4FFDA

Crystal structure of engineered protein. northeast structural genomics consortium target or48
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
230
structure length
230
Chain Sequence
b'MIRAVFFDSLGTLNSVEGAAKSHLKIMEEVLGDYPLNPKTLLDEYEKLTREAFSNYAGKPYRPLRDILEEVMRKLAEKYGFKYPENFWEISLRMSQRYGELYPEVVEVLKSLKGKYHVGMITDSDTEQAMAFLDALGIKDLFDSITTSEEAGFFKPHPRIFELALKKAGVKGEEAVYVGDNPVKDCGGSKNLGMTSILLDRKGEKREFWDKCDFIVSDLREVIKIVDELN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF00702 DOMAIN PROTEIN
molecule tags Structural genomics, unknown function
source organism Pyrococcus horikoshii
publication title Crystal structure of engineered protein. northeast structural genomics consortium target or48
rcsb
total genus 86
structure length 230
sequence length 230
ec nomenclature
pdb deposition date 2012-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 4ffdA02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4ffdA01
3R4CA 2G09A 3QU7A 3EPRA 3U7HB 1CQZA 5AW3A 3W5BA 3ED5A 4XPZA 1RLTA 2G08A 4F71A 3ZUPA 3ZX5A 3ZTYA 1TJ3A 2HO4A 4HGNA 3P96A 4UM7A 1QQ6A 4UAVA 1Q91A 5ALMA 2OBBA 3OCWA 4NABA 5IS2A 4EEKA 4Y2QA 1U2TA 4CE6A 5ALYA 2W4MA 2BY4A 4DCCA 3IB6A 3ESRA 5ALRA 4UU1A 3KOOA 2I7DA 5AKEA 4GIBA 4Y2RA 3L7YA 2BDEA 4DWOA 3AR2A 4JB3A 2B0CA 2MU1A 5AKXA 1YS9A 1J8DA 4KYTA 4KX3A 3EF0A 5A3QA 5AK5A 2Q4RA 5AVZA 1QQ5A 2WHEA 1L7PA 4JDPA 4C4SA 2RAVA 4AS3A 5ALEA 2I6XA 3NALA 4IFTA 2ZBDA 3WKDA 4NAVA 2RBKA 4BYGA 4YCMA 5ALVA 3M9LA 3N8GA 1Z88A 3SKYA 2HI0A 5AVRA 2EAUA 1O08A 3HLTA 3ONNA 5AIBA 4Y2JA 2FUCA 2D2VA 2WF7A 2YMQA 3DDHA 3B8EA 4EX7A 5A3SA 3SD7A 2P27A 5AVVA 2EATA 3EWIA 4BX2A 2RB5A 2PKEA 3QUCA 1F5SA 1RKVA 4FYPA 2FEAA 2JAOA 3MMZA 1Z4OA 1L7MA 4KNWA 2G0AA 4HAIA 1NNLA 3R09A 4UAUA 3L8EA 4FFDA 3NRJA 1RMQA 4UMFA 3L0CA 2YJ5A 1RMYA 1WR8A 4HGQA 2HDOA 3QNMA 2JAWA 3N07A 1RRCA 3UMCA 2CN1A 2GHQA 4XQ0A 3RF6A 4UMVA 2JAUA 1ZD4A 2NYVA 5AK4A 1ZD3A 4Y2XA 4J03A 1AQ6A 3WKAA 3A1DA 5AVYA 3WGVA 3AR4A 2EARA 3EF1A 1J97A 3SLRA 4UASA 4DFDA 4I9FA 2HSZA 3SMVA 5AM4A 4QQFA 3FGOA 5ALGA 5AI8A 1QH9A 3ESQA 4MUMA 1RPZA 2YJ6A 1QYIA 4UARA 2YFYA 5ALXA 2OA0A 3OCVA 5ALJA 1L7NA 3NUQA 1Z4MA 4I9GA 5IT0A 1Z4NA 5AI9A 1L8OA 1ZOLA 4BEVA 3L0BA 2GO7A 3AR8A 2B30A 5AM3A 2IA5A 1L6RA 2G06A 5A3RA 5ALZA 4ZEXA 4EX6A 3ZTWA 5ALDA 2IOFA 4YH1A 3UM9A 2YMLA 2AGVA 1XVIA 3DV9A 1WZCA 3A3YA 2P9JA 5ALUA 3E81A 1K1EA 2HX1A 1CR6A 5AKKA 4Y2VA 1T5TA 2ZOSA 1WVIA 5ALIA 1U7OA 4CF5A 3OCZA 2JGAA 3WK9A 1L8LA 5AVQA 3BA6A 1PW5A 2G1AA 2WM8A 5ALQA 4F72A 5AKJA 3AR6A 4NV0A 4UM5A 4G9BA 4Y2SA 3E58A 1WPGA 5AVUA 4E88A 5ALSA 2JARA 4UATA 2C88A 3AR5A 2QLTA 2P11A 5AM5A 3QGMA 5ALOA 5IT4A 1RDFA 5AKGA 2AUTA 3ZU6A 4CNQA 1Z4QA 2HF2A 3MC1A 3FVVA 3PCTA 2ZBGA 3U26A 1TA0A 4AP9A 4HGOA 2AH5A 1MH9A 1TJ5A 4NFLA 2IOFK 1FEZA 2DQSA 3OPXA 1O03A 1N8NA 5JJBA 3W5CA 4O8CA 1RMTA 4EELA 2QYHA 2RARA 2C4NA 3PDWA 1TJ4A 3J7TA 3ZWKA 2ZG6A 2B82A 3W5DA 4HGRA 1ZRNA 3ZX4A 2R8XA 1ZD5A 1XP5A 3PGLA 5AESA 3ET4A 4Y2YA 1Y8AA 2R8EA 2Q4TA 3WK5A 5AI5A 3WKBA 2HEGA 5AVSA 5AKHA 2FPWA 3SKXA 4RETA 3I1YA 4MWOA 4UW9A 2HHLA 3UMBA 3DNPA 3OTQA 4G63A 2YMPA 1X42A 3NANA 3W5AA 3FM9A 4Y2PA 2Q5EA 3ZVMA 1EK2A 3QX7A 3R9KA 2WFAA 3ZW7A 3AR9A 5AW4A 2C8KA 3ZVLA 5AW1A 1YDFA 1U2SA 2X4DA 5AVWA 4C4TA 3KD3A 1LTQA 1IWOA 3QYPA 1Z4IA 1VJRA 2P69A 3BWVA 2C9MA 5AW9A 4UMDA 2ZXEA 2CFRA 1LVHA 1U02A 2PR7A 5AM1A 5ALHA 2IYEA 2B8JA 4L57A 1EK1A 1Z4LA 5ALNA 5AW7A 4ZEVA 3U7FB 2YY6A 4YCNA 2ZBEA 5ALPA 3KDPA 5ALTA 2B8EA 4RESA 5E0OA 2IOHA 4OCZA 2O9JA 3N28A 4BNDA 4BX0A 2BDUA 3L5KA 4J2TA 3NAMA 3NIWA 4CF3A 1Z5GA 3F9RA 3AR3A 5AVTA 1XPJA 1Q92A 3WKCA 5AW0A 5ALFA 3QXGA 2CFTA 1RKUA 1S2OA 3OCXA 3VAYA 2VKQA 2YJ3A 3KC2A 5T41A 4BKMA 2CFSA 2I54A 4UU0A 5AI4A 3ZI4A 4EZEA 3QU2A 5AKIA 3DAOA 2FPUA 4L6AA 4NWIA 3QU5A 3D6JA 2B1RA 3IRUA 3L0YA 4L6CA 5AW5A 3FPSA 1RLMA 3ET5A 3U19A 2NO5A 3U7EB 2B1QA 4ZEWA 5AK6A 3NASA 3MPOA 2FPSA 3L8HA 5ALKA 2YN4A 4KX5A 3WKEA 4B6JA 4BEWA 4YGYA 2GHTA 2AMYA 4HGPA 3SHQA 1RC8A 2G80A 1YV9A 4PNHA 4BNDB 5AK3A 5AKZA 4AS2A 3TLMA 1U7PA 4XOUA 1YMQA 2R8YA 4HYTA 3N1UA 2MSNA 2FI1A 1NRWA 3L8FA 3N5KA 2O2XA 5AIAA 2OM6A 3IJ5A 1ZJJA 3I76A 2OYCA 3ZVNA 4OHFA 4DW8A 3U7GA 1VJ5A 5AKLA 1T5SA 3E8MA 2PQ0A 1Z4JA 2ZBFA 3CNHA 3WK4A 1SWWA 5AKYA 4GXTA 4IG4A 1NF2A 2FDRA 3K1ZA 5AW6A 4CF4A 5FP0A 3QUQA 4Y2UA 3B9RA 2WF5A 2NO4A 3WK7A 1RKQA 2YJ4A 5ALLA 3M1YA 3WGUA 4KN8A 5AW2A 1KYTA 1ZS9A 4KNVA 5AM2A 3UMGA 4Y2TA 4YCLA 2MU2A 3QUBA 1JUDA 1N9KA 2WF9A 3E84A 3WK8A 2WF8A 2FUEA 3MN1A 2HOQA 4FE3A 2FPRA 1T9ZA 1RQNA 3AR7A 3L1UA 2HF7A 3I28A 3CZ4A 1RQLA 1L7OA 3SF0A 1SU4A 2WF6A 4C4RA 2C8LA 3FPBA 2GMWA 4H1WA 3S6JA 2ODAA 3U13A 2I34A 2G07A 3HYCA 2I33A 4OFZA 1TE2A 1RLOA 1Z4PX 2R8ZA 2YBDA 3FZQA 3OCYA 1SWVA 2W11A 4OD0A 3I6BA 2W43A 5ALWA 3OCUA 1S8OA 3RFUA 4BBJA 1YJ5A 2HCFA 4EENA 4XE5A 3L1VA 5AVXA 3QU9A 3L8GA 3B9BA 1YNSA 4YIKA 3KBBA 4QJBA 2I55A 3A1EA 4BX3A 3A1CA 3ZWDA 5AI0A 3PGVA 1ZRMA 3WK6A 5AI6A 5AICA 1QQ7A 3QLEA 3QU4A 2FPXA 3KZXA 3QUTA 1Z5UA 5AM0A 2GFHA 2YMMA 4Y3UA 5AW8A 4UMEA 5AHXA 1ZD2P 4YIHA 1Z4KA 1VFPA 3GYGA
chains in the Genus database with same CATH superfamily
