4FFDA

Crystal structure of engineered protein. northeast structural genomics consortium target or48
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
230
structure length
230
Chain Sequence
MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYGFKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of engineered protein. northeast structural genomics consortium target or48
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords PF00702 DOMAIN PROTEIN
total genus 86
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4ffdA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ffdA01
1XP5A 2FPWA 2P27A 4Y2PA 1Y8AA 4HAIA 4OHFA 2BDEA 5AVRA 3J7TA 2B82A 5A3SA 2G06A 2IYEA 2IA5A 1L6RA 2WHEA 1LTQA 1Z5GA 5AI5A 3AR8A 3AR9A 3U7FB 5AVXA 5AW2A 2FDRA 1QH9A 1MH9A 2QYHA 2FEAA 2G09A 1VJ5A 3DDHA 3QUQA 3ZI4A 1YV9A 1TJ3A 3AR5A 4KX3A 1RMYA 2G08A 3EF0A 4CF3A 5ALIA 5AM4A 3KZXA 3ZTYA 5AKGA 2C88A 1RQNA 5AW5A 5AI0A 4YCNA 3QX7A 1RMQA 1TA0A 2RBKA 3QNMA 5AVZA 1X42A 4Y2UA 4EX6A 3U7GA 4MWOA 3MN1A 3WKEA 4HGQA 4BNDA 5AVVA 2OM6A 5ALYA 3B8EA 3ZTWA 2PQ0A 1EK2A 1QQ5A 3L8GA 4QJBA 1XVIA 1SWWA 1YNSA 3OCZA 4RETA 5ALPA 4EZEA 5AKHA 4DFDA 2FI1A 1RC8A 2I55A 1NRWA 1K1EA 5AI9A 3WK9A 1RKUA 2YFYA 4Y2YA 1SU4A 2CFTA 4MUMA 3L8HA 2G80A 4J2TA 4UW9A 3FGOA 2YMPA 3FZQA 4GXTA 1TE2A 3I6BA 2IOFK 2GHQA 3A3YA 1IWOA 2ZG6A 4KX5A 4BYGA 1RLMA 2ODAA 1T9ZA 2P69A 5AW1A 3N28A 4UMFA 2G0AA 3KBBA 3M9LA 1NF2A 4L6CA 3U13A 2B8JA 4HGNA 3CNHA 2B1QA 3B9BA 3CZ4A 4YH1A 1RMTA 2X4DA 4UU0A 4BX3A 1ZRMA 2GO7A 5AKKA 3GYGA 2R8XA 4PNHA 5A3RA 3L5KA 4FYPA 2CN1A 3UM9A 3FPBA 3L1UA 5AW8A 5AKEA 4UATA 3SMVA 2WF7A 3I76A 2B30A 2WF9A 3ESQA 3L8EA 3QU2A 3PGVA 3IJ5A 3NANA 5AVYA 3OCWA 1NNLA 2YJ3A 3EF1A 1Q92A 1RQLA 4DWOA 3N1UA 2B1RA 4OCZA 2DQSA 5AICA 4Y2QA 1O03A 5ALTA 5AVWA 5ALGA 5ALDA 4QQFA 1ZRNA 2P11A 3WGUA 4UU1A 4KNWA 5ALVA 2ZBDA 1ZD2P 5AIAA 4OFZA 1ZD4A 2HSZA 2G07A 3E8MA 2W43A 1F5SA 1L7MA 4G63A 3B9RA 3A1EA 5ALWA 3M1YA 1ZD3A 3KD3A 2HOQA 1JUDA 1RKQA 4YIHA 1SWVA 4KYTA 1RPZA 1ZD5A 1Z4KA 2FUCA 5ALEA 2YJ4A 2YN4A 2MU2A 3L8FA 5ALQA 2IOFA 2BDUA 3TLMA 2YMQA 2AMYA 5ALSA 1Q91A 2QLTA 3QUTA 5ALMA 3OPXA 3ZVNA 3L0YA 3WKCA 3QU7A 4I9GA 3QXGA 3QUBA 2FUEA 1KYTA 4BBJA 3D6JA 4BX0A 5AI6A 5AHXA 3WK4A 4NWIA 2JAWA 2MSNA 3QUCA 5AVTA 1TJ5A 5AW4A 5ALLA 2ZXEA 1L7NA 4ZEWA 2AGVA 2RARA 1T5TA 2NYVA 5AKLA 3AR4A 4NABA 4C4SA 2IOHA 1N8NA 4AS2A 4HGPA 4H1WA 3A1CA 2ZBGA 4YGYA 5AW3A 3ED5A 4CNQA 3N5KA 3A1DA 4EELA 4GIBA 1Z4JA 2CFRA 2OA0A 2FPUA 4XOUA 3UMGA 2HF2A 5ALZA 5E0OA 2I7DA 4UAUA 2I34A 3FM9A 4Y2XA 4FFDA 4KN8A 3ZWDA 1Z4QA 5AVSA 4ZEXA 3E84A 4XPZA 1S8OA 4B6JA 2OBBA 2HDOA 2WFAA 2VKQA 2B8EA 5AI4A 1N9KA 2AH5A 1RRCA 5AM2A 1FEZA 5AK5A 3WK7A 1L7OA 1WZCA 5ALFA 1QQ6A 2C8KA 1QYIA 3KDPA 1CQZA 5AVQA 3E58A 5AM0A 4NAVA 2HCFA 1Z4PX 1S2OA 2RAVA 4G9BA 5AM3A 3VAYA 2EARA 2WF8A 1Z4IA 3WK5A 3EPRA 4YCLA 2YJ5A 2MU1A 3NAMA 4L57A 5AVUA 2Q4TA 4UMEA 3PCTA 4NFLA 2YJ6A 3L1VA 2C8LA 4BEWA 3W5CA 5ALHA 4UM5A 2O9JA 2HF7A 4O8CA 4Y2SA 3WK8A 2EAUA 1TJ4A 4KNVA 1Z4NA 2WF6A 3W5BA 3SD7A 2HEGA 4XQ0A 3WKAA 4J03A 4HYTA 3U19A 5AM5A 3PDWA 3BWVA 2ZBFA 3WKDA 3ONNA 3OCUA 5AKXA 3QLEA 1RLOA 1ZJJA 4IG4A 1RDFA 2PR7A 2R8ZA 1WVIA 3ESRA 1YDFA 2Q5EA 2JARA 1EK1A 3NASA 2P9JA 4RESA 3ZUPA 3WGVA 1WPGA 3L7YA 5ALRA 3PGLA 3RFUA 2HO4A 3OTQA 2C4NA 2JAUA 3ET4A 1YS9A 4Y2VA 4IFTA 3QU5A 3EWIA 5JJBA 3AR2A 4Y3UA 3NUQA 5ALKA 5AKZA 3R9KA 3IB6A 2BY4A 1YMQA 2FPXA 3QU9A 4HGRA 5FP0A 4UMDA 1ZOLA 3AR7A 1Z88A 1ZS9A 2O2XA 3L0CA 5A3QA 2ZBEA 3AR6A 2B0CA 2YMLA 4UASA 1L8LA 4YCMA 5AW7A 1LVHA 3IRUA 1Z5UA 2D2VA 3QYPA 5AESA 3I1YA 3AR3A 4L6AA 3UMCA 4NV0A 2YY6A 2R8YA 2I33A 1CR6A 3WK6A 5AKIA 3QU4A 3NIWA 3DAOA 3SKXA 5AKYA 3FPSA 1U2SA 2I6XA 3DV9A 1XPJA 3ZWKA 3QGMA 1U7OA 3N07A 3BA6A 3OCXA 5AW9A 3SKYA 3ZVLA 3ZX5A 5IS2A 4HGOA 2HI0A 4OD0A 5AIBA 2NO4A 2ZOSA 5T41A 4ZEVA 2FPRA 4DCCA 3OCYA 2YMMA 3F9RA 5ALUA 1WR8A 3KC2A 5IT4A 3L0BA 4XE5A 4E88A 3KOOA 3MPOA 1L8OA 5ALJA 4CF5A 1YJ5A 1U02A 3K1ZA 2AUTA 3OCVA 3SHQA 3RF6A 3U26A 4BNDB 2I54A 4C4TA 4AP9A 4UAVA 4EX7A 5AW6A 3HLTA 2CFSA 1T5SA 2EATA 5IT0A 4JB3A 3W5AA 4EEKA 3MC1A 3DNPA 3U7EB 2FPSA 2C9MA 1J8DA 3N8GA 2GHTA 3ZW7A 2PKEA 4YIKA 1Z4MA 3W5DA 2NO5A 1Z4OA 1QQ7A 5ALXA 1U7PA 3ZX4A 3ET5A 2G1AA 2RB5A 4UMVA 1O08A 4F72A 1RKVA 5AK4A 1L7PA 4CE6A 1RLTA 5AI8A 2HHLA 5AK3A 4F71A 2W4MA 4I9FA 4Y2TA 5AK6A 3E81A 4BEVA 3NRJA 3R09A 5AW0A 3UMBA 1J97A 5ALOA 1PW5A 4Y2JA 2R8EA 4FE3A 4UM7A 1AQ6A 4Y2RA 1Z4LA 5ALNA 2JGAA 3P96A 4AS3A 3SF0A 1VJRA 4JDPA 3S6JA 2YBDA 4DW8A 1VFPA 2WM8A 3WKBA 4CF4A 1U2TA 2W11A 2Q4RA 2HX1A 3I28A 3HYCA 4BKMA 2OYCA 5AM1A 3R4CA 5AKJA 3NALA 2WF5A 3FVVA 4EENA 2JAOA 3ZVMA 3ZU6A 3MMZA 2GFHA 3SLRA 3U7HB 4UARA 4C4RA 2GMWA 4BX2A
chains in the Genus database with same CATH superfamily
