NG1A 2CJPA 3FYTA 3TNFA 4U7TB 5MGNA 1EJBA 4DM7A 1IAVA 2XLCA 2CYBA 1PTJC 1IEVA 4OBBA 3RVMA 4UOEA 2VZ8A 4JI8B 1KZHA 4CM1A 4DQUA 2D5CA 1GZ4A 2JH9A 3DCNA 4UDNA 3ECSA 5CFZA 1CY0A 3EARA 3PQ8A 3D3WB 2WSYB 2MCFA 3ZGNA 1FVFA 3ZBQA 5BN5A 2PX3A 3SBDA 3THYB 2ZVDA 2H85A 4MXDA 3K7EA 4WNCA 3LWZA 3VH4A 3IQDB 1E8DA 2WI8A 4U6QA 2CHGA 2KSQA 3BXPA 2C77A 3PD1A 5DBAA 3FBWA 4HX2A 3WA6A 1ICEA 4ZC8A 3G7NA 3UA3A 2C29D 4QDJA 5K3FA 5GIOE 3NTOA 2F6RA 2UDPA 1V97A 3MYYA 2EFCB 2UUBB 1L3TA 1DGSA 1UA1A 4KREA 5HS4A 1G2QA 1N2XA 5CWRA 4G4IA 3UUWA 4K2AA 4YV1A 3SC2A 5K03A 1HRKA 5A3VA 4Z4QA 1A7AA 5TT0A 3SHTA 4JI4B 1DJPA 1L1FA 4C7KA 3W2EA 4GT1A 2QTVB 3SYRA 1F4PA 2IZ6A 4JP1A 4NF2A 1ZC4A 5JVDB 4UNSA 1SC1A 5AM2A 3W8FA 3MS2A 1N7JA 3OZDA 1NSYA 3F2CA 1FU4A 3RFXA 4BFTA 1XDGA 2QVZX 4M7RA 4ZVTA 4TVKA 1AN0A 5FO1A 2HJHA 1BD4A 5EEGA 4RHYA 4PBTA 3G7UA 2QAGB 2PMEA 4MCHA 4O3NA 2VLBA 2ACEA 5HTKA 2BRUA 4YECA 3EA0A 1M34E 2ATEA 2BFAA 4QUGA 3WWYA 3ZXSA 4DPKA 3I0NA 4CKZA 4EUKA 2LZ0A 2VHUA 2PL1A 4XW2A 2YVUA 2AFIE 1YUMA 2HPVA 3EIHA 1UZUA 3GV5B 1XEWY 1JDZA 1ZU4A 1GZ3A 5A06A 2BPGA 3CX4A 5CTAA 5B37A 4HQKA 1QOZA 3A0HU 1KRXA 2A4MA 3WHKA 3PQEA 3RK1A 4ZCMA 4J07A 4KL8S 4C7JA 3OETA 2XY5A 1R0BA 2D13A 4C0WA 3ESYA 4F8YA 1DTSA 2R4UA 3BGVA 4ZCPA 4W5TA 4P7JA 4WXHA 3JQ8A 4UAGA 4MR8B 1FSZA 3EOBI 2BM1A 2PA3A 1NJ6A 5AKYA 4INPA 1KQ3A 4YACA 3E58A 1ESCA 5J2KA 4LYDA 2DE0X 4JT4A 3L82B 4GMKA 4TWJA 5LQNA 4LJKA 1A2KC 3BJRA 2EWVA 4LZJA 4YP5A 3NIWA 4G8JA 3CO5A 4Y6LA 3ZE1B 4EFLA 3ETEA 4DL5A 2P65A 4NLNA 3ZHYA 1C4KA 3VNQA 4TV8F 4OI0A 2MUTA 5KVCA 2NT4A 3R6LA 3DJFA 3B5IA 3P2MA 4LXXA 4DVJA 4EVIA 5L1IA 4DQVA 4BP9A 2HSZA 4YRPA 5K9ZA 3UFBA 1BQ3A 1RC0A 1P4AA 2QT0A 2HHHB 4KPEC 3I83A 1H42A 2GNOA 1UPAA 3FFXA 4DCUA 1U02A 3TX2A 1KGSA 1E1RA 1VG9B 5AM5A 3FDXA 1NX6A 3SI7A 1Z63A 1ZP6A 2W4QA 3SENA 1O6GA 1VLHA 1X0VA 3UWSA 4UOQA 2XYRA 2QM3A 4AWXA 4KHPB 3EPJA 4E2XA 5D7BA 3CO0S 2A3NA 1E0KA 4KVZA 4OFXA 1OIWA 3KXLA 3GZ4A 3HKZC 1EAMA 4OATA 2QKYA 3BX1A 3A1TA 2A5DA 2ESEA 2EATA 2G5CA 3WE7A 4YB8A 4KIGA 1T4BA 4HCJA 2HF2A 4P08A 1IXSB 1I30A 2EZUA 2KVCA 