1OSNA 5KFSA 4HWTA 3C28A 1YJQA 2H4JA 1AUQA 5IAKA 4MULA 4URHA 1QRSA 1A8SA 4MS3A 5F1OA 1CR4A 2ZBRA 4KI0A 1H65A 2NXWA 2NZYA 4F91B 1MQSA 3VNQA 4F2HA 1EUYA 4N3GA 2OECA 3ZUPA 4BB5A 2PUBA 1YIDA 2FCRA 1R0WA 2LIPA 3ZW9A 1JAYA 4B45A 2ZIVA 4BY9E 3E22A 4MV3A 2WIBA 1LDGA 4KYUA 5JQGF 3CURA 3W04A 5C35A 4GM1A 4DZRA 5KL1B 1B6TA 2E18A 4TTAA 1TU3A 1UDRA 3WGJA 5BR4A 3DEYX 4AY3A 4EEKA 4XGQA 1H9CA 1J22A 1ZUNA 2YWCA 1RABA 5DBBA 4G5RA 1HQCA 4UBNA 4PX2A 4Y98A 4DO9A 4CQNA 4MRMB 4RY0A 3T3OA 5H83A 2Q5IA 1S0NA 3TFRA 4J90A 4OH1A 3IP4B 3ZWOA 1AUXA 4PGXA 1U7WA 2YW9A 4M1WA 4BAZA 4CLXA 2XRMA 2IYOA 4IDGA 4PONA 3KJNA 2B0CA 5WRFA 2D2XA 3K0AA 5BSUA 2E49A 2RLTA 4Y6PA 2G0TA 2IHUA 2JXJA 1RYMA 2OR3A 1RM5A 1X0XA 3P0JA 2A9KA 4HTAA 4ZT7A 4EYSA 4PHEA 4QPDA 3G6YA 1J49A 1KJIA 2F2AB 1AS2A 3GIDA 5A3QA 5J1SB 3ORRA 4RV4A 4BMPB 1HDOA 1E9AA 3VTAA 3N6RA 2SKEA 3G5UA 4YFYA 1UOQA 3DO5A 1DC4A 3W1EA 4U63A 4JDPA 1JTEA 1VMEA 3PA8A 5K0SA 3B7WA 5LYJA 1BHQ1 3CP8A 3AF4A 4RQ8A 2AN1A 4NJEB 1YRHA 4KO2S 4YJGA 3VYSB 4CMBA 4RPLA 5KDOA 3SWWA 2Y0DA 5CHEA 5DOZA 1Q7CA 2KJ8A 1ETUA 3RE1A 5LYJF 1JMKC 1N7IA 2RBKA 3AEUA 4M46A 4QLBA 3L01A 1AQIA 1TCAA 1KAQA 4N5DA 5JZSA 9ICVA 1RQGA 3QKSB 4GQIA 4LS3A 1HZZC 2HLHA 3AUFA 2JBHA 3VNRA 1IDOA 4UUMA 3V1YA 2W8LA 4KODA 3VDQA 3ONNA 1LBQA 4OJNA 2C7QA 4QHSA 3FWKA 3GJ7A 3DE2X 4J2HA 4O4IB 4A7PA 1I8TA 4MFAA 4MJ7A 2RHTA 4E33A 4B4UA 1P1FA 5JBNA 5LOVB 3UK0A 4O2BA 3IR5A 3V4FA 3K8ZA 3OT4A 3T3PB 1F9EA 2XIQA 3BQ0A 1DKPA 2CMKA 3USES 4H6XA 4NMWA 1XXHA 4JITA 3V80A 2OAGA 4KN9S 4RD0A 1NZFA 3V3TA 3SQIA 3G9QA 4B1FA 2XR1A 3Q85A 3TTYA 4DM7A 3ODGA 4CQLB 2FLLA 4HYEA 4L07A 5AXCA 3H4IA 1NFFA 3M4JA 2WJ4A 4MCAA 1H0HA 3CZAA 1FQOA 1U0LA 2YS7A 3E27A 4XB2A 3RSOA 4NCNA 2Q50A 2QJTA 1TTQB 3ZDXB 1PGNA 5KX5A 2B5VA 1HUOA 4UHHA 4MCJA 1OWPA 4FCVA 121PA 3T7EA 5KTNA 2G5IB 3UV7A 3GNSA 4PVDA 1E59A 5L9XA 1XZIA 1XPUA 3K6KA 3SAFA 2H5JA 3OQIB 4FMDF 2GHQA 4YT2A 4B2IA 1NNEA 4I27A 2JFBA 4UMVA 2GPWA 4UTNA 1J6UA 4IJMA 4Q9IA 2OHFA 3A9SA 3OU7A 1YBHA 3WLIA 2DFKB 4LDQA 4WJ3B 4L4YA 1WMAA 2A1TR 4PC2A 3TTWA 5HOEA 2R11A 3A2KA 1JYFA 3U48A 4RD2A 4NCBA 4R16A 4KRFA 5IM5A 2XAAA 2QXUA 3EF1A 2X6TA 5I3ZA 5IIIA 3QZ7A 4DMHA 4DFDA 3G17A 2ZSEA 1TVKA 3TFOA 2HSZA 3HDJA 4LC0A 3RRFA 1IM8A 1DB3A 1M0WA 4QQFA 4OOFA 3ZLBA 4BKQA 5TPZD 1TVMA 5EIBC 4C89A 3C14C 2BH2A 2CZCA 4MUMA 5EMKA 4XW2A 2HXGA 1DQPA 4Z6EA 1HFWA 2VF4X 3STTA 4QO8A 4FWIB 4DL2A 1H42A 3EYAA 3HCBA 3ME5A 4G24A 4I9GA 2AN4A 2BEUA 3FWPA 1Z38A 1ZU5A 3VHRA 2OBXA 1LSOA 3AR8A 1C0EA 2Q1WA 3D6FA 1VL0A 1P0IA 1TJYA 1R6TA 1E1LA 1FFDA 4RV5A 4BVGA 4RY8A 2XJ9A 2Q29A 1N8KA 1ZHFA 2C7BA 2P6NA 4JN6B 3E9CA 1KEUA 4EX6A 3VTZA 3WV4A 3I1FA 5F4BA 4L22A 5ICMA 3SQMA 1ONOA 5KAPA 5K0BA 2FPGB 2JVKA 2GKSA 4DLEA 2C28A 3LPNA 2C54A 3DBHA 4CDMA 3DKRA 4FS1A 3KWJA 5DI3B 1U9ZA 2EDCA 2F3RA 8ICSA 1UBUS 3REGA 3OESA 2BGGA 3NTXA 3OQMA 2Y1KA 1L8XA 4XQEA 3BYZA 3H05A 1W5FA 3TXAA 4ZREA 1QS0B 4L5YA 5IUKC 1BN6A 3B9JA 2XZTA 4EF5A 1K6JA 2NXNA 3ICVA 4QODA 2KFZA 2PVSA 5AKKA 4GU5A 1LY1A 1TJPB 2QN8A 1FB5A 3PLRA 4E30A 5LQCA 4N8SA 5C46F 5E3IA 3BA6A 4MKFA 5GM1A 1RJ9B 5ALQA 2HV9A 2P75A 4H7IA 5C80A 5L3VA 3Q0TA 2BHTA 5JNUA 4G9BA 1GKLA 3IBSA 3AGQA 4JKIA 4FUTA 4UUNA 3S29A 1N2GA 1W7AA 2VLBA 5KG6A 3DCJA 3BS5A 3GH1A 3BFKA 1WSAA 3R20A 2JJ8A 7ICOA 5DLDA 4DQ0A 4ZO9A 1DCKA 2A19A 4YD1A 1THMA 4KNYA 4K46A 2IDJA 2ZYUX 1T1EA 3TRKA 2JAPA 2W9BB 5IUNC 1XTRA 4F8RA 3VH2A 4KLEA 1N6HA 4K9KA 2EJUA 4U7DA 3AHIA 4PR3A 1RPLA 1FJ2A 5KFKA 2PGNA 3CVJA 1SVWA 4QWCA 3MQFA 2J9FA 4MUNA 4UNPA 4AC9A 1G38A 2P0EA 2QQFA 2G8NA 3EFHA 3V6HA 4KPUB 4M86A 3QKIA 2Z4SA 3NVYA 1PZXA 3OA2A 4P92A 4XWAA 3JZMA 5D6OA 5T6BA 4OX9Y 1AH2A 4MW5A 1G1AA 3H1BA 4DSFA 2HF2A 2VUTA 3E35A 3HB1A 3N2ZB 2KOBA 2Z1NA 5FI0B 5K01A 4DR6B 2HBJA 2I4TA 1U4NA 3LZCA 4QBHA 5T4HA 4YMWA 2YXBA 4HGOA 2BFDB 4PY2A 3KCQA 4YUAA 4IQ0A 4NFLA 4F11A 4D6PA 1H2HA 3DE4X 2IOFK 3OICA 4KIUA 1BXRB 1IJBA 5K0EA 2D5BA 3IVGA 2AS0A 4N0MA 2BE9A 3IKLA 3KEQA 4MVJF 3SNHA 4A0RA 2KK0A 2P41A 1LBTA 4Q47A 1QZXA 2BGUA 1MZVA 4RW0A 2IVFA 4B74A 2FLKA 3OD5A 4EYOA 2P67A 1AKQA 1COKA 4GR9A 1NBMD 2ZWMA 3OZXA 2WPNA 1U7UA 2PLAA 1VLZA 3FRJA 3WK5A 2VI5A 4KZKA 2Q4OA 4WJZA 5F78A 3TQOA 5L4SA 5B3JA 1BWSA 5P21A 3WGMA 1HX7A 2LM4A 3NHLA 4IF4A 3I1YA 1T2FA 2FN3A 3H5NA 3S1LA 3RB6A 3K71B 1CUCA 5JATA 3I34X 4Z99A 1XKLA 4MLDA 5IJ0A 3MBIA 2JFXA 3NANA 3RJFA 2C78A 3LRTA 4NJMB 2Z83A 5G5GA 7ICTA 1Y5NA 3PXEA 5CYPA 3TZQA 3WDMA 1B43A 1PZEA 1JFFA 2B9VA 2IHYA 3WWOA 2EEPA 1CVIA 4TVSA 5LL6P 4FJ1A 1DEXA 4HP8A 4LJSA 1HDZA 1W581 2HZBA 2IKQA 3LLUA 4RKEA 1DIOB 5AJXA 4FVTA 5EQFA 3A4VA 1IOWA 1PR5A 5NULA 5LWQA 1V85A 3EQZA 3Q7IA 2WR8A 3NBUA 2WTUA 5A71A 5ELXA 1NMEA 2BHSA 2MAXA 1FUYB 1ZL2A 2YYZA 1PT9A 1XDUA 3UBMA 5KOHA 1GPH1 1WBDA 1E79A 4WFIA 3THXA 1VJRA 1JBEA 1Q1QA 4I14A 4JJAA 5BR1A 3OIUA 2P9GA 4QTUB 2P5UA 4N3CA 2G7MC 3WA7A 2CPRA 3ZQJA 4IXNA 4HR7A 2FVXA 2JBAA 3LNTA 5FV7A 4EECA 4EI7A 3BMXA 3ANSA 3EZNA 1YQQA 3QMMA 4UPDA 5AJUA 3FNBA 1D2RA 3M81A 4PAOA 2JCYA 3ZY4A 3NZEA 1U1GA 4ECZA 2BTOA 5DDYA 2WV9A 4MS1B 4ZJUA 5TGZA 4LCJA 5KJFA 3BG5A 1DEAA 1GFWA 4RQAA 1NVAA 4YECA 1JALA 5AW7A 4ZEVA 4I4TB 1KRHA 3WVNA 2R0QC 2PJUA 3I2KA 2F1OA 3I01A 3SJBA 2VDVE 4RL4A 4UD6A 4A6EA 4U3JA 4BMNA 4D99A 5HGXA 1L5ZA 1E6EA 2X4IA 3IALA 4BX0A 2UDPA 3GGSA 4DQVA 2GJAA 