1NN1A 1T3HA 4ZHQB 1KTIA 1T0BA 1P4HA 1NMEA 2FWPA 3PJDA 1H85A 3QFFA 2J08A 5KJ1A 2Z6UA 3KKKA 4P8RA 1UXHA 3U4MA 2BGIA 4IIJB 3QNWA 5LNK6 2A59A 4WFKA 2I76A 5EL0A 3BXOA 3Q3CA 1X8LA 1BVSA 1JIUA 1P2BA 1SAYA 3IAXA 3QV2A 4HJXA 4NLLA 5J40A 3KSRA 3NHYA 2RGDA 3ID6C 5K3EA 3WHPA 3RUIA 1ZN7A 5AOCA 5G0UA 2QTRA 1G0NA 5JE8A 1UFOA 3MRXA 1Z5GA 2NZWA 3RIHA 3RAPR 2F3SA 3BE4A 2OHOA 4Q7KA 4R8UA 2IBSA 3IFSA 4HNAA 3PKJA 1XZKA 2VQFB 1CF2O 1I2DA 3PPIA 2W71A 4OX9B 2GRUA 4F4DA 4IQUA 5KFQA 4QZIA 1XTUA 1JN3A 1Z5VA 4IOJA 1KAMA 2EC5A 3B12A 3AR5A 4FYVA 4P80A 5EFOA 4ZAGA 5BQXA 1Q0TA 2H3VA 3RGWS 4BY9E 5HTKA 2VHYA 2YUIA 1SXJA 5ALIA 4QECA 3KNZA 4FZVA 5KYNA 4QJIA 3DS8A 7ICEA 4HN2A 1NNEA 4JR2A 2KICA 5ILGA 1QGUA 1NQUA 1IJBA 1RMQA 3QNMA 1V3QE 5HMLA 1CBUA 2JVJA 1FNNA 4KZKA 4PYKA 1F6DA 3B3JA 1N61A 4HGQA 4YRAA 2X8BA 1T35A 3NJ4A 1TCCA 1T8PA 2KI5A 9ICBA 2OXFA 4QJBA 1JLMA 1XVIA 5J2DA 3L40A 3AF3A 4RETA 5L3SB 1W36B 3VGPA 3EG9A 4FE7A 1PD0A 3PA6A 4C8OA 2PX5A 2QU8A 4QYXA 2VJBA 4YD1A 1U0NA 1LPNA 1C3OB 3QKSA 5FB3A 1FMFA 2FMUA 4M9CA 1OBFO 2VQ3A 1N3BA 1N2CA 2IPAB 3QVJA 4JKYA 4YJ2F 4KUHA 4DA4A 4CMHA 1BX3A 5JS2A 1G42A 4A6DA 3IT3A 2W0SA 4NBTA 3IEXA 4UW9A 4D1YA 5AD1A 5CB4F 1C0KA 4D0RA 3EPHA 3RAXA 4JHXA 3UT5A 1N7GA 3UXYA 4EFNA 3GEBA 3ZKWA 4Q7QA 4TQSA 1J2UA 5JNWA 5EWLA 1M8PA 4L3VA 1X70A 6REQB 4MHTA 1GKYA 3ZNPA 1CUFA 1S4MA 4HJRA 1VYTA 1TDJA 3H0LB 5JVDA 2XUQA 4A0FA 1EJ0A 1EI9A 1G5FA 1IY2A 3W6PA 4D9EA 2BP7A 5I4BA 1QV6A 1YMVA 1EGQA 1VCHA 1ZLXA 1FU4A 3MIIA 1H8EA 4JBHA 5DYYA 4CM7A 5FWYB 1DC7A 3C1YA 1K6XA 4YP5A 3D3KA 2ZSAA 3F71A 3FUUA 3KHSA 5JO9A 2VPPA 3VNRA 1I1OA 4L6CA 2EJBA 2EJVA 5DJ5A 3V7WA 2H5XA 4D81A 1HT1E 4M86A 4LXYA 1JFTA 4MTCA 4AJPA 4PQGA 2CMDA 4HADA 5HF8A 4UBBA 3CN9A 4D56A 4YQWA 3KLBA 5C4GB 3VKUA 4AKGA 5CNMA 5EC8A 2HHVA 4UEKA 4DOMA 4ZDKA 4IFEA 3JYOA 1FL9A 4BVAA 4DSNA 1TAGA 4BMXA 1YB7A 4HWRA 1R0BA 4C05A 1SZHA 4Y2HA 4GZ3A 3I0ZA 3QY0A 1SXEA 2CN1A 1IATA 3LQ2A 3DE7X 1GSAA 4HQ6A 3B6EA 4PF1A 1JJVA 2JEGA 4DSOA 2QRLA 2H4JA 1E66A 2JD2A 2R5WA 3FTNA 3NBQA 4B43A 2IHTA 5EQTA 2WYWA 2BFEB 2Y93A 2W2KA 3JU3A 4TLCA 4DILA 3RYIB 2ISSD 5AVYA 1PT8A 4RZQA 2EW2A 2CHGA 2VJYA 2X9GA 4FD2A 3R7WA 3ZGOA 4KQWA 5C52B 1RQLA 2CXXA 3ETRA 3MD0A 2VUUA 3ONWA 2JS7A 1KY4A 3DPSA 3TR5A 2AXQA 3E8XA 1YULA 2B1RA 3ZXSA 4FGKA 2E8PA 2OFFA 3RS4A 1K27A 1R9NA 2XV1A 4LIPD 4M7WA 2AD1A 1VQ1A 1A0PA 3V1NA 3S1AA 1FX0B 4F5DA 2VDMB 3EFOB 4JSTA 1ZD1A 5ALGA 1OI2A 2NNLD 5CW1A 4YXWA 4AS1A 2M6KA 5F98A 4KB5A 4O1IA 3MJFA 1MA7A 1V26A 4ND8A 2ZR8A 3I9FA 5E7JA 3VDXA 5J2GA 3FUTA 5DLFA 1BU8A 2JH7A 1G3UA 4RQ7A 2R11A 1VE7A 1J8MF 5JJLA 1XQ6A 3NEAA 4RNMA 1ZQMA 4JVSB 1L4BA 3TBHA 1FNCA 1QM5A 2G71A 2W43A 2GK6A 2VK8A 3O4VA 4P4SB 2X3YA 1KDRA 4AJ1A 1NULA 1QVWA 3AZPA 3HPQA 1S89A 3INYA 4MKHA 4LE1A 4AZVA 1FIUA 1U9IA 5ESWA 1E1DA 4RPJA 4AZ0A 5DP1A 1D9DA 1DUVG 1JUDA 4AJJA 4CR6A 2R5NA 3CBGA 1XE3A 3S2IA 2XQVA 4JHLA 1D0IA 3KHRA 3IEMA 5KFMA 2D06A 2ZRHA 3ZXXA 3TL6A 5ERGB 3RWBA 1MO4A 1QWSA 9ICNA 3KPYA 2AIRA 4KN5A 5JATA 1E2DA 1H5QA 2NTJA 4LSGA 5ALMA 1SCBA 2H8KA 2W2MA 3ZVNA 3UGTA 1KQFA 3DD5A 1D7OA 5K3SA 4RKWA 3URMA 2OHVA 1JMYA 3JPSA 2AMFA 2KX7A 4BB5A 3OQMA 4M8IA 3O2SB 3T7RA 5AHXA 2ECPA 4L4YA 1PLLA 1ZD9A 2PZ8A 4RPCA 5CM8B 3ZY4A 2QW0X 5AW4A 2QVYX 3V6KA 1ZVQA 3LPCA 1Z68A 2Q3JA 2MSWA 4L28A 1Z34A 1LJ8A 1ZMRA 3DKKA 3TOZA 3G7SA 4DCUA 2ODWA 3CCBA 5K8LA 1UMDA 3FOZA 1HEIA 2UZ4A 4AS2A 2E0IA 3LWNA 3T15A 3RC9A 3F6RA 2ZWPA 1I4LD 4FNOA 5EJMA 3MBIA 1UK6A 1NXPA 1BPEA 3IB3A 4EKEA 2HWWA 3F6SA 1B74A 1L9XA 4TZKA 1S97A 4PBRA 5ER6A 3R0JA 4TMXA 5HKAA 1GPLA 1VSUA 4RMNA 2PWZA 1FTNA 2XWBF 4YAUA 3GBPA 9ICLA 2I2WA 4OMFG 1ORIA 5FX2A 5K99A 1OUMA 3TPCA 3X2SA 2VXOA 4B3RB 3TSCA 2P77A 2BZ0A 4OQLA 1U2DA 2Q2OA 5I4IA 4US8A 4K28A 5LA6A 4G81A 2H5LA 2FJPA 2HUPA 4ELUA 4HGZA 4ARZA 3ZHUA 3ILHA 4Z54A 2VKQA 3FLEA 2D1SA 4UBNA 1PKXA 4Q43A 1PN3A 1FFXB 1G9SA 5DCYA 1N2HA 5KG7A 2BCVA 2IZ0A 4NONA 1K98A 3CTPA 4OEHA 2EJWA 5J58A 5JASA 3H0RB 1T2FA 4U6NA 1GZ5A 4LZZA 2IYXA 1Q8KA 3KEOA 4EEXA 1YWGO 4F9FA 1HE8B 4UDYX 4IXWA 1AURA 7ICRA 1PSDA 3RANA 4J3JA 3LK7A 4UDOA 3W9BA 2GN6A 3KK0A 3ONVA 4LW8A 3IDSA 5EOVA 1U9IC 5KFLA 1LX6A 4ICAA 3PX6A 2FNAA 3CEAA 4IHAA 2PKWA 2X40A 5DWQA 4BMPB 5IG2A 5AM3A 1CB7A 3BILA 5A4IS 3CT4A 3G2NA 4QOEA 1XMJA 1S76D 1D4ZA 2EARA 4X3CA 4BKOA 4F4UA 4W7HA 1H4QA 2QZSA 2BUAA 1PDVA 2J0UA 4PZCA 4INAA 1LU9A 3PCXA 2X2OA 2JLYA 3EG5A 3LKZA 5CVJA 2LYAA 3ZHZA 3ROFA 1OAOC 4OGKA 3NGDA 2K4MA 4FZNA 3SM3A 1GGEA 2Q28A 3UFXA 1R4AA 1OUQA 4N3CA 3RHSA 3WYCA 3VYWA 2NO0A 4IQWA 5CH3A 4UTNA 2WF6A 1EFLA 3SD7A 5DLGA 2IZ5A 1QJ4A 2JGKA 3OZCA 4PGYA 8ICVA 3B3GA 3H3JA 3UJPA 5FV4A 1XZEA 1X9IA 4RL4A 3O8QB 3ZLTA 3GZNA 1GTL1 3FOWA 4YLGA 5JCOA 4MV0A 2E2WA 1RJWA 3DUFB 1TC1A 4FEEA 5ADUS 2CSXA 2I4LA 2CYBA 4PNPA 2AW3A 4TSRA 4FZMA 5IIJA 2KG5A 1A0OA 5KAIU 1IHYA 5K0FA 1HF3A 1V6AA 5CYPA 2DR0A 1AMOA 4S04A 3RO7A 4LYJA 2RDMA 3T4PA 1D4OA 2VH2A 3W8EA 2IZZA 1SEVA 1NW6A 1ECFA 4YMNA 2CNOA 1Z62A 3A6KA 2VOJA 5L6LB 4B32A 1VKHA 5K2OA 1TFRA 1CEQA 1XEXA 1P2VA 1CI4A 1ZJ5A 3X1YA 2QZJA 3EYZA 1BVUA 2V3WA 1OZ0A 4H7FA 2HFJA 4DFJA 1B8NA 3ET4A 2WJGA 4JU8A 4KIWA 4LWQA 4RMJA 5KKCA 4BO6A 2B83A 1FFBA 2DKXA 2YOGA 1D2NA 1O96B 5E6RA 5HHHA 2PKCA 3H84A 4KZPA 1W5SA 3EDCA 5J0XA 4YJHA 1E20A 1ZZGA 3NC4A 5B6IA 4JYCA 1Y5NA 4E0DA 1GAEO 3C1ZA 3A6ZA 3BQNB 4EY4A 1UKAA 3SHOA 3NBMA 1ZS9A 4I1OA 3JQBA 3UMJA 5A4AA 4F8JA 2ZRPA 4AIIA 4HAYA 4AG3A 1TEVA 1U2RA 4LY9A 2HBJA 4GG1A 1U5BB 4IJQA 4Z4GA 1MJHA 2QRHA 4NG4A 2OESA 2QZ4A 4GZMA 3EULA 3HBLA 2P9ZA 2WJZB 3EGCA 2BKUA 5H5JA 5LQMA 4FW9A 2C5BA 