2VUHB 3CG4A 4M53A 4R1SA 3DEJA 3VR0A 4EKGA 3NDJA 2FDRA 1DBIA 2FXVA 1D2MA 3SXUB 2GAIA 4QNMA 1BJRE 5AJTA 4HQFA 2GZ2A 4Y6PA 4Q39A 2F55A 1Z5OA 2JIZA 4GLFA 1MX3A 3M4ZA 5ANRB 3U60B 5DIZA 2G04A 3H2JA 4QQKA 2XE7A 5AKIA 2KJ9A 2QMYA 4AP5A 3OCCA 2PU7A 1EEXB 4F3YA 4N8EA 1AGPA 1KQOA 4EHNA 1XEAA 1XU7A 2MRLA 2IYEA 1DSSG 4KKVA 5EJ6A 4HO1X 2R5FA 2YH2A 8ICYA 2OV1A 3LUPA 2WR8A 3G6WA 4DSIA 3GOHA 3WX0A 4F11A 1VKJA 3GDFA 5JH7A 2ECQA 1A5TA 4JYMA 4PZPA 1ZICA 8AT1A 1ZWKA 2MJLA 4FSHA 1O96B 2CK3A 3VHQA 3O84A 3MF4A 1L5KA 1KYXA 3WQRA 2CXPA 3URKA 4K6FA 3L41A 3PR3A 3FOCA 5JCZA 1JAHA 4AKSA 1CYEA 5LQRA 2QR5A 4YLEA 4B6GA 4N5IX 1CUGA 2VSFA 3COZA 1EWVA 2RGYA 4L8YA 1BEEA 1Z06A 2BJHA 4WCVA 2Q0ZX 1OX5A 3SYNA 3HM2A 5ALJA 4ECEA 5U4QA 2MOKA 2E8OA 3OPYI 4TOIA 1JIQA 2GCIA 2VYFA 2A5JA 2VZ0A 2EZZA 1YCDA 1AF4A 1T13A 2N1BA 2G4LA 5DX1A 1ZH6A 4EYOA 2H29A 2YFQA 5AESA 4FFMA 1C1DA 2OENG 2QVYX 2A9PA 1DKUA 2I6XA 1GPNA 2Q7DA 4G23A 2Q28A 3F3MA 2C07A 1FDTA 1UKZA 1KZ7B 4HAYA 4KDRA 4NMWA 4F46A 4M8IA 4BNXA 2ZIVB 4NY8A 3O3NB 1WCYA 1NP6A 4R3NA 2QRHA 1BU8A 4BMVA 1XJWA 3H3FA 5J2IA 1TKAA 2YFKA 1P7YA 2COKA 3FVQA 4EA7A 5KJFA 4OSOA 1AM4D 2CVQA 5KJEA 3S55A 4URFA 5K0GA 4CEHB 3JQGB 1E79A 2WQ7A 1F6BA 4GLLA 4M6WA 4REQB 2ONZA 5LUBA 2C8JA 4FDUA 3QZ7A 1J2JA 1VDZA 2JRLA 2FSSA 1ZH2A 3IXLA 5SY4A 4KWIA 2ID9A 2VYNA 3PWZA 2IODA 4NBRA 1WMAA 3PTLA 1PK1A 2VJPA 2FRVA 1ZUNB 5C7IO 1UWVA 1I01A 4F5QA 1NPTO 4UM8B 2QKQA 1TK9A 3UWPA 4KR2A 4C3VA 1TU0A 4AROA 1QP4A 4HDAA 4JSYA 4ID9A 4E5PA 4DA0A 1NJXA 2R8IA 5JEDA 1FFAA 4NMHA 5LXTA 3Q40A 2HO5A 2Y2VA 3RVDA 4C0LA 1TFUA 1EG2A 2P6MA 2NUPA 2W42A 1Z2AA 3WL8A 1WXXA 1OV4A 3B1FA 9ICAA 5FTMA 2O1EA 1KZYC 4L8LA 2DQ4A 3A6JA 2JLAA 2PUVA 3KVVA 3HDTA 4L8GA 1G2OA 2WWRA 2XB2A 4O1HA 3ZCPA 2EX0A 1F9EA 2D2XA 3CKKA 4G5QA 2FQWA 5B3LA 1ACMA 4YDQA 1XA0A 5CH5A 3PC6A 5CRIA 2N47A 2PIDA 5CJ2A 4OF4A 1ONPA 2WHXA 2JHCA 1QYRA 3N59A 5TQVA 1RRVA 3QJYA 4KFSA 3JAWB 1VKZA 2ZATA 1QFYA 2VJQA 4C1NA 4EDFA 2I0FA 3A10A 5ARBA 1TAUA 2G1UA 3DZBA 3EC7A 4O4IA 4DF3A 1K86A 5CFOA 4GRDA 2VRCA 1R6XA 3T3DA 2O2IA 2XMQA 5AMXA 