4R1UA 3CJRA 4TPKA 4XSVA 1UXHA 3HI4A 4MJXA 4Y0AA 3WYBA 2RH5A 1V5FA 5FWDA 4YQWA 1IN5A 1T10A 2RJNA 2PWAA 2OCPA 5FR2A 3KJXA 3RJ5A 3ROPA 4G2TA 2X7JA 3AUTA 4QXAA 3TOZA 3TAPA 3TTSA 2KIVA 3C29A 1KS9A 2SCUB 1E2KA 5DQHA 1NXSA 2I6QA 2ZRQA 4TVOA 2HA4A 2CXSA 4PV7A 2ASLA 1UAYA 4R66A 1JV2B 1QANA 5CVCA 5GGXA 4CUKA 1LV7A 2EAOA 3C87A 4D6YA 3OCXA 2ONCA 3TUIC 2HJSA 2FFJA 1WHSB 2YJ3A 4PHCA 4B7CA 4AY2A 3I0ZA 3OOEA 5EE1A 1E5LA 1XZGA 2FWAA 4QAJA 4RA6A 4D44A 3M33A 4RYLA 1E5TA 1YHNA 5A4IS 5KNCH 3MFQA 2PMCA 1PNVA 3MHPA 1D9DA 4OMDA 4E2FA 2JRZA 3DMGA 4KRXA 3L07A 4BNNA 4GVXA 4EGJA 1DAKA 2JFYA 3KV3O 2BSAA 3UAOA 4XD7D 2Z8YA 5LJIA 3U6BA 2VA3A 1RXIA 3AK4A 4ILEA 4N9WA 4MV6A 4WZAE 3L7BA 3VR3A 4GSLA 4MQLA 4QUIA 2XDYA 3HYRA 4ECTA 1Q1AA 4KX5A 1E99A 3O0TA 4KRGA 2HK9A 1NU6A 1OWMA 1N6NA 1E66A 4HSGA 5FOVA 4V1CI 1OZ0A 1TF7A 2AMYA 2XMGA 2GLEA 4I8XA 2AOWA 2VPPA 1JN3A 1G2PA 4BNTA 4JA0A 1PK3A 4L8FA 3TOSA 2XADA 3T5KA 1Z5PA 1LNZA 4US2R 5LP6A 5E6RB 1G8PA 3L0ZA 2NAPA 3DF9A 4ZCTA 3JQAA 3NI2A 4KR6A 5I7AA 1RQPA 3M1LA 1OAAA 5CJ7A 1ORIA 2FDXA 4MEAA 4S12A 1JLHA 1KJWA 1LC3A 9ICKA 1TD1A 4PANA 3U0BA 4M1EA 5BWCA 3COJA 2PIAA 3IVRA 1XDWA 2H07A 3O2NA 1X9XA 4LHEA 3RS0A 4D9CA 4DYHA 3BJMA 3JAKB 1C7FA 4ZEOA 2Z6VA 4XM2A 2NYUA 1BJTA 1JKIA 3FPHA 4A4DA 3AO0B 5FA5A 3PSIA 5SYAA 4XLTA 4FPXA 3I9V1 3P8ZA 4O5KA 3ORHA 2QSYA 4DLTA 1XYYA 3HP7A 4MHTA 1DHRA 1SR8A 3UUEA 4CM8B 1DFGA 1H5QA 1ZH2A 3M9NB 1GXSB 3HEMA 3RUPA 1PWYE 4N49A 3FKSA 2FG7C 3PO4A 1NSFA 1YZNA 3ANYB 4RKYA 4BCCA 5FP0A 4I2EA 1TXGA 3OWXA 4LXYA 3RBXA 2PV7A 3L6EA 5JPCA 5DM70 1X2EA 1FPQA 4CW7A 5JS2A 3I32A 2AZXA 1MRZA 1KI6B 2VPTA 4Z5XA 1RTKA 2NUAA 1ICEA 3OSPA 3BH6A 1ZQQA 4OJLA 2C2MA 2X5OA 3FSJX 5TQ0B 3RGGA 1YE3A 2AJ8A 1VDVA 3CLUC 4BFZA 5G0UA 1XKXA 2F48A 3L8YA 2BQ3A 4BGIA 4EI2A 4G1FA 4MOWA 1GGNA 1VLLA 3OKCA 5J2CA 2QN6A 3V2IA 4BEJA 4YCLA 2D0IA 3PSFA 4H1TA 3ZI0A 2WWRA 4E1BA 2VP3A 3PDJA 1E9SA 5AHRA 5JCXA 1Q0PA 1GA1A 2OHVA 5K05A 2VF8A 1M8FA 2NPOA 4HEJA 4F9FA 5KB3A 1YMUA 3RJMA 4I4TF 2H92A 3CWCA 3CLRD 3NBAA 3OUUA 3N58A 3GPBA 3IP9A 1ECJA 4ELVA 1RPNA 3O3CA 3P94A 4FS8A 2FN8A 4NLCA 4PCVA 2PUHA 3K9HA 3G13A 3WL6A 2AG1A 3C7KA 2DF8A 2G4LA 4MKGA 1CQPA 5TLSA 4DS3A 1JJIA 2IP4A 5KSPA 4DARA 1SU4A 3D6TB 1N2IA 1AVTA 4JSYA 3BBLA 2CE7A 1R16A 2C8LA 3B3QA 2PS0A 4DCSA 5FUWA 2GMWA 4X6XA 1D07A 4BYMA 4PJ0U 1S3SA 2PGXA 1R8SA 4PPQA 1XRMA 2HMUA 4HB4A 3G7UA 5CGZA 3WR5A 5T57A 4P34A 1YRLA 2I33A 5JCOA 1HYHA 1RP1A 3RTCA 3G59A 2IHMA 1LBHA 2IGTA 3RTBA 2P6OA 2R8ZA 1R0SA 1RSZA 3PICA 3W6NA 1N2OA 4X6LA 3OCUA 4ARIA 1TQ2A 4BBJA 4D8TA 4JC0A 1C1XA 2VP6A 2B5WA 3G9XA 2DUYA 4KJZA 2QTTA 5T6MA 4FXOA 1H0KA 1XXHE 2Y66A 1POWA 2I71A 2OBLA 4QPCA 5HDQA 3FAKA 3HACA 2EW1A 4BKRA 3KBBA 2A1AA 2J48A 1OC4A 3HR4A 2DWUA 3M3PA 3MT0A 4KAFA 4X91A 4LF7B 3A6LA 1ZQZA 1EVQA 1FP4A 4GX2A 4RLHA 1U11A 1ZRMA 3ZHBA 2A5GA 2RBGA 2ZR0A 3D8HA 4HWSA 3RBZA 4HBZA 1ZUHA 4WBXC 3QVTA 2AOVA 1QV9A 2IGBA 2WNIA 1JECA 5J0YA 1X15A 2ZB8A 1PSZA 3RRBA 3ZVRA 5B4TA 2PD4A 4BDSA 1S01A 3ABRB 2J0QA 3P97A 4NMLA 4PG4A 1RWVA 2V96A 1HNWB 1XEXA 4YRJA 4QC2A 2A2ZA 3DDZX 2CK3A 2FPOA 3GYGA 3R4CA 1T8WA 1KEEB 4WOPA 5GY7A 4LMAA 3KEMA 4IRMA 1NOJA 4DR1B 1Z19A 3TDMA 1Z2EA 4AM8A 3W5BA 2ORVA 5DK4A 3RG8A 2JVIA 4F71A 2IT1A 4ITVA 4NJ8A 1OPRA 2GEVA 3PLAE 4KV7A 1W34A 5LA6F 4QZFA 2GBPA 2YZKA 3FHOA 4OK6A 3Q2IA 4DEXA 5FBHA 4B6FA 3QHQA 4JEMA 1FXSA 1L6IA 2JNWA 4F4CA 2B6GA 3A3NA 3DAYA 3OJWA 5ALMA 4O3OA 1OCEA 2JASA 1YRBA 3HGTA 1HJPA 4HPWA 4AJEA 1Y6RA 4B4VA 3TD9A 2QVGA 5JJ5A 3RUDA 4A1FA 2C20A 4WLVA 5TGTA 7ICJA 2F3TA 2VDUE 1YZKA 5EGNA 1IC6A 3A0UA 3KEOA 3MTGA 4I2CA 3AR2A 2F9LA 3DVAA 3PTLA 2KJQA 4ROSA 4C5BA 2PZKA 3E7FA 4HLQB 2Y99A 1PT6A 3OJOA 1CY0A 3DOCA 2FSUA 3CZ5A 3IMFA 4IMPA 3GNTA 3P9YA 3GQBA 5T67A 5LZ7A 1S2IA 1CR1A 2ZS9A 4GMKA 1NJ8A 3SQDA 1RRPA 2HQSA 2XBUA 3CUUA 3IAM6 5F2OA 2KBFA 4I1SA 1A8QA 1OLXB 2G9QA 1XC9A 5EL0A 1NK5A 1D8YA 1GSHA 3SC2A 4DQIA 1OX6A 3Q2KA 1SXJB 3MTEA 4LTDA 1Z1VA 4NAVA 1XT6A 1J21A 3I6IA 5FWYB 1UEXC 3JRWA 3KT0A 4O4HB 1W36D 3F49S 2XUDA 4EY4A 3EA5A 3JYNA 4DLVA 4IVRA 2X2FA 4M9XA 4GMGA 4OQPA 3TG2A 3BQNB 4R3NA 5BUCA 1CB0A 2YIDA 3H1AA 4R64A 3EZFA 2IYQA 3OT5A 4JV1A 5F64A 3VGJA 4D9FA 3DW1X 5AIBA 3GO4A 5C0YA 1MF7A 1YCFA 1TF5A 4P2HA 1F2UB 2A88A 3BGVA 3DDHA 1XMVA 3K72B 4DIMA 4D3FA 1SXJD 1VIYA 2HQ1A 1N1MA 2D1QA 1O6GA 3AEKA 4M8SA 1NYRA 1W8DA 5AVVA 4JFRA 4URFA 1IN6A 3LF2A 4D5GA 5JROA 4NCIA 4GDFA 2I4RA 4PN7A 4BLRA 2QMHA 2C4HA 5KT7A 2IY9A 4CKWB 2VF7A 4QKQA 3PE3A 7GPBA 4W63A 3EGXA 3VNAA 3F8WA 5CM2Z 1ZMRA 3ZU3A 1O9BA 2D1SA 3CRNA 4EPTA 3IBGA 1CUKA 1ZZEA 2ZI4A 3NU1A 2I7XA 1RQRA 2IFTA 2I9KA 3BERA 4GWGA 4GPZA 4I1YA 4P4GA 4MI3A 5IAEA 3LFUA 3B6ZA 3EGDA 4C0QC 4QJFB 3M8SA 2OT3B 2JJMA 3LVQE 1Z5VA 5KC8A 1BE6A 1ZGJA 4QHYA 3TSAA 1G291 2I4LA 1B7GO 2WVGA 3GUYA 2EYUA 1WR8A 4BMVA 1WG8A 4AQ7A 4WLFA 4Q9NA 2KM1A 4PL2A 2A78A 4YLGA 2Z04A 1I6LA 4GE0A 4ZPXA 5G1OA 1UT5A 3TM4A 4UBJA 7ICLA 2DKFA 3DF7A 1B74A 1U9JA 2QS9A 1EFPB 2PZBA 2AG8A 3QKRA 2QI9C 1VGQA 2ZR8A 3E0QA 1W96A 4LMBA 3X0DA 2DPGA 4CEIB 3GV0A 4B3GA 2WHQA 1P18A 1GTG1 2V55B 3E8XA 3EN0A 4EHKA 1U65A 3PHGA 1URPA 4CN8A 4D81A 3WGVA 3A4IA 1F9AA 3KEFA 1IYZA 4LRXA 3SLRA 5BUZA 3VJKA 1RI1A 3R76A 3GUCA 4A16A 3C3BA 3OY2A 