1AS0A 2R9VA 4M0AA 3KPUA 2AJTA 1I5OA 1I13A 2FE1A 3BGVA 4FHGA 4RV9A 3C1AA 3N7SC 1S2LA 2I62A 2WZCA 3MGHA 1YGYA 3L6DA 3M5DA 5ED4A 1LTHR 1Q1AA 4I08A 4I2CA 1H1LB 1MT3A 1OPRA 3DAOA 2DKZA 5CEHA 3NOXA 4QSMA 2FLVA 2QD3A 5C4IA 1KYQA 3B6MA 2XVAA 3I23A 3LT0A 1Z33A 2JH1A 3B8HA 1MB9A 3C8MA 3NRCA 3T5LA 3OCXA 5DQIA 1C3JA 1ADJA 2PZBA 1ZQBA 1KL7A 3SKYA 4ZDIA 1A2QA 3J80A 2ZIAA 5EKUA 1AKTA 1AHHA 3RYFA 1TB4A 3OMXA 3G8DA 1USVA 5T41A 4IGEA 3LRXA 4G86A 4P3PA 2OC9A 3OJXA 1R3DA 1UKCA 4HFNA 2WSMA 3EGDA 4MIEA 3WGMA 4EA7A 2R8OA 1IM8A 3R7SA 2VYVD 2EF0A 3V3TA 2ZIUB 1R6VA 3G79A 4QHYA 5KPDA 3RDPA 4G2NA 1ZQEA 1C3EA 4EG6A 3FPHA 2DJIA 1ULBA 4LS3A 4KR9A 3KOOA 4CF5A 4JNKA 1X7WA 3AJRA 2VNSA 1CUJA 1PHRA 4FBTA 2ZITA 1IVSA 4EK9A 1WNFA 4LKOA 4UHJA 3PFBA 3T3HA 1SMKA 3IEVA 1Y6RA 3P9IA 4IFBA 2ZZNA 2WJ6A 1K8ZB 2GF9A 5DNWA 5KT3A 2VF2A 4IWYA 3RBDA 2HF8A 3OKPA 5JC8A 3GFKB 2C3PA 4KXFB 1GYQA 5F7ZA 3T6KA 3NWBA 1N6LA 2VPTA 1W2GA 2RC6A 1GNQA 4ZOQI 4E70A 4QATA 4BN0A 5JXIA 1F0NA 1S8NA 5JAHA 2C1EA 1E60A 4YB8A 2JHAA 4O4JF 1XKLA 1DDGA 5FA6A 4DLYA 4XB1A 3R5HA 4DOAA 3RTVA 4L5IA 2FTKE 4DYHA 2NP7A 1JKIA 2FZEA 5EPUA 3O73A 4PIVA 2CVZA 1A4XA 4E22A 4DF8A 1AKQA 4TYPA 2AX4A 5CM9C 4JODA 4CKWB 5CDSA 2P4QA 1ZQRA 2QA5A 3O9MA 221PA 2AKYA 3GLQA 4L8VA 2C5AA 3V7JA 1ZVKA 3L7LA 1AQYA 2ON6A 2QRPA 5K45A 1MRNA 4C89A 4EYKA 1RXSA 5C5EA 2Z3WA 2HA4A 3A3NA 4AO8A 3RYTC 3THYA 3H8WA 2VT2A 1HE1C 1RKXA 2AJ8A 1K7XB 1TEXA 2OBFA 3C1UA 4JI7B 1BX0A 3B1WA 4B6FA 3C6QA 3EGVA 4GLFA 1Y7PA 3PXXA 2XDAA 2GKGA 2Z1MA 3O2JA 4JITA 1XTZA 4I3GA 4YN3A 4BQQA 3A0RB 3T7KA 1GZ3A 3RRHA 1XZBA 2DMRA 3N59A 3GJTA 5CP2A 1GNTA 4KK3A 3AEKB 4NH0A 4PZYA 2Y6UA 3EX7C 1I30A 1FXWF 3IQEA 4XWOA 1XZHA 3UHPA 1Z4LA 4Y1GA 2VBCA 3K0KA 3CEHA 5DG8A 1W30A 4U2EA 3M9MB 4ZVNA 3L3FX 3H1GA 1RSZA 3Q2IA 3ZWVA 1G60A 2R1VB 4ECWA 1BXGB 4GFDA 4PRLA 1G1MA 3CLVA 2JIMA 4UHEA 4QUJA 2Q0ZX 3N8DA 2HRRA 3OX2A 3SCZA 1Y6ZA 3LUHA 2XQIA 1WULS 3ZCQA 3ZE1B 5K1ZA 3SQLA 3PX2A 1J8VA 1KMHA 1VSTA 3BRCA 4LVNA 3TPFA 2B34A 3JQGB 3P2OA 5E1OA 1NG1A 4ZEOA 2ETXA 9ICUA 1KOFA 1TVKB 3DEJA 4IRKA 4KBYA 1KYZA 3M0EA 4UHHA 4EEZA 4C8KA 5TEVA 3HDHA 4YR3A 2PKQP 1NM5C 1S3FA 1WNTA 2NU7B 3QBJA 1PEKE 2ZDHA 3K0CA 1QYXA 3RTAA 3SX4A 3T5PA 1IG3A 2FWBA 4UARA 3P2IA 1NRIA 1G19A 5JU5A 1ONPA 3THXB 4YMWA 5JI3E 3FSGA 4TZ6A 1DG9A 1PR1A 4KQXA 3IOEA 4P7BA 5HIJA 3VBCA 4EBBA 3S99A 1L5GB 2OZLA 2Q9BA 1P39A 5JAPA 2C31A 3EDOA 1MFPA 1Z5PA 3G2LA 3JALA 1VXRA 4G36A 5ITWA 5LL6P 5J0WA 4YNBA 1V97A 1Z7BA 3OFND 1E5TA 1SELA 2ZS8A 3R1IA 2GVDC 3JATB 2PGXA 2MUTB 3VKWA 4TXHA 3F8WA 1ZONA 2AQ4A 1LJLA 3D1LA 1UJ5A 3DDWA 4ZARA 1SHTX 1LPSA 2EFEB 2GKSA 5KFHA 4ZT4A 1T34A 5K3AA 1ZG3A 4P83A 1I8TA 1SOMA 2NSJA 2AC7A 2RK3A 3U9TA 4MDHA 4YD2A 4ZAYA 4PQRA 1RCFA 2IUTA 2BKXA 3BRWA 4EBEA 2XGQA 2Y76A 3EC7A 4N01A 2PZFA 1TQHA 4RTSA 2YFHA 3AERB 4MUXA 3GAZA 3EW9A 3QHQA 1XZNA 5CEEA 3CUWA 4IHQA 7YASA 4Z7OB 1QX3A 1XJCA 4XWGA 1AS3A 1SOUA 2AI2A 3UHFA 1NUSA 5AM4A 1IOZA 2AN1A 3FRJA 2C9OA 3M5CA 2FZLA 2GZMA 3G5TA 5E9JA 3ZN2A 5AKGA 3O0FA 1X80B 2EFDB 3KPVA 4EGCB 4ZICA 5BN1A 3C15C 4KR7A 5FFMA 2DERA 3QX7A 2LXNA 3DVSX 1GZUA 4Y1FA 4EGSA 2ZUFA 1X42A 2W55A 4KMSA 3SAGA 5J5CA 3Q3HA 2KJ9A 2C2ZA 1Y7TA 5K20A 2O23A 3N7PD 4DPMA 1WXFA 1H2ZA 1HYHA 4D5GA 3HO8A 5L95A 3SV3A 2F8SA 2OM6A 4B6SA 5EJ8A 2PQ0A 4RPKA 3TRFA 1LQUA 3S68A 4OBXA 3DBVO 2H7CA 2Z58A 1WEKA 1ZCBA 3PBKA 4BLQA 3AVWA 4PL2A 1P1BA 2KW5A 3A9UA 1M7GA 2QF7A 4LDPA 4NMHA 2CKDA 4MWBA 3T0FA 4LZGA 2XGJA 2OKCA 1R5NA 4KV9A 4Q66C 4D3XA 3K1RB 3KKEA 2UVRA 2QL6A 3T3PB 4TURA 4IIYA 2RQ5A 3V7FA 1O97D 4B7AA 1TECE 1XEFA 2C2KA 1VL8A 2Y9PB 4RVCA 2YMPA 5TPZA 2F67A 3G17A 4I4TF 3D2NA 3BB1A 4RMHA 2YWEA 3K0HA 1Z0UA 3GLUA 3PRJA 4NZYA 4WHMA 3TLYA 3I6BA 4CI9A 2GHQA 3JATA 3QPUA 1K5HA 1COZA 2XADA 4BDSA 3CLRD 3HFGA 1FTGA 4JT9A 3RYFB 1M1YE 1N5KA 1X8XA 1TC2A 4TUPA 1UF9A 4QO7A 1II0A 1KGSA 3THWA 1YXMA 3EPIA 2PUTA 1N2OA 2ZTSA 3HXPA 5ADVA 2BYTA 2Z8YM 4WZBB 5EG5A 3WRXC 1REQA 4REMA 3CNNA 3KU4A 5BQ3A 1RYHA 3KAPA 4CRXA 2QRJA 3RUCA 3B9BA 4YMGA 1KH3A 2R4UA 2KHQA 2ZWVA 4J3NA 4C0HA 2QN3A 1GGFA 1X9HA 1XZIA 3FFXA 2DPIA 4DLWA 3M4JA 1DG3A 1E1KA 2FSVA 1TNDA 2VT6A 2Y92A 2ZROA 3PNCA 1Z18A 4EMUA 5J2KA 4N5NA 3THWB 2BHSA 2GO7A 1RYNA 2VS1A 4I1VA 2QVLA 4PZ9A 1RTTA 2ROQA 3MMPA 1BQ3A 4M2YA 1COWA 3DE5X 2X5OA 4ND2A 4TKUB 1HRKA 4CQMA 1U2DC 5HZGA 1JKMA 2Z98A 3RS7A 4A5SA 5JSUA 5AW8A 3HBFA 5KEIA 5I7HA 3DFMA 4H1TA 4C0SA 3ESQA 2FMQA 1U7UA 1X8JA 2ODTX 1DK2A 1JHAA 5CB4B 1UFVA 3OIYA 1EX9A 3NJRA 5DTRA 2P5YA 1GN8A 1MGPA 3OCWA 4BMOB 2BV3A 2WWFA 4JLVA 2WI8A 1Z13A 2HSDA 4OJNA 1XCGB 4R8VA 4DG8A 5KYXA 4YP6A 2ISCA 2VL7A 3P2MA 4C43A 4JUBA 3ISCA 3K9HA 2FEMA 1JIHA 1JYEA 4YR9A 1PNTA 1Z12A 4BVBA 1Q17A 1W85A 1A4RA 5CLQA 5K8VA 3OVMA 5CP8A 1OU0A 2RHTA 1EH5A 1FXSA 1U6KA 1Y34E 1Y8RA 3TD6A 2EERA 1UC4B 2JVIA 4KQ6A 1H6AA 4URVR 4XZ3A 3ZDZB 1P6QA 4I6GA 1J2MA 5EMKA 1I2AA 4RPGA 1TQ2A 3D7RA 3CNLA 3G0IA 3EIEA 1FLDA 3L7IA 3ZCVA 2P6UA 3WO0A 2NXJA 1Z25A 4TSFA 1EZ4A 1CS0B 2ZIXB 1G2PA 1E9VA 3LVWA 1JWBB 2RCYA 2WE7A 5IJXA 3UJHA 1YR1A 3LKVA 3O82A 1OR8A 4J9SA 5HK8A 1BO6A 5EUBA 4E5YA 1JN0A 4BNLA 3H2BA 3RTEA 2G28A 2HV8A 3V6JA 1CZKA 1K89A 4GE0A 4TZTA 5EKTA 