4FZLA 4PPQA 4D97A 4BPBA 1M8FA 1IG6A 4RPJA 2LI6A 3HVIA 1DARA 1TCVA 5DLGA 4HGYA 3PLRA 5IANA 4JUZA 3NDIA 5HA5A 4JIGA 2ZXHA 2KOBA 3M8SA 3DV0A 3TRKA 5JO0A 3ZZ0A 4FEAA 4MQ5A 2VF7A 4QZBA 1QPZA 4ARCA 4R8LA 2RONA 1NJYA 4Y9RA 1P44A 1IU9A 4Y2QA 3ET4A 2IHNA 2QG4A 1E9BA 1M2HA 4DREA 1H2XA 2Z5VA 5D3QA 4NY1A 2QVBA 3A2KA 2TMYA 1NOIA 3O75A 3A1NA 2V7EA 2BQRA 1RQNA 5FL3A 4C0AC 4CGZA 1IEXA 2YQ5A 3UQ0A 3QXHA 3ZUPA 3LBYA 3HB9A 2ZTCA 2VA3A 2WZCA 4YQFA 4MR7B 3HW8A 2I55A 2ZRQA 4U8HA 4RVUA 1W8DA 2C2HA 5JNLA 4YMWA 2LM4A 2Z8ZA 5I9TA 3WGGA 3DXXA 4LJ8A 3ZDAA 1F0PA 3WGTA 2V0NA 2HNKA 3V2GA 3VFDA 1H9BA 2Q7XA 4KH1A 1X1BA 3KEQA 4HY3A 3WMWA 1KXZA 3INGA 5B4VA 1M7HA 4Q19A 3MRTA 521PA 1UBKS 4TT3A 4OJOA 4YREA 2E55A 1T1SA 2ZRGA 1HZJA 4QUIA 1V48A 1OHHD 1T2UA 3AONB 3M6VA 3RV4A 4YMSA 4L22A 1T8RA 1QHXA 3O21A 1ZN9A 2OZLB 4ETMA 4EBDA 5KT2A 5KNCD 5JSHA 4X97A 3CZAA 3NBUA 1P1JA 3FSGA 4JMPA 2H3QA 5BRJA 3GVIA 4AS2A 3AHCA 2QK4A 2HXYA 2DR2A 3NVVA 3MS4A 3E4DA 3QMVA 4ARSA 3I9V1 4UEQA 2E5SA 3TANA 1XT6A 2P62A 3CLVA 3JQ7B 1WY5A 3M6MD 4P92A 1D9DA 2WJJA 3BMNB 4I81A 2JA2A 4B82A 1GSHA 2W6IA 4RMHA 3G17A 1I1NA 1E7YA 3LPLA 3SQXA 2MYUA 3RUDA 2PGNA 4NBKA 3AVPA 1M1NA 4XQ0A 2OC4A 2JASA 1UEIA 4DADA 2R8YA 3HKBB 2R1TA 4ML3A 2WAMA 5DEOA 5KYTA 1T3QA 4MS1B 1W0JA 3CB2A 5JFGA 2IP2A 3UHPA 1ZQMA 4OP2A 3OEYA 4RUCA 3NHWA 5A6SB 3LUHA 4B46A 1AGNA 1ZI8A 3H2HA 3RS7A 4GO1A 1IQRA 1KBUA 1IQ0A 4XSGA 2QB0B 1KAQA 3T7SA 2BW0A 3WNBA 1Q21A 2GASA 3CF4A 1XU4A 1GILA 4FS2A 5I9LA 4P81A 4KPYA 1DIHA 1MPTA 2Y1OA 3ZZNA 2DUJA 1BNOA 3ECCA 5KFYA 2BEJA 2GVZC 1OFIA 5TC4A 1NJ2A 1UUFA 2FRDC 2R86A 3ROEA 3MTBA 1WBDA 1Z12A 4D99A 1N36B 2FPMA 3Q6IA 1RPTA 4U00A 2G72A 3PUYA 5DXAA 3AGPA 1L4YA 3RAEC 2V5UA 1VRWA 3VJKA 2ZUFA 1XQ6A 1CB7A 1CR1A 3I4CA 4I2FA 3OJSA 3ROMA 4F71A 1ZOPA 3NBMA 4X1IB 3E6AA 5L9XA 1NJ5A 1C1HA 1M3SA 3GDXA 5TMEA 1BJKA 3I4LA 3OZUA 3SYMA 2CVOA 3I37X 3T1QA 4ZYVA 4LQDA 1KSHA 1NXWA 4FB4A 2OCLA 2AZXA 1KBOA 1J2RA 5JVDF 2LGJA 1Y5RA 4MHOA 4LOAA 2E0IA 3RSCA 5EJ8A 1L4EA 1RBQA 3CEAA 1T5SA 1OI7A 1JIHA 2KN7A 2ZB4A 5DHQA 5DLYA 4R65A 1JLKA 1UBLS