1U0SY 2QAGA 4DMRA 5BOMA 3B36A 2H65A 1P2FA 3REQB 3MYRA 3RVSA 2IMWP 1F60A 2BZSA 3GLUA 3ESQA 2D3WA 2WWIA 3FMGA 3HSKA 2JAQA 4Q00A 1HDXA 2J46A 4HDNA 4RWEA 2VWHA 3L77A 1AD2A 4YDQA 1R9NA 2E2WA 2Z2YA 1LPNA 3GLHB 4B8YA 1F8FA 1NQXA 2WIGA 1LDNA 1IHXA 1LQ2A 1XUOA 2GYVA 2PT7A 1NYQA 1IV8A 1L8OA 2OH2A 1RADA 4HJRA 4D3SA 1UPHA 1UBGA 2BGLA 2XWBF 3FCCA 2LWIA 2JF0A 3L0BA 4Y1GA 3K32A 1NP7A 4D1YA 2B2XA 4WXEA 3A6FA 1YVUA 4MK4A 2P2ZA 4EHAA 4F45A 2UUBB 5JS1A 3AVOA 3FCEA 4C6TB 1DGSA 4LV6A 2ETVA 2QP9X 3R74A 1EESA 4KWIA 1OX4A 2WSIA 2XQKA 1Z0SA 2EVWX 3B1YA 1UBCA 2HHCA 2P1DA 4YRIA 4AUEA 1A4RA 1Z7BA 2Z30A 4KVFA 3VU0A 1CX9B 1JDZA 2AGVA 4LF9B 3NVWA 2LUOA 5IDYA 1B4DA 4KOAA 2PRKA 4BGEA 4E11A 2O5EA 2WTEA 1NN5A 3RQSA 1M7BA 1OBFO 2OZKA 3K2QA 4AY6A 2DUNA 2Q6KA 4OJMX 2ZIUA 3SR3A 1DADA 1Z0JA 1TMKA 2MINA 3EPIA 4M3NA 2PKQP 1ZK2A 3BRQA 5EJMA 3KQMA 1JILA 3RHZA 4RK4A 1WD5A 4FYXA 4RZIA 2CBGA 3LHKA 2FPPB 3B1KA 4KBYA 2Y4NA 4JBWA 3H40A 4I1RA 2E4WA 1TZMA 1U2PA 2MSCB 2XBLA 2P6PA 4Z1MA 4EHNA 4KR7A 4YRCA 1E4EB 4CIXA 2RBEA 4ZHQF 3IMKA 2WM8A 5K0LA 3UOAB 1YFZA 3TPCA 5FA6A 3EISA 4CFYA 1P7PA 1PO7A 4IIJA 1CS4C 4E6EA 2WWXA 4OHMA 4RGYA 1QRTA 1QGYA 2AKAB 3USZA 3LX6A 3QPUA 2F77X 2ZSIA 3T5GA 2LPMA 1OA1A 2H1OA 3UGQA 1JR6A 1CG6A 2FX3A 3FLMA 2MYUA 4A73A 3UC5A 3WISA 3WSVA 3GCGA 4V0LA 2WJ6A 1HLDA 5LA6A 1QRUA 4QM6A 1YDMA 16PKA 3SX2A 2JI6A 1ANKA 4EAAA 3OIDA 4OBEA 1M3SA 1SU7A 3AFNA 3FWHA 3PT9A 4N0QA 4OJPA 3TQSA 2E0IA 4XGIA 1SL1A 1XU9A 2HVIA 5CDFE 2DWQA 1YBFA 4IUBS 3W90A 4NHEA 1FIQA 1Y5RA 3QJGA 2VJQA 4CKBA 3PNQA 4PSDA 4YCSA 2WB2A 2FE9A 3O4JA 2F2TA 3FVVA 2ZIXA 1USWA 1TQ4A 2M1XA 3EDRA 3FCAA 4JL5A 1BA3A 4RHFA 1RWPA 2ZYIA 1KI3A 2QM3A 4RO0A 4Y18A 1WCXA 5EG5A 4C2BA 1KORA 4Q12A 5CAEA 5KYKA 4DIDA 4R2WA 3LSYA 4A5OA 2VJLA 1ULZA 4E1AA 3HB4X 1O03A 5K9ZA 1QM5A 1IEXA 1TT5A 1I13A 2V54A 1ISIA 1VLHA 2C2YA 1OXUA 2C4NA 1QX3A 1CR2A 2FVYA 1JF8A 1LB1B 2Y6VA 3J7TA 1Z75A 4JOCA 3LC7O 3TFQA 5EZYF 1LZKA 3BHIA 2B4RO 2GCIA 3T5JA 3S1AB 5AESA 2I91A 1JHAA 2GB4A 2YJTD 1KR5A 1YDEA 4IWXA 5A4DA 3W6PA 3PFIA 1JYEA 2WABA 2Q4TA 3I09A 3IT0A 1WXQA 4QU0A 2P8SA 4RZ3A 4F4FA 3KXIA 2QB0A 1IG6A 1X7DA 1PLKA 2FZEA 3IUBA 4QD3A 3SQNA 1VCOA 1K5OA 1T0BA 3FA2A 4C05A 4X65B 3N7UA 4MWOA 3ZZ0A 1P81A 3I6MA 4GC7A 4PO3X 4LY3A 5J0UA 1ID1A 4DFJA 1QH1B 3ZXUB 3QRWA 3D3NA 5GTHU 2Y0SF 3ZVMA 1QPBA 3ZIAD 3FE2A 4ND8B 5F2NA 3OUTA 1N36B 3MTBA 5C1BA 1DK2A 4DYVA 4I2GA 3CR7A 3EODA 1TECE 3IAEA 3U1VA 3NWJA 3PI6A 4M6WA 1QG0A 4G9EA 1JG7A 4Q9KA 4XLZA 1OH5A 2ZYVX 4BO9A 3HE3A 3ZWXA 4PXSA 2AIRA 3WLRA 3UT0A 2N46A 1LTQA 3K75D 2Z8YM 4OUKX 5SYNA 4OQEA 3RG2A 1ORWA 3PBKA 1M0SA 3EYWA 2BV3A 3H87A 2ORYA 2I3BA 3PHCA 4P53A 4Q3AA 3KTAA 4MPPA 1GKYA 1R6UA 2DZDA 3T5CA 1TV9A 4DA9A 3M5CA 2CL6X 2W7OA 3L7OA 2ZU6A 1BS9A 1X1BA 1VA5A 4FW9A 4G09A 2ZWIA 1G8HA 1U02A 3KRTA 3Q40A 1XWWA 2QDXA 5AM1A 1QIKA 4MAFA 1FP7A 2C9ZA 2YXNA 4HAYA 5EQTA 3TUZC 3ZBPA 1U0NA 1V11A 3FUTA 2O50A 1T3GA 4EB6A 3JU3A 1XD9A 3BJRA 5KYXA 3U7FB 3FDSA 4PZOA 2R5FA 3EAQA 4EG4A 2B8EA 1E1CA 1NRJB 5L3QB 3F8TA 1DXQA 1QBKC 3R6LA 2BFEA 2J3JA 1MAAA 5DW3A 2KX7A 1BXKA 1ZICA 2XNSA 1MOSA 4CF3A 3LP6A 4IYJA 4J2TA 4OAQA 4TTTS 4KQEA 3ZDFA 1D7OA 1QF7A 2YV3A 4KWEA 5DKFA 4MYTA 2Q8PA 3IBTA 1F2TB 1TOAA 1ZN7A 2Q6OA 2NU9B 3OEHA 3F7OA 5FH9A 1O57A 3UF0A 3OD1A 1GRNA 4IPTA 4J3NA 1SZPA 3ROKA 1DPFA 1RKUA 1L9XA 2I2FA 1UC8A 5CH8A 3ELUA 4LK2A 1QHYA 2VBGA 1J09A 2H57A 1HV8A 3EZ9A 4H3HB 4H1VA 4TL8A 1EM6A 1UMCA 2VRBA 4HTFB 4LQDA 4P7KA 3NVAA 3PDCA 2KLHA 2F1IA 2A58A 4KQIA 4KDRA 4LCBA 4O4LF 2FZKA 3BXEA 2RHCA 5GP1A 4DLUA 9MHTA 4RMGA 1XQYA 1QG6A 2VP2A 5CEJA 1GQQA 4LXXA 5IN5A 1I3OA 1L1FA 4Z86A 1DAFA 3ABZA 5IBRA 3RK1A 2C4MA 4ZEWA 4BNGA 1FMCA 4V39A 2BC9A 4MR7B 4LGCA 1YQUA 4G4GA 1HE2A 4RY9A 2L2QA 3L8HA 2GPSA 4YRLA 3S5UA 4BZWA 1YHYA 1CE8A 1TYZA 3NRZA 2O8EA 1TUEA 1E9BA 3DL7A 4C0HA 4AMUA 5LQJA 1AUVA 2J33A 4PF1A 2M0NA 2V5AA 3JR7A 3SOZA 2O8DA 4LRTB 4U2EA 3QVKA 5MGBA 2ODQA 1LX7A 5EYPA 2FMPA 3C6YA 1KWKA 3MCVA 3R6WA 4U7JA 3HP4A 5BQPA 1K63A 5TR9A 3O8CA 2ZJOA 1R4AA 3SS8A 4IJKA 2O8FA 1R5BA 5IJ9A 1NURA 3WLKX 2XB8A 1D4OA 2W2MA 4F5NA 1YMQA 2QR5A 2X9GA 3GC6A 4XWGA 2D74A 3BXZA 4EMUA 5IZCC 3D54D 4B2PA 3TAQA 1L7BA 3G02A 4DLBA 2ZS7A 2HA3A 2K87A 3VKGA 3NAZA 3PUKA 2W48A 1MKYA 4JX9A 5DT2A 1H2FA 4E08A 3BMQA 3IJ5A 3IPYA 2GBFA 3UMFA 5B58C 4PYMA 1YONA 3TEJA 5D00A 3A0BU 4BP9A 5JAHA 1Z9BA 3A3OA 4LWPA 5T8KC 1UM8A 5KYGA 4RENA 3AEXA 5LQNA 1BCSA 4DJAA 4QZHA 3VDNB 3A3PA 1IBMB 2XRYA 1O96A 4J91A 5L3ZA 1GTZA 1YZYA 1OWOA 4MVJM 5DG8A 2J9ZB 2OV8A 3Q3CA 5GQSA 1SKUA 3NUGA 3E4DA 2YHIA 5E1MA 5H9VA 2VZEA 1XTJA 4YBZA 1C0KA 3EEOA 2D5CA 2O5RA 4DHEA 2OHIA 2OXOA 9ICSA 4XJVA 2B78A 2IPMA 3A6KA 5EFZA 1BIFA 1USGA 3O9ZA 4WERA 4OP3A 1T0UA 4WN3A 4C87A 4FGLA 4ZJPA 1YFLA 3DNMA 3A4YA 1NR7A 3AG5A 1SBNE 5FUYA 3B9QA 5DBFA 5TB5A 4N82A 5EKDA 1FX0A 2W2QA 3D6VA 3SZRA 3ER9A 1KHTA 1VHJA 2JH9A 2IYAA 2D0PB 3IIEA 1Z35A 5F21A 1MJNA 4B6OA 4UB5A 2O8DB 3EXAA 1RKQA 1ZYQA 5CB4F 3SJCA 3T15A 3WGUA 2MR6A 4FGJA 4JASB 4KN8A 1SBTA 3RS4A 2B6HA 2ETXA 1OC2A 4IO0A 3QOYA 5AQEA 5FOXA 4DUYB 3UMGA 3C48A 5F1KA 5TS2A 4MR7A 1JR4A 2CB9A 3JD1A 4C21A 5K45A 4F5QA 1EVZA 4BMOB 1Q2XA 1M34B 1SPXA 5KFUA 1VE1A 2QQEA 3I2YX 4LPKA 1M5TA 