1KY3A 2LW7A 4L9SA 3KD3A 1MQAA 1E0JA 4KE7A 2GPYA 1QGOA 1VM6A 2GN9A 2P2ZA 1ABFA 3IALA 5CAEB 4EIWA 1E9BA 1Y3IA 3FB1A 4FYJA 1T8SA 4V02A 3C29A 1KBUA 1FE8A 2JIRA 1GT6A 3E22B 4REOA 4DA9A 4JKOA 3AEUB 4Z6CA 5KMGA 2ZUVA 3N0XA 3Q3JB 4O3MA 3FN4A 3OQBA 1QRDA 2C3UA 1VECA 4JZKA 5SY4A 5MN5A 1JYSA 4E30A 1E2HA 5I4KA 3VSAA 5KC8A 3O93A 2KTQA 4KPYA 3GV5B 4OQDA 3ZGZA 1QB8A 2GJ9A 2IBKA 5K6AA 3K9CA 5L4NA 2O2YA 1Z16A 2FV8A 2F8LA 2V9PA 2I3AA 4BX0A 1Z6ZA 1BEUB 4LYAA 3X44A 5A1JA 1KJWA 1KOJA 3I53A 4Z9FA 4PPGA 4XKJA 3ICCA 2H3HA 4F1KA 3H5LA 1S3GA 3IGFA 5ECYA 2LHTA 1ZCZA 1EWKA 2ZWMA 5F33A 3V48A 1G7TA 1SBTA 2JKZA 3C0KA 1L3CA 1RAGA 5AVJA 2A19A 1E9CA 3LFTA 4ZJZA 1P45A 2AR7A 3BWXA 4FJ1A 1I7PA 4UD2A 3T1VA 2ZJ6A 1VJCA 5BQOA 3UWMA 4UTVA 3V9AA 1MPXA 1H8HD 2CXOA 3ABSB 2Y1XA 4ZRDA 1WMFA 1T0IA 1QOZA 3DOHA 3EA5A 2LPEA 1U7HA 4NK5A 4DA7A 2IBTA 4YUYA 3OEYA 3KEFA 4DE5A 4BVLA 3OQIB 3NIGB 2KOBA 1ZQDA 3K6SB 2OA0A 2CFRA 4HWTA 1QH1B 5EJEA 3UMGA 1YJCA 2AUNA 2JW5A 2XUOA 2FW9A 1CIJA 3QVTA 4G23A 4QTTB 4X3PA 3WLEA 1IMOA 5JXHA 3M8SA 1H3FA 3AF1A 1HYQA 3CYFA 1MJNA 3RT1A 4PHCA 1TVEA 5GJWC 4JUFA 4ZEXA 1TW2A 4O2BB 1ZJZA 2FW7A 2VDPB 4WZBA 3TAQA 2WK1A 3NIDB 1ND6A 3TQHA 5IXJA 3F2BA 1P74A 1NPYA 3EK2A 3O95A 4EO7A 2B8EA 2PJDA 2F4VB 3CH7A 1VMIA 1UPHA 5AI4A 2FLNA 1QHXA 1W29A 2P5UA 4JV2A 3ORYA 1H5NA 3E9RA 3ZWAA 2A7XA 2PQ6A 3MMNA 4FC7A 4H3VA 2LD4A 5EHIA 5FI3A 2UYYA 3EEYA 1PJ4A 2KSOB 3AL2A 4ZT6A 4HUTA 4CEIA 2E1EA 3N2GA 4H9GA 3TBFA 4UNSA 2LBOA 1JHVA 2AVDA 5D84A 1QFXA 1N5OX 2D62A 3AU8A 1GFSA 1OWLA 3WLOA 5B1YA 3I6QA 1BVHA 3JYLA 5LP6B 2V4ZA 1YL6A 3ULKA 4CR8A 1KIFA 4DLSA 1BMFD 1G5HA 1MQ8B 4XWAA 3EXHA 4KO2S 3WNCA 1S2OA 4JP5A 4PR3A 5J5AA 2MINB 3A4TA 2HJVA 3T9EA 1JQEA 1TK8A 2FUKA 3D4OA 3RVSA 4CF7A 2QBYB 4ROTA 2WD8A 4TWAA 1L3BA 1PW7A 2GNOA 3SVZA 1AGRA 2W8KA 3KT6A 3NRZA 5BUQA 4UHKA 5TRTA 3AOGA 3OFKA 2R66A 2Q0QA 3B3QA 4Y6OA 5TGDA 1NXWA 1W0JA 2EL9A 3PCTA 3PGMA 1LLFA 2D2FA 3E53A 1GRNA 1JWAB 1V4BA 2N1RA 4UM5A 3BZCA 1VPEA 3D7SA 4URYR 1MRZA 3V4RA 2WU3A 1T5IA 2FOXA 4E09A 3UAVA 1ARZA 3SC6A 3LF2A 4QDKA 2P4SA 1ZQNA 3D7KA 5JYBA 4OBEA 1TA9A 2XODA 3KJIA 4MQEA 4WY8A 4C78A 4XEUA 2ZUSA 1V43A 4NJEB 2X1LA 4HYTA 4MI1A 4TMVA 4CL0A 3TSZA 2ZUEA 1MHPA 2YX8A 1SKYB 4AMUA 1PEYA 1GCIA 1RLOA 1T2UA 2KB0A 5E9QA 1YDWA 1WB4A 2ZYWX 3L4SO 2HBLA 4DS4A 2CW5A 1N2XA 1OLSB 2ACVA 3CJQA 3DTVB 4FZ5A 4R0VA 1EYZA 3RTDA 3T5MA 1AQJA 4WZZA 2DVMA 3E9CA 2VAPA 3GG9A 1YUNA 4YAKA 2EX4A 2E6UX 4RADA 5BW4A 2PR2A 2FK8A 5F7OA 5K8CA 2FHPA 1ZQSA 4FU0A 3ROXA 4DRZA 3K0EA 4LGYA 5DI9A 3CINA 4DV1B 3Q8KA 3ZV4A 5E1DA 2GVNA 4QZEA 1HRDA 3NNSA 4BVJA 4ARCA 4IM7A 4PLWA 3ONEA 2YKGA 1F44A 2E4WA 2X7XA 4OGFA 1AMUA 1MDBA 1GUDA 3B6ZA 3ROMA 4LXUA 3OKAA 4BS9A 2BZFA 1BFDA 1N6HA 2NTVA 4ZCSA 4GQAA 2H9IA 2XNKA 4G26A 3H2ZA 3VR5A 2AZMA 4Y3UA 4X54A 2A9VA 5KFRA 2IH4A 4DL9A 4J9VA 3VMMA 1GU1A 1GR1A 3THXA 1ZGBA 1L5FA 2BY4A 6ADHA 2ZAYA 1U8FO 1APBA 2VDUE 1EWRA 1COOA 3GQCA 2BHLA 3E3LA 1Z19A 4H7PA 2PUFA 4C2BA 3LK9A 3M1LA 1CR2A 1HR0B 1AZTA 3L92A 4EKDA 5DB4A 3WWCA 5HFNA 2VJ4A 3FKQA 3FYCA 4UC0A 3MFYA 2OSVA 3PGA1 5I7RA 4Y6PA 4QWDA 2HWXA 3BWCA 1BN7A 3DV2A 3GUVA 5EP3A 1QC5B 1Z5UA 5T8KC 2AOUB 3JQGA 1L5VA 3Q5EA 2B3DA 3RS5A 2F3TA 1I7QB 4YEDA 1LXCA 1YS2X 4R1UA 3RYHA 5JO0A 3E5MA 1N2JA 3U16A 1PBNA 3IUPA 1JLSA 4FQ8A 4TPKA 4IHKA 1SL0A 2A3VA 4K5QA 1QHNA 3P9SA 3OF5A 2OOSA 3QU4A 1P4SA 2YBEA 1A2KC 3B6JA 3QUSA 3FOFC 4D8WA 2AMJA 3VPGA 3A8TA 5LKRA 1UJMA 1K6EA 5BYBA 1EDBA 1MEOA 4ESEA 3FZNA 4UXHA 2CD9A 1FJGB 2I22A 2E55A 4QDUA 3DA8A 3ZWPA 4Q15A 1R6DA 2BMWA 1OLXB 2ZYRA 1AN9A 2Z56A 3MNFA 3OTHA 1RHQA 2M1ZA 1WD5A 1U48A 1J49A 1Y1SA 2FPPA 5FPHA 3VH1A 2PGLA 2H3FA 3KWMA 1NTRA 4MUFA 4RQ6A 1NJZA 3D2AA 3T0IA 3TEFA 4CCWA 1J7KA 1MA3A 3BTOA 1HTWA 5BYKA 3HNRA 2QT9A 5C8YF 1KEJA 1FXUA 5TY0A 2QVXX 1D2AA 3PX7A 1NKCA 1IQUA 2CXTA 4R81A 1IZ0A 2O0KA 3QFRA 1F12A 3RF9A 4ZVUA 3ANNA 1Y4UA 1IN5A 3HJHA 4UQOA 3MWEB 2C1ZA 3KQPA 3TE7A 4B8WA 5EJIA 3MWDA 4DC9A 2ZK7A 2ATVA 2BFBA 2AJQA 4D6XA 4FZLA 2QGFA 5FV7A 5IAJA 2FFBA 4QZHA 3OCVA 2GAIA 3S3TA 3EDMA 4N54A 5HQTA 1DWPA 2UYQA 3OPQA 3AUJB 3WMXA 1KBQA 1WQ3A 4UAWA 3Q8MA 1PG2A 4ECQA 1XRJA 4LNHA 1PR5A 3AHJA 4IWNA 5B7PA 1MO5A 5FNZA 1TLLA 3AU9A 1Z6XA 1A2BA 4C7XA 4F4IA 1ZQWA 2YOFA 4DV0B 3LX4A 1AKYA 3CRRA 4E94A 4F38A 3WQSB 4JASB 3KVYA 2FPIA 5CX1A 4XASA 3GZJA 2JGJA 4Y9UA 4UOZA 3N8GA 2OXOA 1NK5A 3AT1A 1IK6A 3AVPA 4HBGA 1N62A 2Z57A 2GXSA 4D97A 1JIJA 2W3SA 4EGFA 1SURA 2RHHA 1SCDA 4R1PA 1X3SA 1EFCA 3BHIA 1SXJB 5IYZF 4E5KA 4NNPA 4KLGA 2ODBA 1RNLA 3REOA 1FSZA 4IVQA 3TNJA 2GZSA 1FRFS 3CPHA 4EFDA 1C30B 1NQVA 4BRZA 1K5OA 1SU7A 5KVCA 4RXUA 3OZBA 4WCFB 3DG9A 5T8KA 2O19A 2AVNA 2I8CA 4YCCA 4I55A 1FNDA 4FQ7A 2ZTUA 4HRAA 4FS8A 3WIEA 2OD9A 4BP9A 1QV9A 2Y1JA 4IJVA 3RJEA 2HMVA 4FFPA 3UAXA 4B9AA 4JK3A 3CVYA 2ORWA 2V5UA 1JNXX 2Y8EA 3AP2A 3QJGA 3GP8A 3UMBA 3HJRA 3RVNA 1ID1A 1U2EA 4QLOA 1KZ6A 2VDNB 3DC7A 4XGIA 1XL0A 2J4DA 1Y5LA 2O50A 3FC4A 2R8EA 3KRTA 3QOYA 5FBWB 3QW2A 3TYXA 2WKSA 2BFCB 2G17A 4DSZA 2BR0A 1S2DA 3IPRA 5DBOA 7ICGA 3OA2A 1CY4A 5IDYA 4CT0A 4LSZA 2Q3FA 5L1LA 1H69A 4QIWC 5JTIA 3AUTA 3PFHA 4ZYVA 3GPLA 5DWDA 4KLCA 1O94C 4MWTA 1XSLA 2ZAMA 4K9RA 1G38A 2X19A 4IKOA 1EZZA 1SZPA 3NYQA 4ER3A 1E4VA 1MVLA 2O2HA 4WDQA 3G13A 4WV3A 3OLWA 1YR2A 2R8RA 3G1TA 3H1AA 3AV3A 4URZR 5EWJB 2BVNA 3LW7A 1WAMA 3BJYA 1BMTA 1HDEA 1H4SA 4Y1RA 4DF4A 2VK4A 4V03A 3OUUA 4Q9HA 5DSZA 5TGTA 5FYQA 1OSNA 2O3SA 1PWHA 2OC4A 3RH5A 2HF9A 3HGQA 2PJRA 3AUKA 4MI6A 2PL3A 4OA8A 3O92A 3JD3A 4LK2A 3PJRA 2A35A 1EQAA 1JMKC 4IS2A 2WYHA 4K9NA 3K0FB 4F5RA 2BFPA 2JAOA 3DGEC 2QR2A 1ZQ9A 3Q7SA 1PCXA 2CDNA 4JC8A 4U9UA 2I4RA 5EHQA 1ITZA 3W7BA 2IYNA 1DXSA 2QLFA 4N5DA 3BMCA 4B6EA 4CRWB 3ROQA 5KX5B 2GMWA 3ZD7A 4BX2A 1CC1S 3DEIA 5CB8A 1OLUA 1KI8A 4O4HB 2AZTA 4KXNA 2O6KA 1M66A 1P7YA 1AKEA 1V4VA 5PNTA 5FWYA 2Q6LA 3UXOA 2AGPA 1Z37A 3TLAA 2I3GA 3NOVA 3Q9UA 3CUVA 2ESRA 5FUQA 1YB4A 4JJ4A 1Q1EA 2IDMA 2XZPA 4B3DA 3AUOA 3IAUA 1PZMA 3K73O 5JMWA 2WHEA 5D5PA 2D5LA 3FGNA 4HSEA 4C8NA 4ALNA 5J4VA 5HXAA 3RC1A 1H23A 3UFBA 2Z30A 5AVXA 2CMHA 1NU6A 2AUMA 3HY6A 3DHVA 3DAPA 4HQKA 1TYZA 2H08A 2ZT5A 4W8HA 4DR1B 2G09A 4JLKA 3TKYA 1QDLB 1VJ5A 3EXIA 4IYJA 3S28A 2A6PA 5DULA 2Y1KA 1DTWB 2HLPA 3T4EA 4DJDC 1S10A 1PK9A 4GDFA 3CEJA 2W58A 2LGJA 1E2FA 4BLRA 2O2SA 3BSSA 3LBFA 5ILQA 4B0PA 3DKPA 4CI0B 4EUHA 4MZXA 3G1UA 4RVSA 3MJCA 3WBJA 2BE9A 4GHWA 4M0DA 3GFSA 4XR4A 3IQHX 3ZLUA 1ESMA 4G8BA 4F6LA 2F8MA 4MV4A 2B9EA 1L4YA 3ANLA 4P3YA 1ML3A 3IIJA 4NCNA 5AVVA 1I01A 5JHHB 1PJ3A 1T91A 5FO1A 2QPTA 2G67A 4JVOA 5ICGA 2CLDX 4DNXA 2QP9X 3VDRA 4HL6A 4HAZA 5ALPA 2I9PA 3FDJA 2P6MA 3GNQA 4M9ZA 3DWEX 3LSYA 1OV6A 1YL7A 3DAFA 2PFPA 2DPJA 4OSEA 5EKSA 3R7LA 2GCGA 2W4IA 4YONB 2YWDA 1K92A 4GECA 2IWRA 3D7NA 1T3GA 5GADl 1V45E 2MMCA 3OM9A 5DDIP 2H63A 2HMSA 3IP1A 3RC2A 5HBGA 3R77A 1DKMA 4F4YA 4MCIA 3CZ5A 4UOEA 3C5FA 1BFKA 2X0KA 1SIUA 4AURA 4ZAXA 1X2IA 4DIUA 4JI1B 6CHYA 1GPUA 1I9CA 4PLYA 3HJFA 1KO7A 5A0TA 1NE7A 4RY8A 2JZCA 1URJA 4DL5A 1I3LA 4JT2A 3X3HA 2YHAA 4MAAA 3TOSA 5LZ9A 1XI2A 1PF7E 2ZG6A 1XJWA 2W2OA 5DDYA 3KHTA 3N2NA 4Y8VA 3VR2A 2JCBA 3SDSA 3PEWA 4QJ4A 5EQJB 2CDBA 5JNLA 4LF7B 1RI1A 1S0UA 1GFIA 1SA0B 2Y1CA 4NEQA 3GPCA 3MJVA 1D5CA 5TQ2B 1C1DA 1R5OA 3NHUA 4OXKA 3BS7A 1G3RA 4AY2A 1GXSB 3I83A 3LX6A 2AJBA 5G40A 3TPZA 4ARZB 2GN2A 4Q1CA 4P3KA 2G0AA 4MUNA 4K6GA 4TMKA 1UT8A 2W2VA 1KRPA 3HNOA 4QW9A 1TZ2A 4HGYA 1GLVA 4QIHA 2DHDA 3DTNA 3G49A 3GVHA 5COBA 4I7EA 1WW3A 2OFWA 2W6JD 3AUUA 2VF7A 3H99A 4AJLA 2Q4DA 4PRKA 4CG3A 1SCUA 2GILA 4QZBA 2HM7A 3W6OA 1X1BA 3FOEC 2CLIB 1JA1A 1NYLA 2ERYA 3TJMA 5GVRA 1K4YA 3L5KA 1GPH1 1M74A 2QVCA 3AVOA 3KR0A 1SHKA 4LJXA 3OZXA 1WRBA 4TYYA 2AOVA 2Q0XA 3R3HA 5IVPA 3E0FA 3PITA 2D5BA 3SMVA 4X1IA 3AQFA 1XRQA 3BBLA 4HLUA 4AZSA 2H8GA 2QD1A 1MX1A 3BH0A 3QU2A 2BPOA 1RJDA 3HVJA 1LPBB 3LVRE 3PUZA 4GOLD 5LXTF 2AR9A 3C5CA 4GSKA 3T1NA 5K05A 1SHUX 3HT3A 2I7CA 5BMVF 2R65A 3AI7A 3LZCA 3RAFC 4I1RA 4EQZA 3MG9A 4KITB 1ZK1A 1RAAA 5DBHX 1AY0A 4D4KA 5IJZA 4XDYA 4DDMA 1U11A 4LWZA 4A1OA 5JCOC 3VFDA 3HI4A 1M8KA 4G9EA 1UPFA 1WLYA 1B1CA 1XLVA 4PR0A 1MKYA 421PA 1O03A 1BX1A 1Y63A 3I12A 2HB6A 4IJ6A 1NSFA 4OQQA 3L7JA 4KR0A 5BV7A 1Z3CA 4AW9A 1ANKA 4N6NA 3RT7A 3BWMA 2FLKA 2J3KA 1OLSA 3B20A 3PICA 4ID9A 3ZBUA 2GARA 4C0WA 1QFYA 5IKPA 1U2GA 4HB2A 2FXVA 3DJFA 4JEMA 3K1TA 1S0VA 4LRWA 1EAMA 4LRQA 1IAVA 3FLAA 2OCAA 2LIPA 3GOHA 2D3DA 2BPFA 3RARA 5JOQA 2F64A 2Z5FA 2G8NA 2V0GA 1RRKA 2DT5A 2OV4A 4G63A 3E7PA 4UAZA 5KOYA 3GPBA 1NJ8A 1HFKA 4DFMA 1MZVA 4P58A 3KCQA 2IW3A 4JAVC 1C9YA 1P1RA 2DPMA 2QSYA 3F6CA 3IQGX 1WYGA 3IIMA 4NYMR 3ST7A 4E12A 2JD1A 1GAXA 2JRLA 2QTGA 5KREA 3IE2A 5J0PA 1OGIA 2XMSA 4PYNA 4FSDA 4C21A 5G0TA 1UMBA 2PEZA 3Q41A 3TRJA 3Q9LA 1ZQVA 1V3VA 1E4YA 4P3OA 4FZ3A 3JVVA 4MQ4A 2JI9A 2MU2A 1C20A 4LEIA 3ETLA 5JFTA 3N4MB 4G09A 4KXYA 3G23A 5BRJA 4AY6A 2QBYA 1B15A 3K5HA 1QOPB 5KSYA 4CEHA 4M60A 4TV8F 4F4WA 3NEYA 5IZCC 1Q15A 1EFRA 1GNSA 4IXTA 3KFLA 1S7GA 5JCPA 2IYFA 2M9NA 3N2ZB 1OWPA 2VTVA 3KS9A 5M34A 4Y9SA 1K06A 5E79U 3AW8A 1LSOA 5JROA 1WM1A 3H11A 5I9LA 1U63A 5DX1A 1FFAA 5KG5A 3D2QA 1T5TA 2VYNA 4NABA 3OPMA 4OQMA 1BHQ1 1UBHS 2QJFA 4GMXA 4J1QA 3VTAA 2QN9A 3TD9A 3JZIA 4GPBA 2O8BA 2ZSHA 1JAYA 5C1DA 1JAXA 3MYRA 4HNUA 1P9NA 2BTQB 4GXJA 2EX1A 3G2OA 2Q3CA 1MIOA 1ULAA 2E18A 2WHYA 5I7SA 3RB4A 3KOUA 4GW3A 4WW0A 4D8VA 7ICQA 4UTOA 2QI9F 4HOYA 1H6CA 4IRDA 4TWJA 2UXCB 1AF7A 4F96A 3DE1X 4EW6A 5L7YA 1XTBA 1Z4JA 2JLAA 4V0KA 1FB5A 4KLEA 1U99A 2P75A 3GIDA 5HRAA 1QIHA 2EEPA 3CM0A 3KZKA 1CUHA 4UAUA 1Q12A 1RQ7A 2HVIA 2Z8YA 1S2MA 3O0DA 4L02A 2IY7A 4HYKA 3B52X 4LGMA 2VDOB 3G2IA 3LTNC 3PSHA 4A2PA 3HCWA 1AKWA 2QMOA 4IJKA 4R2KA 1S8OA 4B6RA 5FL7D 3BBPA 1XVUA 121PA 3AHCA 3PDIA 1UKVY 1E32A 4R2MA 5GOZA 3C3BA 4HP8A 3KB2A 1L5WA 2QNBA 1OLXA 1IXZA 2XF2A 3ORHA 3JWHA 3Q3VA 4RQAA 4BNNA 5LLTA 4O5CA 1SHZA 3AEQB 1XGKA 3FLMA 1Y9DA 4LRSB 7ICSA 2OB1A 4QM7A 3CH5A 3DEFA 3NLLA 4JVNA 2WINI 1UQVA 4INZA 3L6UA 4JBXA 2XOKA 1ILEA 3SZ3A 4AYBC 3WIOA 4G6ZA 4S05A 1HE2A 4KW7A 3UXHA 1BKDR 3TFSA 1MR3F 2VF5X 4ZYLA 2QN1A 2Y1FA 2NPIA 1AKVA 1NKSA 2IFTA 2VEOA 3PE6A 3ELYA 2R47A 3A9WA 2HA3A 1G8YA 3R0XA 3S7TA 1E58A 4XRGA 3G0CA 4B47A 4E5VA 3P0HA 4R1MA 3UHAA 3NFRA 4LOAA 3CNEA 4KLMA 4RPYA 1CIPA 3Q8SB 3ONFA 3AEUA 3ZKAA 4Q8FA 2I80A 5IIOA 2QQFA 4NFLA 4X24A 2VI5A 4DQQA 2ZB3A 1BVRA 1KR5A 1LF5A 2JIBA 3QX9A 