4BO4A 5I7HA 2G77B 1V38A 1QGOA 1SUIA 1T2UA 3LDHA 1TGYA 1V7ZA 3V2GA 4DWIA 2OK8A 1EM8B 2O4UX 2NNWB 5K1ZA 1X74A 1X9HA 1B00A 9ICJA 5EFOA 3ZJ5A 3GLRA 3MINA 1KDYA 2VSXA 3T1OA 4D8XA 5MN4A 4LPSA 1BDMA 1FX1A 1SN7A 2DFNA 3LG2A 4KFSA 4P3YA 4P98A 4PBRA 4QGBA 2FSIA 4M60A 4TWJA 4JMPA 4W7IA 4DMMA 2LBPA 5K20A 4TL7A 9ICLA 2JLXA 5EA2A 1RXCA 5L3SB 3DEEA 2OHHA 2VUUA 3WAGA 3R5SA 4RBNA 1UXOA 3TQRA 1N1GA 1L7VC 2QWXA 4OXQA 1RYBA 2EZ4A 2V6FA 4MYSA 5KVVA 4YTEA 4QU5A 3V72A 3D4LA 4YPVA 3ONWA 3GGOA 2IU3A 5HGJA 2H06A 1WIWA 2QTLA 5JALA 2JBWA 2RP5A 1E1RD 4PC1A 3SBDA 2BFEB 4RZXA 1Z4PX 6PFKA 1F0KA 2ATIA 2HHXA 2Y2UA 3VH4A 3K5HA 3TNLA 4V0SA 5BSKA 4KLSA 3UJ3X 3GLSA 5MN5A 1N5WA 4EY8A 5KL8B 4I2FA 1Z74A 4CLEA 4LF5B 1A3CA 5EVJA 1ODLA 3QU9A 1QOPB 3MFIA 3H42B 3U4IA 5IZCA 1QTMA 1ZLYA 3D4NA 3DXFA 3E9DA 3ANLA 4BO8A 1W36B 5ERYA 2O14A 3H6GA 4CG0A 5C8YF 5D49A 4NZNA 4MA4A 3OPQA 2Y1XA 4ZVQA 4D4MA 5JADA 3KDSE 2LMRA 4RZUA 2DWOA 1X8KA 5AM0A 1A9QA 1OUMA 3IPRA 3OZCA 4TT3A 4AMBA 4EUNA 4HK4A 1C4XA 4MW9A 2QE7D 2PZJA 2WFZA 3OZSA 4N47A 4YIHA 2FSVA 1GG8A 2C99A 2PSSA 3E53A 3D02A 3KTAB 3LHDA 4C6HA 3FWYA 1PQUA 1NXOA 3GOQA 1YS1X 3QU7A 2HREA 3IAAA 3VXKA 1T3NA 1OYOA 4X1IB 1RWBA 3RS9A 3G2KA 4BRZA 4OLAA 3RIXA 4HG2A 4OQ4A 5CXXA 1WDLA 4GNRA 3LL7A 3N0RA 3IEPA 1I1NA 4DZTA 3W3AD 4XX0B 3T7DA 4HWPA 5DPMA 1ZD9A 2JLZA 1GLGA 3PYXA 2EX0A 3AM5A 2H3ZA 2NO6A 4KXFB 1B6SA 2RGBA 3W4IA 3R0JA 5HQTA 4L72A 3WB9A 4PTZA 1JB9A 1GARA 1X94A 3M9XA 1I7NA 2BHRA 4L16A 4LXGA 4BB0A 2H2HA 4FYJA 3U7QA 4NE2A 5FF9A 2ADFA 4CM5A 4UNRA 4Y2RA 4YRMA 3OJUA 1FQJA 3PY8A 2NO7A 4LK3A 9ICEA 5DGBA 1YQGA 2XE7A 2YASA 3DE3X 3P20A 2QB0B 3D4PA 4YEDA 3M8KA 5ESXA 2QE6A 3ZHYA 4A2CA 3KSBC 1P0CA 1JR2A 1IVYA 1B8OA 5IKOA 3TE7A 3IH5A 3RIYA 3G9TA 4MWBA 2WSLA 2Z2IA 1T0HB 2ZSBA 3DR5A 4ON9A 5FRDA 2KTQA 4B40A 2VPIA 3F90A 1C9KA 5IWAB 4XUEA 1A7UA 4YROA 3AW8A 3TCXB 2FMFA 2RGAA 5D3QA 3JD3A 5KFLA 3KE9A 3AF3A 2J5RA 2G1JA 4HAUA 3WKDA 1G6Q1 4DVGA 4S05A 4FKBA 5KO2A 4TYWA 1IXSB 4PLHA 5CAEB 2ZVDA 3AM4A 2QPLA 5ALVA 1VSVA 3HDVA 3QA9A 2XGSA 4II7A 3WWDA 1PQYA 2VT7A 4NULA 3IR6A 5BYBA 4C6SA 1CZHA 3QWFA 2EX1A 1IRIA 1ZGAA 1XWLA 4FZLA 2B2CA 3OWHA 1N0WA 2P4SA 4AECA 2QN2A 3PYMA 3RFFA 1XP8A 1Y9EA 4D4KA 2I4IA 3C7DB 5JD6A 2GK3A 3D9QX 1U2GA 3ITEA 2W2KA 3K20A 4GICA 1L4YA 4Q7JB 3JS5A 4CKBB 1RVV1 4KMMA 3TSWA 3T5PA 5JO9A 3AL0C 9LDBA 3CE9A 3QPWA 1CJUC 5EP2A 1P45A 1QIGA 1KVSA 8ICBA 3PFKA 2Q2WA 2OEHA 1DT5A 3GPIA 2XGJA 4J9SA 3NM4A 2EZUA 4LJLA 3DFUA 4Y6LA 5TPWB 4ND6A 3TZ6A 3W34A 1JLKA 2ID9A 3O2QB 3QLJA 4GC9A 4H4EA 1L5WA 1RKVA 2FEAA 5EMLA 4CQJA 4WNYA 2FJUA 1GPUA 3I9KA 3BD6A 4H7JA 5LZ9A 1PVPA 1NNLA 4IIJB 4V3BA 1F4VA 3E3OA 2BKVA 4FE7A 2C2RA 3EZLA 2G82A 3P2EA 5JBIA 3WOVA 5DTEA 1VLBA 1SU6A 2VDOB 1ZH8A 2R8BA 4JLBA 2ZXHA 3CNLA 4JEUA 2KVCA 1E4EA 2C5SA 2JL1A 1P5RA 4BL5A 4TWZA 3RVJA 4D0RA 3B1JA 3PVSA 2OXEA 5LNK1 3MCWA 1BHJA 4DT1A 3KTQA 1OI3A 2P3QA 1KPHA 2H0QA 3GJ4A 4BJ6A 4M9LA 1FJGB 4ITUA 3CV3A 1W4ZA 1KR2A 3OMXA 2JVJA 3NGLA 4MRNA 4I66A 5JSFA 3BKWA 3N59A 4TM7A 4BMDA 4DA0A 1IQPA 1DBWA 1RAAA 3F1KA 3TBKA 1TCCA 2XY7A 1KFBB 3K7EA 5J2GA 1VDZA 3CGWA 4WPGA 3PR3A 1MB4A 2IXAA 4QG7A 2VDQB 1TK9A 3IHLA 3VI4B 3PPYA 1NTRA 2BELA 3C6ZA 4X5OA 1S8FA 4AWXA 1PEYA 1T26A 4CIDA 3LCUA 4RVFA 4B82A 2BD0A 2Q45A 4D46A 3AU8A 2PL1A 3W4JA 3ZI7A 3NS1A 1GNTA 3LPLA 4URYR 2ZUFA 1UWVA 1A76A 4URZR 5C53B 1I6KA 4YMLA 5B3KA 4WI1A 3T95A 1EHYA 2DU8A 1KAGA 4FCWA 4V0OA 1BAPA 2ZZKA 4R8KA 4E46A 3ZWWA 3H5IA 5EJFA 3QVGA 2H8GA 5FJJA 1KK2A 1LXCA 1GPNA 5CT4A 3TSOA 1J56A 3VX3A 4KO8A 4C3UA 4D9KA 4DMLA 1AXRA 1UT6A 5JDIA 1WETA 1U0OC 1GNPA 2IZ1A 3W9UA 3ZWMA 1I2ZA 2ZSAA 4JL6A 2B8WA 1K5DA 3STXA 4DWWA 3MWDA 4HDNB 4PLWA 2DPYA 3GPLA 4NZMA 5DYYA 5LN1A 4KLFA 4R0NA 4MKIA 2QXYA 1YI8A 3DOUA 3AEVA 4FN5A 3REQA 3ZTWA 3ZWPA 5TNXA 3TRFA 4D9HA 2YX8A 3ICOA 3A9VA 2Y1GA 4U5QA 4ZHQB 5ECWA 1N7HA 4YH1A 3N7SC 1Z08A 2IYTA 2QT0A 4J0IA 1RHRA 3QI7A 3CH5A 4LDRA 4NH0A 4RE6A 2DMRA 3PRYA 1CQJB 3FDFA 1ZJWA 3CF2A 2B35A 4IJ6A 3GNQA 1TF2A 3BMOB 5BOSB 1QYVA 3MUNA 1EFKA 2ERXA 1RI5A 2O8NA 3OE4A 2QSZA 4H7DA 5B6PA 1I30A 5DNVA 2QTAA 1WZCA 2FW7A 2OVFA 2QZPA 1VJTA 2GD0A 2EFJA 2WTBA 1U9IC 3ZKAA 1NBME 3ESXA 1NSYA 1EVLA 2BMDA 1C8VB 4BO1A 2E1RA 2MWMA 3L93A 3L7JA 4YPFA 3JD0A 4RPXA 3FAHA 1MFPA 2V65A 3PHHA 4I5GA 4KWCA 4XASA 5TT0A 2P90A 4LOJA 5JNTA 4BCBA 1QIJA 3DDWA 3BQ1A 2G1AA 5LB2A 1IG3A 2P6RA 2FP3A 3JYLA 4L5IA 4EYEA 3B13B 3IP3A 5CNKA 1IBKB 2OKCA 3EGDB 4NYJQ 1IWPB 3AZPA 3BD8A 2J3QA 3H4BA 3CLSC 4Y1EA 3ZCQA 3L1IA 1BROA 4M0EA 3ZGZA 2FEOA 2OCLA 1K4KA 2JI9A 4MVJA 4CCHA 1CEXA 3ZYZA 5HXAA 3PPXA 2Q3BA 3UAZA 4GEKA 1IL0A 4CHTA 5C7OO 2A9OA 4HADA 3QNWA 4X7MA 1BYIA 4PU0A 4TWAA 5CIYA 2IH5A 1G6KA 4DSIA 3MLEA 3AEKB 3SV4A 2LVBA 4JGGA 1GAQA 4X3PA 5E2IA 1XNSA 3WG9A 4B6SA 5MF6A 3CMMA 4TQGA 3V7UA 1KO1A 3M9WA 4OHUA 2EJWA 1KMCA 3NIBA 3SXPA 3ZU6A 1OILA 3H1GA 5JJLA 5C4MA 3ND9A 4RCZA 1DMRA 2I03A 2VHVA 3C1UA 2Y9PB 3DE6X 4PZPA 4R9VA 4U2CA 3RF7A 2REXB 3K0EA 4WZAA 5IMSA 4QDZA 5FFMA 1KPIA 5C37A 2PMBA 5KQGA 3O9MA 2J4FA 4E5SA 4BRWA 2RAUA 4C3VA 2AH5A 3MOIA 5HNKA 2WLSA 3H9EO 3HV0A 4O4HA 2B94A 2GZHA 1T9DA 2JGLA 3RV4A 1CULC 3PNVA 4O29A 1SXJA 1LJUA 4FQ7A 1XJCA 1KQQA 1JIQA 1VMKA 4DOAA 1OLXA 1KIFA 