3AI3A 3O9ZA 4QREA 2QT0A 4P2BA 4JL8A 2EZYA 2WDZA 2XDYA 5E6UA 3UPQA 2H5JA 2Q3MA 1E3IA 5L40A 1SZCA 2HWYA 3DCIA 3GA5A 3GVXA 4P22A 2JLVA 2ZT8A 3DHYA 4TRJA 3GW8A 3ZCXA 3OZTA 2A1UA 1A9XB 5B3KA 1DKRA 2QPAA 5DLEA 2YVQA 4M0KA 3U3MA 5HW0A 5L8VA 1XP8A 3DB1A 2YZGA 4TUYF 2MR5A 3WOHA 3ZZNA 2OE2A 2L82A 1JB1A 4QX6A 5AKXA 3MA0A 3RCBA 1OD6A 2Q2WA 5JQGF 5GV8A 2A92A 2G1PA 1KHTA 4EW1A 2NLOA 1WVIA 3ELUA 3EVGA 3L93A 5CDFA 3VR2D 4MPDA 1USUA 4PNZA 1FRNA 5JLAA 3WJAA 4RIFA 5IDQA 2CVOA 3AN1A 1JDBC 3JQPA 1FLVA 2OK7A 3SSOA 3OJUA 1ISPA 2I3BA 1NPDA 1OC4A 4OOFA 4RESA 1Y98A 1VL5A 1XWFA 2BIFA 2V96A 3IYLW 5ERXA 3VHXB 5EXPA 3TGPA 4CCSA 5ALRA 4R3NA 5LMCA 3QELA 4GKJB 4KPEC 2DUUA 4M1EA 4IP0A 1AQLA 4MW0A 1U7XA 4JYMA 2EBUA 3VI3B 4FS3A 2BT4A 2BWJA 4MLZA 2GZDA 1RYEA 1X38A 2QJOA 5IC4A 1JTEA 2ZYDA 1KBZA 5CX1B 1UFQA 4U7CA 5TMPA 2IHNA 1OXKB 1MO2A 1B93A 3H3XA 3PVSA 2BR3A 5D87A 1NM5A 4OHZA 3TE6A 1YMQA 3F5MA 2ZIWB 4GKAA 3TSOA 3UVEA 2A88A 1ZHFA 1EFAA 1UJBA 3K53A 3AR7A 3MBKA 2PRJA 4MAFA 4P2GA 3SSNA 1AJEA 4DQPA 2JDIA 2YIDA 5J2FA 1C7ZA 1RYDA 4FVTA 4HH3C 5TC4A 4F6CA 3E2IA 3T9BA 1HOTA 3DXXA 4BP1A 3L8MA 1MN6A 3R8CA 3E0QA 1ZL2A 4AJKA 1FP4B 3GF4A 3TAUA 4E51A 5IAKA 4Q82A 4J0EA 3ZE8A 1OU4A 1O94A 3UMCA 3NFYA 4FDTA 4F4HA 2OCYC 4OSPA 2F90A 1Z2CA 2QXTA 4DN6A 2OCBA 4L0MA 4IHJA 3LUGA 4DA0A 1H2RS 1FTSA 1HURA 2QL5A 3CZMA 3DMNA 4WKOA 5T5QA 1P62B 4FW8A 1X3LA 1U9CA 2PXXA 4HWSA 3N2KB 1QHHA 3JYQA 4L6IA 1UCVA 1B3BA 4I50B 1QS0A 3VZRA 2VQEB 4X0EA 3QXSA 2I6TA 4D8UA 2E5FA 2XXJA 4QXRA 4MJ3A 4EYEA 2KSOA 3ABRB 1VLLA 3BDAA 4YP7A 3BKXA 4RQ2A 3BA6A 3G8BA 2P1RA 3N07A 3USZA 2A9RA 4F56A 4EG7A 1VP3A 4KFUA 1J8QA 2DSNA 3BMXA 3GLSA 1MHTA 2MRLA 1JPVA 1MRSA 5H70A 5GZ3A 2AXEA 2XYPA 4O2AA 2JFFA 2ZQZA 1YBVA 1N5DA 1Y33E 2XEXA 1RYMA 3EB9A 3JYPA 3OLZA 1MP0A 4H7KA 4K3VA 4XI9A 5FI0B 5GZ6A 5ILOA 3CW8X 2GEDA 4J1TC 3DSRA 1OE0A 4QA9A 5L3ZA 4AI6A 2C8VA 4O9MA 1RWWA 3KTFA 1V6CA 1MC5A 1CY8A 1UC5B 2QAGA 1NVXQ 1KO8A 1GDHA 1NXQA 3HKEA 2P67A 4MS4B 1XV5A 3K8OE 3ZH9B 4E2FA 3T3GA 2J3DA 2ZUCA 3RAEC 3MGGA 2QQ5A 1ISIA 4E88A 3AM1A 1RLJA 3FYDA 3FF4A 4Y67A 2O7VA 5F52A 1C4OA 1F6BA 3QP9A 4WCFC 5DGXA 2CHQA 4QWWA 5CYOA 1ZQ1A 4JLBA 2OQIA 3I39X 3OE5A 4EITA 3ZI7A 2HQBA 1EWVA 1TA4A 2X7JA 4M89A 3HUEA 3NH9A 1DNPA 1M1XB 2ZUTA 4AZTA 9ICSA 4QW8A 2FG5A 2ZJ0A 3HUFA 2FG7C 2VJLA 4RHFA 4R2JA 2PGAA 4EEKA 2ZUWA 4K6KA 3ZHCA 3OQJA 4BZQA 1XYYA 1ZA1A 1JDZA 3PWTA 1QK5A 1J99A 3AJ8A 1YDMA 2LPMA 4KFRA 2P9CA 4BDTA 1G2IA 3E35A 1N63A 2XTNA 3JPOA 3QLVC 2DFKB 3BQMB 3V8RA 5B12A 3ZY3A 7ICNA 4U9IS 2LMRA 1YA8A 4BJ3A 4D0NA 1L6IA 1YJBA 2JPDA 2PS1A 3F0TA 3UK1A 2WMYA 3P2YA 1V5EA 3ONDA 4FBGA 2NMVA 4UTXA 4EJFA 3MUOA 3DVLA 4IQGA 4JQCA 1JLKA 1QCYA 7ICVA 1QFMA 1YS7A 1HOXA 2WA1A 4UB1A 4MUYA 3TZBA 3O38A 2H29A 1QQ7A 1ZQYA 3PEUA 4BQFA 5CCXA 2G1AA 4C4PA 2ZQ5A 5HKOA 1KEWA 2VJDA 4QUKA 1BXKA 3RK0A 4G97A 2X9LA 3WRXA 1L7PA 1RHJA 2LWIA 1AOXA 1G21E 5GMOA 2B5OA 1S2IA 2QTHA 2IV2X 4OI1A 3KQUA 1B22A 5JAMA 1QAQA 3FJOA 1KN5A 2IPLA 2EFGA 3IAEA 3O90A 4AG5A 3UJNA 2PGOA 3BCHA 2BISA 1SL1A 5F2OA 1L7VC 5LQDA 3HW8A 3MR6A 2OHIA 4ROSA 2H4ZA 2YY5A 2CLLB 3P7MA 4NCBA 5AW0A 4J9OA 2Q6VA 2H6EA 3K5PA 4E13A 4KRXA 5J2IA 3AUFA 4IDHA 2EG5A 5C1PA 1A8IA 4EHLA 3KJZA 1ADCA 1CETA 3C48A 3AHEA 1FP2A 2HADA 1G5RA 5AH0A 4TS9A 4FHDA 3FCYA 3RI3A 1ZISA 4WFJA 3SF0A 1E6CA 4MP8A 1GADO 721PA 1DZ3A 3T1TA 3HP4A 8GPBA 3Q88A 1R9JA 5G2OA 4F2GA 5BP7A 3H2KA 3NC0C 5TSDA 2CXRA 1R9GA 1SM4A 4V0QA 1V9CA 4LSWA 2PCJA 3WWEA 5EZYB 4CVNA 3GMTA 2HQ1A 4JWNA 3MCZA 4MV7A 1NBWB 1B8VA 1FRZA 4DM7A 4PONA 5TQVA 3RB6A 5K0LA 2OORC 4S1TA 1OAKA 4U39A 5AM1A 1LRJA 2WUWE 3R4CA 4R40A 5KYXB 3C85A 4BBPA 4HYYA 4LKRA 2WF5A 4B7ZA 4LF6B 3BL6A 5AJWA 2O3UA 1EP1B 4NQRA 4U2GA 3QVSA 4JBWA 5KNDD 5LSAA 4AJNA 2R8IA 1DCKA 1W94A 1UM9A 2FK7A 1OFHA 1A7AA 2GFHA 3JQ7A 4NQZA 3CVWA 3CPJB 4R84A 4C4RA 1DSSG 4MI9A 4EFMA 1VPVA 2DG2A 4Q4CA 2VT7A 4HMPA 2XWJI 4IBOA 3AUSA 4I6EA 1JKXA 4YAGA 1ELOA 3BIOA 5KQGA 3M6UA 1FUYB 2Q8PA 2Q5LA 3ENZA 5JNRA 2FN7A 3C2LA 4Z6EA 5JT1A 1EB8A 1EUZA 4HTAA 4OHFA 3K6RA 1XMOB 1A69A 2J9XB 4H6WA 4B8YA 2Q1XA 1AKRA 3QFTA 4TMZA 2JGIA 3T61A 4ECRA 4M8KA 4KHZA 4L9RA 1KC1A 4D4MA 1S8FA 3I2JA 5I9NA 4Y6QA 5KINB 2QX8A 1JWLA 1U0HC 4FFLA 5KG1A 2BUBA 3WQBA 1H2HA 5KFEA 1POWA 2DBRA 2Y71A 4KYIB 4I6JA 1WCIB 1LCIA 1X7GA 4KEAA 3F2DA 4PTYA 1FMTA 4GYWA 2J0EA 1GRVA 2CF6A 5F5XA 3MOGA 4CM4B 4QZVA 3N6VA 4CMEC 3TRDA 2G4LA 3KLMX 1UWCA 3DDHA 5CB1A 4P0PB 1US8A 2H3QA 3JD1A 2XT9A 5LVAA 3DBRA 3HKZC 2QX4A 1IB0A 3I1JA 1BGWA 1QH8B 3BEOA 1HEUA 3TLEA 1ZCFA 3H0MB 4OJOA 3AU6A 2P6RA 1ZNQO 1CE8A 1L4KA 2QZPA 3H2HA 1VL0A 3NXSA 4PFSA 3WDKA 1SUSA 4RGYA 3FWKA 3EBLA 3IULA 4RWZA 3LPDA 2HJSA 2C88A 3II6X 4OLHA 1UDBA 2WHXA 3PTZA 5AR1A 1O58A 3SYMA 4P5DA 4OHOA 2X2EA 3GLFB 2I2AA 2Z6QA 5EWFA 2QMYA 5KOIA 3RKUA 2JJ2A 3DGFC 5KVSA 4F3TA 4BNJA 3KCNA 2BBWA 4Z0PA 4ENRA 2C7GA 3AF2A 3BK2A 1KDHA 3LHIA 3T38A 4QWCA 4CMGA 2BSQA 2G9QA 4EZEA 4P93A 3D4PA 4F9GA 1XCBA 2QSZA 1ADFA 1F4LA 3VNSA 3PD1A 3IURA 4ERNA 4O2AF 1DC8A 2ZTLA 1P19A 1TW3A 4I50F 1QVVA 4YRFA 3OF3A 5DU2A 3UAYA 3SAHA 4ES6A 1YGPA 2YDYA 1XXHE 2QUKA 5DRTA 4BAUA 3KX2A 1RI2A 4BFTA 2OM2A 3QLUC 5B4UA 4P4NA 5CG1A 1C7RA 2Q7DA 3EGDB 2FE9A 5I48A 3GH3A 5DNCA 1O3YA 5EMJA 4KYUA 1B0ZA 5TGZA 4S1NA 1VE9A 4KQCA 3RH6A 3WGIA 1N3LA 3GX1A 2JH8A 1XAIA 5D49A 2W2TA 5AUNB 5A9SA 1OREA 4EUFA 4H1VA 4WKCA 1L3IA 6ABPA 2EU8A 4P08A 4DYDA 2W04A 5DG7A 1X7ZA 2FP4B 3A1NA 2BFBB 3LOPA 4GX5A 1CY6A 4OIMA 2FY8A 2XT0A 4R1SA 4DGQA 4EY3A 4JJIA 4JXXA 9ICQA 2HCJB 4NJOA 5DYWA 4GVPA 7ABPA 3PA8A 3RGGA 1NC1A 4J91A 1H6DA 4B79A 4MIYA 3I01A 2H1IA 4IDOA 4JB2A 1PWXA 2OHJA 3EXG2 3OOHA 2P2NA 2ORYA 4XDGA 3NNNA 4HUQA 3VMFA 3S1LA 2RGRA 5C4MA 3AH8A 2W7OA 1A96A 4HDKA 5DGIA 3JD2A 2UUCB 3S29A 4R01A 1KO4A 2H4WA 1WU8A 3CZ4A 1JU4A 3M4YA 1E8NA 3VO9A 4ND1A 2VR1A 3FCSB 3UN1A 1AA9A 4ZCPA 4RABA 3TM5A 4BYMA 2OHGA 3RROA 4BCCA 3OX4A 5DXJA 3PUXA 5JAIA 1KRHA 2R8XA 3A37A 4V2IA 2HHUA 2QK4A 2WT9A 1ZC4A 2J5QA 3C8HA 4LYFA 3PVXA 3F47A 5JH7A 2HWUA 3MR3A 1HDIA 2ZJYA 2Y0DA 2YW9A 2C99A 2GWHA 3IE0A 3M2PA 3FPGA 3QOXA 1NOIA 4LTDA 3NWEA 4IMRA 1EFHA 1ZA2A 1LV7A 4HVLA 3HKCA 1XG5A 2AC2A 3GEHA 3IMGA 4GR5A 1GZDA 3V6LA 2PXCA 3J81j 4EG5A 3BJZA 4AP5A 3NANA 5CDTA 4D4GA 3JR3A 3OBBA 3RLIA 5LNK1 2BM1A 3RVDA 5BSGA 3MMSA 2VK2A 1ADYA 4BB9A 2KMLA 1J56A 1A5BB 1BG6A 1ZR4A 3TLGB 1KI6A 1UBRS 1T8RA 4TTSA 1NJ5A 2C2MA 4C7VA 3P71T 3WV4A 1PK3A 2E1PA 4ZVVA 3ZDFA 2JFZA 3UOWA 5KWIA 2DQSA 4J16C 1JIIA 1VHQA 2XAAA 5AICA 1KZYC 3DZJA 3G5LA 4Q48A 1H65A 2P0EA 1QQTA 3RBXA 4BZPA 2I91A 4TKVB 1GIAA 1X6IA 2G1UA 2ZCUA 3GPIA 3NUGA 1YACA 4HH1A 4BB0A 2A1TR 5LOVF 3JZMA 3MRSA 3MQ4A 3UK0A 1V9SA 2WT8A 2COEA 4O3PA 4OHXA 1Z6TA 3T3IA 1X77A 1P7WA 3OIFA 4UVGA 2FLWA 3DUFA 3F5SA 4M83A 2ENWA 1VKOA 3FNHA 4XVRA 3SV4A 4OFZA 3JZDA 3SZ2A 4G1BA 4MVXA 2HREA 4MEAA 4BEBA 3H87A 4KDCA 1X9MA 2EBWA 1BNCA 3RJMA 3JAMA 4YMMA 4GNRA 3DO8A 4X94A 4FN5A 3HM2A 3UJCA 4DUZB 2XLCA 3UQ2A 1ZD3A 1NT4A 1C7QA 1LS1A 2Q0HA 4RQUA 4XJSA 5K0EA 2HOQA 3P94A 5FI1B 5M2QA 4C3VA 2P9BA 1RKQA 5DHSA 3O1LA 1UQTA 5JU6A 1BJKA 5FYDA 4JJ7A 1ZD5A 1HG0A 1IAQA 2PMZC 1Z74A 3H0EA 4ZALA 1EKXA 4AMBA 2CXHA 3QVVA 3RAGA 1JBQA 3BTVA 1B0PA 5ALQA 2FPLA 2C0QA 2I3DA 3CXRA 4JIGA 4QOIA 5DLDA 2LCQA 1RAFA 2LCFA 4YRGA 5EMMA 2XXAB 2V4MA 3CISA 5EA2A 4BC1A 3I05A 1Q91A 4BIMA 1T26A 1X7ZB 3NBAA 4X90A 2XOEA 2W9CA 4ONEA 5EXXA 4ENSA 3BIJA 3MILA 4HYQA 4R8LA 3TZKA 4YJGB 3I2KA 4A23A 1LDNA 3L6BA 4D0GA 2X4IA 4OY3A 4AKTA 3UY4A 2ZRCA 4QT4A 1USIA 4D25A 4ZOLB 3NTXA 1YCDA 5CJ7A 1UOEA 1VP9A 1WXEA 3IELA 4GRDA 4OREX 4BMVA 4A6EA 4BQIA 1UK7A 2X3FA 5FPPA 1A6SA 4HN9A 4BNGA 4RY2A 5TMDA 3AV0B 1NMSA 1CEEA 1X80A 8ICFA 1I51A 3P4UA 1BCRB 1GGMA 1GUYA 2FX2A 4TKMA 4WLOA 3A1CA 5KSPA 2XY4A 3NOOA 3QEMB 4TTPA 3K9FC 5JH7B 2I6UA 5AW3A 1CKEA 4EB3A 1E1YA 3GFOA 2HMWA 5HDBB 5E4JA 4RACA 3RVJA 3FG9A 2IEGA 1GZHB 2PIAA 3Q72A 1OWNA 1UBGA 1JHRA 1HI9A 3UJBA 5ITZB 5M04A 2C5GA 4MB0A 4RPHA 3QH4A 4H31A 1N7HA 3R6LA 5KDLA 3O21A 3OLYA 5CK5A 2QUIA 2QLLA 2SECE 2WZDA 5ALZA 1ZCAA 2VJOA 4ISCA 7GPBA 1VG8A 3MCTA 1DBPA 1QFJA 5IINA 3CZRA 1J90A 4IDDA 1PVDA 1U8XX 2QARA 1ZJ4A 2Q5JA 4GO1A 3OLCX 1JZTA 1NJ6A 4K2AA 4RF3A 1MOZA 3G9ZA 4E6EA 5IDXA 1JH9A 2A5YB 3HA5A 3L9WA 4RKYA 4NCJA 2V9ZA 2GETA 2K4EA 4PXAA 3TTYA 3JALB 5HX7A 4E5MA 4URXR 5I9MA 4FBLA 2CWWA 5A4FS 4G56A 4UUNA 2O57A 4GPEA 4BJQA 4LV8B 1M6HA 5KFSA 2G9ZA 3QPAA 5IT5A 3U7FB 5HPYB 3T3OA 1R4NB 5F73A 3ZHXA 5EN4A 1UBEA 4MVJF 3PQ6A 4NOMA 2EL7A 3HL0A 4HAUA 2YXBA 1M9NA 1E2LA 5CMLA 3LKDA 5K3CA 3UF0A 2WFMA 4CL8A 3LY8A 3DHEA 1S96A 3E58A 1NK7A 4NAVA 3IBCA 2NTYC 4UE3S 4IGIA 2P9EA 3LH5A 1NKTA 3IUYA 4Q1DA 1XO1A 3A6HA 3DNFA 2GZ2A 3UWDA 1EWQA 2PGNA 1H9AA 4EABA 3RYCB 2X0RA 3NAMA 1AK2A 2FN8A 2RHJA 2FWIA 1AZSC 4MOWA 1U3DA 1SY7A 4U7HA 2QAGC 3GLTA 2I78A 4PZUA 1YQXA 2ZVPX 4KQIA 1FU8A 4WNAB 1FY2A 2CXQA 3BD7A 4KOAA 4NBWA 3ZGYA 3IOMA 3C2QA 2ZKIA 1QYCA 1NSYA 3W5CA 1Z6AA 4ND5A 1NBIA 1IVYA 3IUNA 3W3AH 3T1YB 2PUWA 4RZ3A 3L4KA 5DB8A 2QY9A 2WM3A 3GP3A 2O3RA 4C08A 5IU6A 3L18A 1UC9A 4KNVA 2YVUA 4DXAA 3BDVA 2C00A 4RXTA 4EQ6B 1LZLA 1W5EA 4AF6A 1ETUA 4YECA 1CZNA 1KH2A 1U4SA 1W88B 4XQ0A 3BRSA 1BHJA 1N1EA 1ECLA 4MI3A 5T3UA 3BQ7A 3FGPA 5EZYA 3BPSA 3TUJC 3PPVA 4V0OA 4DKJA 4DDHA 1GRCA 1ZIOA 2VXYA 1Q84A 1X94A 1CLUA 2HFKA 2P79A 3C70A 3GK3A 4Q02A 3Q7TA 4RVFA 3OTWA 5DN9A 1RDFA 1LBEA 3BREA 1XRMA 3K72B 4AUKA 1W581 3EYWA 4WMLA 1KMMA 2GJSA 4L07A 4B82A 5K0JA 4HKTA 2YWXA 2D1RA 4C20A 2D0DA 3H0CA 3F53A 1DC6A 3EFEA 8ICJA 1GKUB 3ODPA 2W70A 1DRWA 5C0OE 4BQNA 4QLBA 3NHJA 5C7IO 4YHHB 3LL4A 1QTNA 4O6VA 2UZ1A 3RVOA 3H8MA 1W1IA 2ZUUA 3QWIA 4NDNE 1V96A 4GOJA 2GEKA 4J9LA 2FCRA 2FSIA 2IUSA 2GZHA 5HR6A 3IP9A 1ZXXA 2D0OB 4RQ8A 2WMOB 3HZRA 5BUSA 2FE4A 4Q03A 1HYBA 1JAIA 4HDNA 4WNCA 3W8NA 5KWEA 2K8CB 1KPGA 3JPNA 4PPYA 2AF4C 3A6DA 2EZXA 3CMCO 5K5EA 4UHDA 4GZLA 4ZKDA 4PG4A 2A0UA 1KORA 5ECWA 4DSAA 1M8JA 2VPWA 1ZLYA 2G5CA 1ZW6A 3REFA 2G25A 2C7OA 1T0PA 3IEIA 1BHSA 9ATCA 4LHWA 4HXGA 2HEIA 2YY7A 1DXOA 3STHA 1PK8A 3HJNA 4N5LA 3D6NB 2A30A 3L0CA 2WA2A 3EUEA 5DCWA 1UBSB 4AG6A 1WP4A 4G5YA 2PMDA 3OJWA 3ND9A 2C4KA 1X66A 1O6ZA 1YQDA 4N4AA 2CJWA 1GPKA 2QTNA 4JX9A 4TVSA 4DUPA 1HE3A 1F9AA 4P4GA 4DT1B 2A1TS 4QQNA 4EPWA 5NULA 4ML3A 1P44A 1PV4A 2JLBA 1FTQA 5FEMA 5AKIA 4MUJA 2DTEA 3UUEA 1B0UA 4P53A 1PFYA 3VSDA 2EIHA 2J5XA 4ANFA 4ZOEA 3A27A 4BBAA 3K1AA 3UGKA 4MJ7A 