2IP1A 2K4EA 1PJ2A 2H29A 1M1ZA 4I9NA 2OWOA 1KBUA 3WLMA 3BTUA 3FYTA 1PFVA 1G7TA 4NM1A 2VK8A 2VXOA 3FTQA 4X1YA 5CW1A 1KSFX 3SZOA 5EXXA 1SURA 2DRIA 4ACBA 3U3XA 4X00A 5I6DA 1J9EA 2HEGA 1UOOA 3OFND 2GCGA 5EEGA 3AB7A 4F1JA 4KN4A 3N2GB 4NI5A 2G6BA 3RIGA 5TDHA 2FETA 1X42A 5IK2D 4BWYA 1NPDA 3SX0A 1ADJA 2DUJA 2P77A 3BOSA 4OHVA 1ZN2A 2D5AA 3F2IA 2I1QA 4NU8X 4PBSA 5FEMA 5HTKA 2IELA 4R0MA 5FAKA 1TCBA 5SZKB 4N0EA 2HIGA 4LE0A 1K68A 2CYCA 3AUAA 3KPUA 3DZDA 3N76A 4I2BA 3K1JA 5J4LA 3AZQA 1PSWA 1RJWA 2BM8A 4M8NE 5ENZA 4QUGA 4YMOA 2V7QA 4JH0A 1TO6A 4TV8F 4W1PA 4RQ3A 1AZTA 3F4KA 4IH4A 3WLSA 1EH5A 4QASA 1W36C 1N4DA 2P78A 4BFVA 4E5VA 4IIDA 1RCFA 2WUWE 2XY4A 3EAFA 3KYDB 1XEXB 4FNGA 4MW4A 4O8ZA 1ESMA 5EZQA 1E0SA 5KQPA 4BQNA 2P4HX 2Q6IA 1X13A 3LV8A 4KKXB 2OZLA 3RIHA 3RYTC 4QGSA 5BN1A 5C5CA 5KG5A 5L1MA 1YJ8A 3DFFA 3SYRA 5J4KA 5KSYA 1FS6A 1X3LA 1H69A 2HB6A 3P0HA 4KP7A 1UFKA 2WMNB 1D0IA 2HRRA 3HO1A 4KPYA 3VM6A 2IYEA 4X61A 3BAFA 3LGAA 5SY9A 4EPYA 1DIRA 4IICA 3S8YA 4RD6A 3QNUA 3UY4A 3GARA 3T7JA 4JWKA 2F59A 1N0IA 3H2GA 3K1AA 1BOFA 1NRIA 1NVDA 3E48A 5TF0A 5JSHA 1TTTA 4K2HA 4TKUA 1C1XB 5F5NA 5ALTA 1UFVA 3IN5A 1WUTA 4RESA 2IOHA 2WRZA 3N28A 3K5WA 4MVYA 1PJZA 4O4LB 2XWJI 4S3MA 3VH3A 1PK9A 1BEUB 2WMDA 2DHCA 1L3UA 1KDOA 4H7EA 2IYXA 5KFBA 1MQ3A 2VTBA 3OX2A 2PYDA 4U0JA 2QLBA 4ECWA 1BRMA 2WJ3A 3FVWA 4W99A 1ZR2A 3GELA 3UAGA 4M76B 1XLWA 1IIBA 3HB9A 3JTEA 3UEOA 4AIRA 5KKAA 5AVTA 1ZVJA 4AJJA 4ANFA 3C4QA 2KZ3A 3ZDDA 1NUQA 4Z0HO 1WL8A 1CYDA 2CFTA 2QSJA 2XTZA 3DH0A 3EAGA 5KMGA 3U3DA 1K6XA 3VR0A 1V9CA 3KC2A 5L4NA 1G5QA 3OFJA 1M2NA 2CFSA 2ONZA 4N1AA 3GFFA 2WWVD 3ES9A 1TM4E 1M1YE 2CE2X 4DF3A 5IVIA 4DQLA 2WUDA 2B5OA 3D8RA 1N9GB 3L1HA 3M5PA 5H3HA 2FPUA 3CRVA 2A59A 3HKDA 3H97A 3AOEC 5CT9A 1RLMA 3T3IA 3GDGA 3MQ2A 3U19A 1HNXB 4P36A 1LEHA 3I9FA 5LYYA 1AN0A 5KTOA 2V1UA 2CLDX 2UAGA 4E2XA 3MT8A 3RK4A 1U28A 2YFHA 3O1HB 1SB8A 1E3MA 5DHQA 4N5NA 3EMKA 3OFNA 3ONVA 3IG5A 3O74A 2W03A 2X8LA 1A97A 4Z8XA 3SEZA 1X7XB 3L18A 3RR8A 1DRVA 3JARA 1BPBA 4JLAA 5F5XA 5TQ0A 1QO0A 1R4ZA 1YJBA 1XBTA 2B1IA 2P9YA 2ISCA 2FUKA 1DLJA 2ET6A 2NUAB 3ZQ6A 3I04M 4DCVA 4B6EA 2PIDA 3LP5A 3PPWA 4HNAA 1OUQA 4DA7A 4XA5A 1N6OA 2ADOA 3U6KA 4WVLA 1RC8A 2EWMA 3T3GA 1K8RA 7ICIA 2PI4A 1M75A 1QIIA 1XG5A 1VYVA 4DL5A 1W8IA 4C8OA 4C1NA 4P4OA 1SM4A 1X6VA 2LDBA 3CY6A 1I5OA 1PR2A 3THYA 2QVYX 1RJDA 2UZ3A 1XRPA 4LWQA 2OBFA 3BAZA 3KHUA 4KUGA 1GXSA 2IKSA 1USUA 1CUUA 5J5AA 3IDWA 4CM8A 1MIOB 1Q0QA 3OFKA 4DXHA 4OB8A 5KWSA 4A23A 2GLXA 1A1VA 4LRUA 4AVYA 1TTPB 2VC2B 1XQVA 1FDSA 4BB6A 4CPDA 1C1DA 4LEIA 2WU4A 4DIKA 4MDEA 4RIEA 5DBHX 1JG3A 2WDPA 5TS3A 1D2EA 2J3DA 3LC0A 2PMKA 3N74A 3MJFA 4I81A 1Z2PX 2ZJ2A 1H2XA 1Z4JA 1XF9A 2AA3A 3JAKA 4JHLA 5HKOA 3RHTA 1P5JA 4LI3X 4G0NA 3DBRB 5CDGA 4ZZ1A 4OL0A 1QP0A 2XIDA 2JGJA 2X4LA 3H8MA 4BXOB 1ICIA 1BJRE 2QUJA 4S1WA 4RSMA 5AW6A 1BW9B 4XGKA 4ZU3A 3HX0A 5EWJA 2CC2A 2ZI7A 5JH7A 2A4KA 3JQAB 3C74A 4BFSA 3D5EA 1ZJ5A 3DDSA 1V1RB 5E6RA 1MB3A 4Y2UA 3PUHA 3VC8A 1VPVA 4OUDB 3ESCA 5BT9A 3UW1A 4ND7A 5J2FA 4GQAA 4R31A 4EQ6A 4FHCA 1V95A 2VEDA 3WK7A 1MX9A 4MS4A 1V16B 2QU8A 2W2XA 1T91A 5ALLA 3UCXA 3RTVA 1IOVA 3K2EA 3QW2A 4MP6A 1Q6ZA 3KOUA 3T1QA 1EWYA 3KXKA 3UQ2A 3HA7A 4YK7A 5K8LA 3EEIA 3RWMB 2D1TA 5H2FU 1JRLA 2VEOA 4B7ZA 1U0JA 1KBQA 2JLYA 2K8AA 4Y1RB 1SXIA 3RTGA 3QLVC 4NPHA 2ZPTX 1J1ZA 1PFWA 3LX5A 1IBLB 3ZPXA 1Z12A 1E77A 2FUEA 1X7WA 2VUIB 3KUXA 4RACA 4DCGA 5K8UA 5K5EA 2JW5A 2XB2A 2QG4A 2BDTA 2O1WA 5LP1A 3OQBA 1VBFA 2WTNA 3M6IA 5FI1B 3SBOA 4BFLA 1U0RA 1Z5NA 1T2EA 3A10A 3CZ4A 4QBKA 4QT0A 4EQZA 3NDBB 2IEIA 2RI1A 4JYAB 2SCUA 3GLHE 1XQ9A 2K7ZA 4TSKA 3W2GA 1L4LA 2QT9A 3FPBA 2PO5A 4NC9A 3DTVA 2PAAA 4PG5A 3EIUA 2FPKA 3MTAA 4TVBA 3S0JA 2EZ9A 3SR4A 3ETEA 4JBHA 4IIHA 4L5CA 1OX5A 3VU8A 4L0MA 3SE0A 4CMIA 1SVIA 5AJWA 5D84A 1XSLA 5BV7A 1EFDN 4J9OA 1S8OA 3JASB 2GOYA 2Y27A 2XD4A 3ZU4A 1Y4AE 3VPBA 3C1YA 3LWLA 1Z56C 5IEBA 4J9QA 4FBTA 3TEFA 1R15A 3IAFA 3WFIA 4I4TA 1OOEA 2XZOA 5KT4A 1HEIA 3U3OA 4B7AA 1K3FA 1X9GA 3GD7A 1UKYA 2DQKA 2J0UB 2JFGA 2H16A 3ZS9A 4OHWA 2B4KA 2J6HA 4QJIA 3JPOA 2VXCA 1X2BA 2G25A 1ULHA 2VJYA 2NRVA 4G0XA 4I2JA 2ZJYA 2JGNA 5AUQA 3OAAA 3CLVA 2JHAA 2WHRA 2CL5A 3TKAA 4U2BA 2EHJA 3CE6A 3ESAA 4J1TC 4L7VA 1Y3HA 1I9GA 1GA6A 2DVMA 3L7AA 4Q1BA 2YJNA 2GK4A 4FYYA 5DCLA 4EFNA 2ZRKA 1NK7A 1U3GA 2HQRA 2REBA 4BNWA 1I6MA 1XKTA 2AB0A 5IU6A 5J0XA 2G5PA 3A31A 4GZ5A 5FIUA 2FLPA 3CYFA 3HJUA 1I4OA 5EXTA 2JEFA 2O2IA 1TK5A 4OHKA 5FBQB 1GTSA 5B1EA 3G0GA 5KOHB 3KG2A 3DMFA 4KPEC 5EPUA 3IBCA 1Q0LA 5TV2A 2TMGA 4XD7A 5JQWA 2I76A 3H19A 4BZXA 3ZTYA 2C2BA 4GGPA 4YJ2B 3ZV6A 1W87A 1J2TA 3BZCA 2IW3A 4XTRA 4IHKA 3TX2A 1UZAA 3P96A 4IAOA 1CI4A 5HZGA 3I6QA 3JVIA 5EKSA 2BI4A 3NC1C 5JVDF 3L0PA 2P91A 3R0VA 4LNUB 3PMNA 5CLGA 3H2IA 3JATA 3WBFA 4C20A 2V6BA 3H0EA 2X0KA 1NJ5A 3SAHA 1IATA 2J6TA 3EE6A 4KQWA 4BO7A 5KTMA 1U2TA 2UYOA 3BWDD 2WILA 5AXBA 1CUSA 3GPCA 5IJ0B 3ESRA 2ZJ8A 3EPHA 4FDMA 4UCFA 1VJ0A 6NULA 1QP7A 2XTNA 3HCOA 5AR1A 1P7DA 3L7YA 4NFYA 5DYNA 1LCIA 3LMKA 1DRJA 2YH2A 2ESEA 1QK5A 3VC3A 3VO2A 1ZW6A 2WWYA 2EFCB 2O8EB 4G89A 4F5DA 3OZRA 2KICA 1M6NA 2MU1A 4FYMA 4KACA 4YONB 3BIFA 4Q3BA 3WWCA 4DB2A 1HDCA 5CVTA 2E5WA 3HH8A 3D43A 