4XM0A 1MV5A 1G66A 3OT4A 1U7OA 4ALMA 2ZWAA 3RRJA 1KR2A 4L50A 2W9CB 4J90A 2WIJA 1EFVB 1NDQA 3NT5A 3DULA 1OTXA 3SBDA 1XOIA 4RCVA 3KHGA 1XNGA 2B0JA 3RSOA 4BQOA 2W5UA 5DNUA 4DIOA 3EZNA 2JI7A 3EYAA 2TRSB 2VQ6A 2OK8A 3HN7A 1NVUQ 1N2CB 4DREA 5G02A 2AJLI 3OJ0A 1JDPA 1M2WA 1E1QD 2EG9A 3WGJA 4N48A 4DJEC 1PJ8A 2CBGA 1WXQA 2B1JA 2JB9A 1SUAA 3H97A 4HDRA 1HDGO 1DX6A 4XVHA 2UDPA 4MS1B 1DWOA 2ODPA 3F6PA 4JFAA 3ETDA 1D1PA 7ADHA 2VNKA 2GZRA 4LDRA 4G1CA 1NXTA 2HA2A 3EXHC 1V8BA 4RF5A 3RUEA 3CUSA 4IDFA 2AYYA 4LF5B 1YFLA 1JFSA 1DO2A 3GMSA 3W04A 3F5QA 3S8EA 1T2NA 2GEFA 3V7KA 3IBYA 2C78A 1N5WA 1URPA 2GTPA 3JQ7B 3U7IA 3CVUA 4ZCQA 5LQAA 4O4IA 3W7AA 1CR0A 1LK7A 2AK2A 2XMCA 2PU7A 2VSNA 1ZQIA 3ABZA 4P4LA 4CJXA 1KDTA 4RFSA 3KUCA 4RPZA 1QGUB 1YNOA 5CX4A 1BN6A 5DX0A 2IHJA 4GXRA 4DSFA 3TKLA 3RH4A 3WADA 4NNOA 1ZQGA 3ICVA 3IG5A 1IXKA 3IJRA 1JI0A 1ZU4A 3OA0A 3K5IA 5F4BA 4GMFA 1GNVA 4GPTA 1KI2A 4EEYA 1OFUA 3B6KA 5C5CA 1A88A 3GARA 3GZFA 3BXXA 3AI1A 4NBLA 4LFCB 2WHQA 8ICNA 2FZ4A 4NJ8A 3RM3A 3O75A 4JQOA 4LY3A 4HLNA 2OFOA 4MB2A 1FYVA 1KKUA 1NX9A 1YQTA 2C94A 3ES9A 4MS3B 3F78A 4B40A 2Y9TA 3DM5A 3GI1A 4COKA 1L8XA 2IXGA 3CFYA 4MYUA 2QD5A 3Q8PB 3WLSA 1DEXA 2BM9A 1GFWA 3WWZA 4BECA 1D9FA 1ZYQA 4CE6A 3E5RA 4OH7A 3TW6A 4C22A 3H42B 4DL3A 2QB5A 3AINA 4NL9A 1GTG1 3A4IA 4Y0NA 3C6MA 1SK8A 5DNAA 1GAWA 2IV7A 4XVUA 5LMNB 3FNIA 4P7JA 3GFFA 1QZ3A 3C8UA 3FETA 3CF0A 1GQSA 3L1KA 4UCXA 3UBMA 1YL5A 5JJCA 2DUYA 3E3NA 5GOTA 1P81A 2X2FA 1XMSA 3IODA 1CY0A 1XS9D 5F1KA 2P9HA 3PS9A 2WTFA 4KKVA 1I9GA 5DE3A 1XELA 3G6YA 3P96A 3WU2U 2DQKA 3L4JA 4HDOB 2OYRA 3TCKA 1FJ2A 1DMRA 2JI8A 4Q1AA 4LDNA 1FK8A 3SP1A 2EP5A 2V58A 4BVFA 2QYSA 5CB6A 1E9SA 4NU0A 1VG0B 1JLRA 3C97A 3D9QX 1XQWA 3EVEA 2W6JA 4ZVTA 4RJTA 3CJTA 5BWOA 2Q3LA 1QQAA 4YDQA 2WV9A 1FS6A 1UIRA 2J9FB 4Q3NA 2Q46A 2HHXA 1NVMB 2QTAA 4I2EA 2WAMA 4N0QA 3D2BA 3RAJA 1CUGA 4B6GA 1J0AA 5BY2A 1EXVA 4X8LA 4FB4A 3C2MA 1XLUA 2ZYUX 3I92A 3QLTA 2HMXA 2NO9A 1U8TA 3ZE6A 1USWA 2H00A 4JUDX 4A0SA 3FAZA 3WBFA 1Y9EA 4F11A 2WU1A 3MINB 5KYWB 1I94B 4I5EA 1TF2A 4M0FA 4OF4A 2A1JB 1LH0A 2AFRA 2FZWA 4J9UE 4EHAA 4JMPA 4YT5A 2PNFA 4ZU3A 1R7RA 3KXLA 1QZUA 2VZEA 2JFNA 2A5LA 3BJIC 4IZHA 4BZXA 1J70A 2BEVA 1NVGA 4PG8A 4WUTA 3QX3A 4DKXA 1IZ9A 2WU4A 4Z5XA 2XAUA 3KUXA 4GAEA 3T5CA 4AUNA 2OCPA 1KKXA 4AKEA 2P27A 3IESA 3QPWA 4I2JA 4Q44A 1PJ2A 1YB1A 2ZBRA 4BO8A 3PNSA 1H2WA 1C4WA 2F6RA 2GSWA 2G88A 3SN6A 4QNRA 4L51A 4HNVA 4CCYA 2IYEA 2IA5A 3X1MA 1UP6A 4CLRB 3PZBA 5DRYA 3MDAA 2D00A 3NZEA 4G5SA 1SXJE 1QE3A 4G85A 4I99A 4GLJA 5JCJD 1Q2XA 1SUBA 3LW8A 1BE8A 4D43A 3OSPA 2RBEA 5A0LA 4LJAA 1DKLA 1ZI6A 3FA2A 3TTUA 1YKGA 1TZMA 3BCUA 1JE0A 4DVJA 8ICQA 5CHEA 3KIPA 3WTBA 2DF4B 3HXQA 2C29D 3SJCA 4RTPA 2XKJE 4DBVO 3TADA 1V5IA 1J5XA 4EJMA 3RJKA 1GP2A 3EVFA 1PSZA 4UUOA 5FFNA 2N1MA 4PFKA 2P30A 4YCNA 2C03A 3FBTA 2OQ2A 3IUEA 1ZQFA 2VSOA 3NVMB 4IH9A 5F3RA 3UICA 4ZZ1A 1ZAYA 4IS7A 1FMJA 2E89A 2Q49A 4J3FA 2J6SA 3WKEA 1TM2A 3DXYA 1N6NA 2GAOA 1E89A 1IDOA 4NPHA 1A27A 5DOVA 3S5UA 3GCDA 4QJ5A 3EIQA 3ZXIA 4O2RA 4NE7A 1COKA 4UQLA 4ZVOA 2EBFX 2FSUA 5INTA 1XA0A 1JSXA 3MTGA 4IGFA 4ZAFA 3WLMA 4BO1A 2O7SA 4MICA 4X60A 5ICSA 3AG5A 5E1BA 3H7IA 3WK9A 2JJMA 4OJQA 4BLTA 5JSQA 2P8JA 4IIVA 5F7XA 2FEXA 4OI0A 3J7AC 8ICTA 4AWAA 2R1ZA 1Z7WA 3EZLA 4BV8A 5KQPA 3GIKA 3VH4A 3L8HA 3I3OA 5JAZA 2C3MA 4I55F 4D9BA 3MLBA 1SB9A 3R9XA 5CH8A 2Z4SA 5IUNC 2WVAA 5DBCA 1NOKA 1E3EA 3CCFA 1RJEA 2EEZA 1DJMA 3WFZA 1XKXA 3LPNA 4XGRA 5EP4A 3VOSA 3WAGA 4Q4JA 5D3MA 3GBSA 1IWOA 1NJYA 4RV4A 621PA 5KI6A 3VBEA 1QFZA 3GJSA 3ACBA 1KEUA 4PYLA 1EX7A 2AFHB 1YKSA 4MYSA 3ZDCA 1RADA 1RZRA 3CKKA 3NHKA 1WWVA 5FEUA 1SRRA 1DPFA 3GYBA 3L79A 3GRKA 5E0KB 1M1NA 1OC2A 1I3OA 2Z8ZA 3JPPA 2W7PA 3FB4A 1UMBB 2C04A 2IUFA 2VAXA 3GEEA 3OIVA 3P5SA 1TCAA 1PSWA 2ERCA 4ELTA 5IKOA 4B5KA 3R9WA 1PS0A 1ENYA 4LCBA 1QHYA 3CNHA 4GRIA 2COKA 1XZJA 4D5EA 3O4JA 2JFBA 1RPLA 4DQSA 1PAUA 4HX2A 4KN9S 5AJVB 1BDMA 2CF5A 2HNBA 3BJRA 3ZJ5A 1CVRA 3KLNA 2CBXA 1PL8A 1E96A 4Y0VA 3V1MA 3WGHA 4AY4A 4DABA 4GXIA 2FUG6 2HK6A 2G6BA 1A2OA 2GUGA 4N8DA 3FGZA 3RIEA 4JJ8A 3WLRA 3UW1A 5ITSA 2Y0SF 4Z4IA 2O5CA 5AXCA 3U81A 1WCIA 3SEFA 3NDBB 4FGWA 2GBIA 4GF5A 3SDZA 1JPJA 1JS1X 4HMQA 1KKMA 1JX4A 2WIBA 4IG9A 4JDUA 3PGVA 2OV3A 4E46A 2OCKA 1OZAA 4ICIA 2E1FA 1LNSA 3RV3A 3U39A 1W0CA 4BLPA 4I5IA 4OA5A 3BEDA 3T9FA 4A3SA 2IS6A 4IJUA 1GPNA 1NX6A 2N75A 4J0HA 4AYXA 4KSBA 1PIWA 2PLNA 3GMDA 3KYCA 2JHFA 4MW1A 3HKBB 1HWYA 3W8FA 1PU2A 2BTOA 1GGNA 2ADMA 4QRIA 3PTAA 3KYBA 5LP1A 4HDSA 1ZNXA 4X8HA 4A2QA 4CTJA 3O8RA 4PFQA 3F4LA 5AMXA 5AUQA 4LSMA 4CM9D 5LN1A 3AEQA 2VNAA 5E7MA 4OHRA 3T7AA 4GWGA 2HU5A 3EJWA 1GG9A 3MDCA 3W4IA 2DFVA 1TJNA 3FKSA 5C5IA 3OC0A 2NP6A 4CM8A 2ZE6A 5TXGA 1SOVA 3KB8A 1YJXA 3LBNA 3A6JA 2A3RA 1XEXB 1CP3A 1E63A 4FKMA 3QV1A 1NATA 1VOTA 4L0QA 2ZT6A 3MIZA 1TYCA 3O4FA 2YC2C 3TMKA 5D7NA 3WI7A 2OBMA 4OJ6A 1WWUA 3DT8A 1XRRA 2GAFA 4MRVA 4PBTA 4POAA 2FF7A 1B16A 2Q6IA 2OLEA 3QXJA 4FCWA 2H0QA 5KYUA 4CCYB 1KERA 1P6UA 3Q40A 5AXBA 5JW6A 2NWQA 1MMFB 2PMFA 2IOFA 1A5TA 2PXAA 3KHLA 1YZLA 4FTWA 1YIDA 2FPIB 2O20A 2YYSA 1T5HX 3DP9A 3HGTA 4ZRNA 2IV3A 1AUQA 1J0DA 1JFLA 1GSHA