3TW6A 4B3IA 4IRKA 4QUJA 2CVOA 1L3SA 3SZLA 4YI3A 4C8NA 3OOSA 3CLHA 4J2OA 1PG5A 3GFQA 2HUNA 2BUBA 3C3DA 4FYHA 1AUPA 4O9MA 3MFHA 4WGFA 4EFLA 3LT5A 3SGLA 3VOTA 1JNYA 4A0SA 4QYTA 3COZA 4AS3A 5KVAA 5JS6A 4RPGA 5KNBD 3PCXA 1Y5LA 3WZMA 3JSAA 5M3BA 3VGPA 3A27A 4IC9A 4ABYA 4YMNA 1ESDA 2JHCA 4HQFA 5CTAA 3T1NA 1FFGA 2E85A 1FC0A 4BNJA 1Z88A 2WJAA 4P08A 4QEZA 1BA2A 3T54A 1KFDA 1LW6E 3DV2A 2WZQA 4L8VA 5AVRA 1OFIA 2ZM6B 3RSSA 2C5HA 4L2IA 1N5KA 4G65A 2G5GX 3LFTA 4Z9BA 3SHTA 3HZZA 4LXIA 4ENVA 3IO5A 5CCEA 4QWAA 3INNA 1RZUA 4JI8B 3IHWA 2E1FA 1DU4A 1DQNA 4M49A 1CEQA 1Y8RB 1RAHA 3B8EA 4NM2A 4GI5A 2KHQA 3U4GA 2MTBA 3C6XA 2O1XA 3UT5B 5DQGA 2ACVA 4PLFA 1KE1A 5BR7A 5JAPA 4WL0A 1J2JA 2YNMA 3K09A 4P3NA 4BLSA 4BX2A 4OXNA 3Q6NA 4G8CA 3SHWA 4LY6A 3TQCA 3QUCA 2PH5A 2R4QA 3MLBA 4Z2YA 4LY9A 5ADVA 4OGKA 1R8JA 4FYPA 4V0QA 6GPBA 3IXQA 5CA1B 3RJIA 4BFTA 1LI5A 3MMZA 3ZK9A 4I1UA 1KI2A 3QPCA 4HAIA 3QVUA 1Y6FA 1HNNA 4E2WA 5KAFU 1PGPA 2JATA 3QPBA 4WKGA 5I9MA 2JFFA 5J0TA 2DBVO 3QWIA 4INJA 1KH3A 1FDOA 1TD9A 4LX0A 2AXPA 4Z4IA 1FL9A 1N0UA 1SQ6A 4WDRA 1R0KA 3HVKA 3I2IA 2HDOA 1FSGA 1ADCA 2E4AA 4I36A 1PTJC 1I2DA 5CA7A 1PV1A 1R3UA 5BYKA 5GZ3A 2BFFA 2BEVA 2CCKA 2G3YA 4ZH4A 3K92A 4ZZ3A 2ZZMA 1AT1A 5IULC 1XHFA 4RS4A 3G7NA 4TUYB 3GFBA 1B26A 2WJHA 3ZXIA 2XXJA 1ISSA 2EKDA 2Q9AA 4GC5A 1UM9A 4TYQA 3KCNA 1NXTA 3E9NA 1EG2A 1MB0A 3DEIA 4RXUA 3KQKA 4BDPA 2NT3A 4B2YA 2HA2A 4M9NA 1GPBA 1G3IA 4DDMA 2FZ4A 3H4TA 3KVVA 4N18A 3OVMA 4QOSA 4TT8A 3A37A 3A4TA 5IDXA 4UQOA 3B82A 2IU0A 4YP3A 1ID8A 2KKPA 4R9RA 2YHBA 4WBSA 4YDHB 4RKRA 3LA6A 3DWEX 1KK3A 3EA4A 4FGUA 1IZ0A 5J2BA 2H1LA 4MWGA 1GZ6A 3EC2A 3SNKA 3DTTA 2IUFA 4QZBA 2Y71A 7ICSA 1JHXA 2YJ6A 4UARA 4WOBA 4ETMA 4AQYB 2J7PD 2PD6A 1PR9A 3FZNA 3D4BA 4JHXA 3WHLA 1Z4MA 4ILKA 2JIZD 4IEFB 4BEVA 3UJDA 2PWPA 4I8IA 1IPFA 2F3NA 3K2BA 4PS0A 2KNJA 2QTCA 3WJ1A 1WXFA 1EWKA 2P9QA 3JYPA 3KKAC 2W6MA 1VZ3A 2DWCA 3BQMB 3D8TA 3KFLA 5FL7D 3UWPA 2VJBA 4Q4JA 1WX1A 3A1TA 4JYZA 4LGYA 2RHBA 4CMJA 1GV1A 4WDQA 3M4YA 5CURA 1XX6A 1MP0A 3T61A 1TVKB 1RYEA 3IQWA 3UM9A 1HT3A 1HFEL 1IY0A 4GXNA 5C1IA 2X5NA 2W4QA 2KQUA 3CC8A 1A4XA 3H1EA 1YR2A 2Z6UA 4F2SA 3TTXA 2GVDC 4AZSA 4EO7A 3KL4A 4JROA 2R4UA 1QCDA 5K3FA 2ZWOA 2EGGA 3COWA 5JRJA 4HUQB 2G1PA 1FNBA 3WNCA 1OWNA 1P4AA 3V7NA 1DC3A 1ORVA 4H77A 4JELA 1N5IA 4LYJA 1K1EA 4OJKA 4HAOA 4X7BA 5G4KB 1DEOA 1S10A 4WNCA 3UK7A 4HVCA 3OU6A 4UB2A 4OBWA 3P7MA 4WZBB 1FNSA 5THXA 5B6JA 1G1MA 3RI3A 721PA 5CNJA 2WKWA 5E4JA 3R3ZA 3ZJ4A 1L8LA 3MGHA 1AS3A 4KO4S 1IUKA 2VP4A 1M9NA 3NOOA 5AKJA 4MQ6A 2RC5A 4PQFA 3T34A 4DQKA 2QLNA 3L46A 3S2ZA 3QFFA 4DL7A 3RASA 2P6UA 4L74A 4PCAA 1K9SA 4ARBA 4CQLA 2DT8A 2O20A 2XXAB 2ZDHA 3KQPA 4BLVA 3DW3X 3K4HA 2B61A 3VKHA 5B1SA 2WG1A 3UFXB 1MJGM 3ZHTA 2E4ZA 3PC8A 3FJYA 4B5LA 2PTHA 3CKYA 3SI7A 4CV3A 4O3RA 5JDCA 4PAWA 4AX8A 5EXPA 3X1YA 1Z2AA 1Y7PA 1GR1A 3DFMA 5DASA 5KTYA 3M82A 3TJMA 3W5UA 5LOVA 4E5DA 5IJZA 4LQ4A 1G19A 3WHIA 3NIDB 1FMJA 1RXUA 1E9DA 1R5OA 4WOKA 5BWLA 5DCWA 5JWHA 1K97A 1Z4QA 1Z7EA 2ZAOA 3DOJA 5TISU 4O4IA 3H99A 2ZULA 3E9YA 3BIOA 1RE0A 3IXLA 5DYIA 5DNAA 3F2VA 3VR6H 2XCIA 1DV1A 3ZUGA 4BQPA 2CRXA 4F3YA 3JRXA 5A5GA 1PR6A 3AFGA 1UMDA 5IG2A 4YJFB 5CFLA 4F5PA 4Q1FA 1ECFA 3UOWA 5JRZA 1L4UA 4AP9A 3ICWA 3HM2A 5HZKA 3WIEA 2X14A 3COSA 3IL2A 2AVNA 2O7QA 1TL7C 2VJPA 1ZHHA 3KKNA 3NDJA 4PHAA 4CGZA 2M6KA 4ZDKA 1D9ZA 1EZ1A 4P4PA 1S1MA 1T3TA 4D3XA 1L5FA 5JUMA 3K6JA 2WZBA 1E1DA 1P9WA 1QK4A 2JFUA 2Q46A 2ZVJA 3QG1A 5TEWA 3T38A 1XZLA 1FFUA 2R79A 4JYBA 2IQ5A 3MAGA 4MICA 1UJCA 1YB1A 2PGIA 4O2RA 3H5TA 3JPYA 3Q4GA 1RI3A 3UXEA 1DCTA 5ECDA 4EABA 4OBBA 1E5QA 4W4TA 2O2SA 5CA0B 1E0KA 2IC5A 2XMDA 4UBKA 3W8NA 5L7WA 1NKBA 3OM9A 3Q0IA 5L1IA 4JGIA 4ZVRA 3VYWA 2LCIA 2X5KO 3FYUB 3A9TA 2FLVA 2C7PA 5JFGA 3WGZA 3DTNA 3PF9A 4G4SO 5THKA 3WHPA 2PRZA 3OSUA 4A27A 1V35A 1G5HA 2OORA 3AP3A 3E2PA 4LVUA 4MRMA 2QKYA 1S5PA 4EMBA 3LT0A 4E14A 2ZRLA 2FOIA 4CXMA 1J0CA 1G8KA 3LX8A 2R00A 5KNDD 5ICFA 3BB3A 3R7AA 3U7RA 4BWFB 3VUFA 1T6ZA 1U8ZA 1FFHA 2WINI 3OHBA 4YP5A 3EDOA 4Q8FA 4H35A 4UZEA 4QYSA 5FR1A 4P5PA 4XRHA 1VHLA 5KT3A 1YVRA 2I1WA 1M2WA 2XT6A 4P54A 1GNQA 2VJMA 3BQTA 2P62A 3PKZA 5LQDA 1RT9A 3SBEA 4C6RA 5LMCA 4FBUA 1THZA 2XMPA 3Q3VA 4R1SA 1HSOA 4DGQA 4GF5A 1QZTA 3QOXA 4E12A 2XCRB 1W5AA 5IX8A 2JS7A 2KMDA 3T52A 5BSRA 4MGZR 4A0FA 2ZJ5A 2XYGA 1SHKA 4HQNA 1QMPA 1B8VA 1QORA 2GN0A 2Z0MA 3C16C 2H9YA 3A2NA 4HL6A 4NU5A 3K8YA 4Q3CA 2J9GA 4WA8A 1O1YA 4XDGA 5HUHA 1MU0A 1LVHA 2PR7A 4KXQA 4JT4A 5HG0A 3ZE2B 2HWXA 4C0KA 1XU4A 5C5JA 4RUCA 1W0JD 4ZVPA 5ALHA 3U5ZB 1V3UA 2JJYA 4H2DA 4J76A 3PP8A 3VR5D 3F4LA 3FCOA 2NSJA 4Y30A 2RK4A 2W2NA 3DA8A 5I7OA 5LLTA 1POXA 4F1WA 1NAHA 3STYA 4QGFA 4MLPA 2VUHB 1FYFA 1Z25A 1YJXA 2ZRCA 4NXNB 4AZVA 1DQYA 4F2GA 3E3AA 3IEXA 4W9RA 3GG9A 3O4VA 3THWB 3VHLB 3OT1B 2VHTA 2XVMA 1QWSA 3JWIA 4K8RB 4OM7A 3V7FA 2WHPB 4PLTA 4D9JA 4BVHA 3WRWA 4Z9YA 2PNFA 5EQDA 5K3DA 1E3LA 3NIWA 4RTRA 1ZFNA 1EJ2A 3OLWA 2C42A 3L6DA 4R6WA 5DGIA 1BO6A 4HCJA 4R68A 1CNEA 1K9VF 3AR3A 1AB5A 1PDWA 4GZ6A 1RM4A 2Y68A 2ECQA 2AJBA 4PLCA 1XVVA 4ZOBA 3YASA 4BJ3A 3PR4A 1SC6A 2DH5A 1PR4A 1SUWA 2C1XA 2VKQA 1TMYA 2MSEB 2R6AA 2PG3A 3TK1A 5C8YB 2DJIA 2QSUA 5J0OA 2N1BA 2ZE5A 5M7EA 3FG9A 5JEEA 1LDYA 3EVEA 3PXDA 4DL9A 3T1YB 3UQ0A 1E7RA 5AKIA 1Y81A 3OQPA 3PNLA 4AYWA 2I2BA 1F4PA 3KYCB 3L7KA 2BR3A 4RE5A 5FAXA 5HHTA 2NO5A 1G3RA 2W2VA 2WT4A 1MUUA 4O5OA 3ZGVA 3CM0A 5DTQA 5G1PA 3RS8A 5GIOE 1OBVA 4DSEA 1FJHA 2DGZA 1BC5A 1RFLA 3R2JA 4Y6GB 2Y1IA 1ZQTA 2JDIA 2CJWA 2ZTLA 1WKVA 3KAQA 5D3KA 4TYNA 1FK8A 3IQDB 4RCVA 3J7AC 2ODTX 1XCMA 3WKEA 5K8TA 1E2DA 2B3DA 1SUDA 2WG2A 3NB0A 1XSPA 2HJWA 4EUKA 2F43B 2YIMA 4KLIA 4NXZA 2BGKA 5IAJA 5K4LA 1BE0A 4S1PA 3DR3A 1CQIA 4MINA 3EEFA 1CB7A 2XNHA 2N1MA 4Z3DA 3G9UA 4ARCA 1GAXA 5AHOA 1I0IA 1S9HA 2WAXA 3CLTD 1MR3F 3D8UA 1B16A 3L6RA 4PIMA 3FSGA 1W30A 5SV2A 2RKOA 1RYSA 1Y7TA 5J5CA 4AS2A 5CXQA 3P45A 1GGHA 1Y82A 3RSLA 2OMKA 3NG1A 3CH6A 5EOVA 4MFFA 4LWOA 1QH8B 1HI9A 4B4WA 3FMIA 3AI1A 1I80A 4A36A 3KWFA 5E2BA 3K30A 4UAZA 2ENUA 3C3WA 2EYQA 4FMCF 5GMOA 1P60A 5KG4A 3PFGA 3DXXA 1Z0FA 3IIIA 1AQNA 1V7QA 1VKJA 5AP9A 1UJ5A 5JTIA 2VA2A 1UT8A 5K03A 1LSJA 2OM2A 2QRMA 4PRYA 5F7ZA 1AM4D 1E4VA 1FTQA 2OGZA 3Q6MA 5JECA 1H6CA 3HU1A 1QHIA 4RT3A 1VLVA 2W6PA 4QVKA 4UU7A 4O4IF 1KZHA 3Q8WA 3O8RA 4L0QA 3HQ4O 2FLWA 4HWGA 3ESBA 5CP8A 5DT9A 3ZDQA 4DNXA 4XGNA 4ZV9A 3IVMA 4MHVA 2HDNB 1YS2X 3DPIA 3B9RA 4G0QA 1MTOA 1JP7A 2R7AA 3CONA 3VKFA 2KJ9A 3BMCA 2TMYA 2PKYX 1KQOA 1ACLA 1G66A 3S4YA 4WV3A 4F97A 3GEHA 4P4SA 3CRZA 1MX5A 2H0AA 2R47A 3EXFA 1Y4ZA 3LQ4A 4OMCA 5KCMA 8MHTA 1JJFA 1IQUA 4HDOB 2K8CB 4J1QA 4M21A 4G3IA 3U7JA 3V48A 5AW2A 1IU9A 4HAXA 4DL3A 1WQ1R 4LI0A 4RVDA 1OYYA 2QRJA 3MNFA 3MF4A 4G0WA 3OTHA 3GVIA 3KR2A 4RNCA 4KQCA 1UCVA 2WF9A 1CCWA 3F67A 3QTTA 4FZRA 2A5LA 4GSKA 3VX4A 4ICIA 1U0HC 3O26A 4FHZA 1CVLA 1YOVB 2I6TA 7AT1A 2PS1A 5CBPA 3VPDA 3UGKA 3R9IA 1ARZA 1QONA 2ESRA 1K88A 2QTBA 3VTKA 1XEFA 3ETNA 3L7IA 4XCVA 1L5GB 4PYJA 5JIBA 1KRPA 2UXBB 1SXJE 1DRKA 1QH0A 4YDRA 4NIMA 3B38A 4ZAWA 1TEXA 5HKAA 3K73O 4JY7A 4DRXA 4PSVA 4LYGA 1NN3A 3LYUA 3O4HA 1J99A 1EAMA 1Q12A 1P3Y1 5FOWA 2GF9A 5D3MA 4J3JA 5ENVA 2AV6A 1E7SA 2QP4A 1HT2E 3S6JA 3V4RA 3F3KA 6ABPA 3TPFA 2IZZA 3T5DA 3PXAA 3WL5A 4FNAA 1U1EA 3WP1B 3CSSA 3GLTA 4I08A 3RFAA 5HFAA 4ASUA 3WRYA 1RS0A 2GN8A 2W11A 3V1MA 1RAFA 5J2DA 4NYIR 2Q1UA 2VIXA 3C21A 3O2JA 2XUZA 2I5PO 1V9LA 3M6VA 2EKLA 4G97A 4JJ7A 4LZJA 1FMFA 1KMMA 2G9RA 1Z62A 2POQX 3AKZA 3EYZA 5FADA 1DP4A 1ZN8A 2X2EA 5AI6A 2ID7A 1GY8A 4F5YA 2ODEA 1YACA 4YJDA 1KFJB 2P30A 2H2FA 2VHYA 2UVWA 3LOQA 3I2GA 2C77A 1S89A 2RC6A 2GPJA 2QRVB 3BXGA 2ECOA 2EQBA 4G81A 4L3VA 1OLUA 5COAA 3MVEA 3PUWA 4ND2A 2AZ4A 2UYHA 2W2LD 2F4VB 4JIMA 1ONPA 3L2OB 2H9IA 1E62A 2C82A 1AF4A 4RDCA 3ADBA 3D7KA 5K2MA 2JG3A 4K4GA 5BO5A 1XTSA 4ZYZA 4RPZA 3PO5A 2DY1A 2Q5OA 3R8XA 5CW2A 1CEYA 1FA9A 3BE6A 3SF8B 5J2UA 2E5FA 3GGPA 3WNVA 4ZCQA 2RDJA 4FKZA 1IB0A 1A2BA 3CJTA 4UBCA 3WJ7A 4F2DA 5B5SA 2PWBA 4WESA 821PA 1N7GA 2PUEA 5CB4B 2IE0A 4B0OA 1IQRA 2WIDA 2R25B 3I9NA 4FGSA 4ERNA 1G20A 1ZEMA 1RCTE 3HTXA 4EHDA 2C3UA 2IDMA 2X86A 4RA9A 1J8YF 3PJFA 4M8KA 3TADC 1W4RA 1OB2A 4BP8A 1ADFA 3N2IA 2W9AA 3O7WA 4U7PB 1NE7A 4FINA 3ZKWB 1KZYC 3GGJA 4BVFA 2CSXA 3A4LA 3M34A 1L3BA 2W6ZA 2DJ5A 2R3SA 1C0IA 3QVMA 4XEHA 4C7OB 2V0CA 4RGQA 3PWKA 3I72A 4KSCA 4S1TA 4HBGA 4C04A 2CLFB 4MITA 4NY1A 5F2KA 1WOMA 4FYIA 5IFLA 1XWFA 5KYWB 1BS1A 3EF0A 1AK2A 1ZQSA 1H1LA 1JVSA 1O0SA 1JLSA 5BSFA 2AGQA 5L7TA 3U4HA 1D6JA 3RYCB 1D7AA 3FTDA 4JUCA 4H6VA 2GHIA 4D82A 1L7PA 3K31A 4G07A 4ZVUA 4YX9A 1V48A 5EJ9A 3FBGA 5HPYB 2ZIWB 1K7YA 4EVIA 4PINA 1MORA 4XYLA 1V1MA 3S5JA 1VG9B 3KX2A 3NTOA 4A8HA 4XM1A 1VI5A 1KQPA 4BTEA 2O3SA 3M6AA 4ER6A 1JPVA 4KR2A 3UAXA 3ZGOA 4DS5A 1G2IA 1IHPA 2CW5A 2DBYA 1U9IA 3EVCA 3MS2A 4LJ9A 1DDGA 4OQYA 2A5JA 4RGVA 1HRDA 3Q41A 5EZ6B 3RH0A 3DLBA 2HW3A 4O4JB 5T4EA 1YS7A 1YR6A 5HZHA 1UC5B 2VYFA 2VNAA 1G8MA 2PRYA 4Z8YA 3O8OB 3PVCA 1M54A 1ZMTA 3BH7A 4YCBA 1V9SA 2I2CA 3E2MA 2CD7A 1UFQA 4M9GA 4FDTA 2R87A 4K88A 4PC7A 5DXAA 1JGTA 4OYLA 1L1RA 4TS4A 3SVZA 3O75A 3C24A 2V7GA 3TSZA 3UPDA 1L5UA 1XRSB 1R27A 1BWRA 1KRXA 3HCCA 3E0FA 4OF4A 3WDLA 4IMIB 2R86A 1YMVA 4HMOA 4PG7A 2OCEA 1PI3A 1U6IA 3DZKA 4XRRA 4X1OA 5EUCA 1F2VA 1WF6A 2PT6A 3UAVA 4ZMRA 3GT4A 2MIIA 1PTJA 1XVLA 3TOCA 3GAAA 3ND6A 4CL0A 4Z7QB 3EPGA 4BNHA 1JMSA 1DAPA 1EUCB 3AKCA 3IPXA 3VO1A 5L9AA 2VANA 2XCUA 3ZQKA 1NLUA 1IJEA 8ICLA 1J0DA 1DBVO 2JEZA 2OFPA 2YWEA 3DUFB 3MJ4A 3HVHA 1HQKA 4XJSA 3GZNB 1UP6A 2Q3FA 1OROA 1AU9A 1ZQVA 1IRXA 3GDFA 3PC6A 4RKFA 5AWFC 4CL3A 1IY1A 3DKIA 1F38A 3C5VA 1E2GA 4K1LA 2NXJA 2L5YA 1EB8A 5BVHA 2I67A 4UM9B 1U47A 3K0KA 2W3SA 2P2LA 3GRYA 4JV0A 1RHMA 5ITZB 2JAWA 1RZRA 4MUEA 4EKNB 1YA6A 3RC8A 1LDMA 4KXNA 2TYSB 2XUFA 2FQXA 2JAUA 1W5TA 2W6QA 4PZ9A 4YGXB 1E1KA 5ICCA 3K9CA 2VQ6A 1JSLA 4J03A 1RHUA 5HK9A 2Z5GA 3S1SA 3ZHOA 4QZIA 4PGFA 7ICFA 4LJXA 5COBA 3VTFA 3MS7A 4B17A 4G5YA 1ADBA 3HDQA 1Q17A 2J6IA 4QULA 3WGHA 4URVR 2R1ZA 1PJQA 2NU6B 3TYXA 1M2FA 2YN0A 3EUB2 1YA8A 5K8JB 5KQRA 2MOKA 3QP9A 4CHGA 1TUIA 2HO5A 3PVXA 1VDMA 4FEGA 4NP6A 2AQ4A 3E3LA 4HDMB 4PZYA 4FOPA 4CVNA 1QG2A 3H18A 4F84A 5AI8A 1WZ2A 1WEKA 2M6LA 1ZQXA 2IYWA 4C76A 8ICMA 2O59A 3LWZA 2ZTSA 3KYJB 3F3SA 4G5SA 4MWCA 3JD4A 3ZS8A 1E7MA 4OQQA 2FHPA 4I3HA 1UA1A 5FFNA 5NLLA 5A9SA 1T29A 3OJFA 3ON5A 2B30A 5EP3A 1JEQA 1M2VB 1ZCZA 2CXUA 2XYRA 5JO0A 1JRPA 2P9TA 2A0FA 4OSOA