4FFKA

X-ray structure of iron superoxide dismutase from acidilobus saccharovorans
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
212
structure length
212
Chain Sequence
b'SVVSLKRYELPPLPYNYDALEPIISAETLRYHHDKHHLGYVNGANAALDKLEKYLNGQLTDIDVRAVSRDFEFNYGGHILHTLYWLNMAPKGKGGGTPGGAIGDAINKFFGSFDKFKKLFGDAAKNVEGVGWAILAYDPVTGDLRILQVEKHNNVVTTNLIPLLAVDVFEHAYYIDYRNDRAKYVDSWWDLINWDDVEARYQKALNTPKLIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title X-ray structure of iron superoxide dismutase from Acidilobus saccharovorans
rcsb
source organism Acidilobus saccharovorans
molecule tags Oxidoreductase
total genus 78
structure length 212
sequence length 212
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4ffkA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4ffkA02
1I08A 1XUQA 4F6EA 1GN6A 1VEWA 3DC6A 3DC5A 1KKCA 2QKCA 1EM1A 3EVKA 1IXBA 1BT8A 1AP5A 1AP6A 1QNMA 4GUNA 1XREA 3TJTA 1GN4A 1BSMA 4FFKA 3C3TA 4BR6A 1XDCA 3QVNA 3IC9A 3KKYA 3K9SA 1WB7A 1Y67A 1ZLZA 4E4EA 3RN4A 3AK3A 3CEIA 3MDSA 1PM9A 1MSDA 1JR9A 1SZXA 3AK1A 1AVMA 1IX9A 1GN2A 1MNGA 4JZGA 1JA8A 2ADPA 1EN4A 1MA1A 1VARA 1GN3A 1ZTEA 2AW9A 2QKAA 1B06A 4C7UA 1LUWA 1ZSPA 1WB8A 4YIPA 3AK2A 1P7GA 4YIOA 1EN5A 3OT7A 1MMMA 1ZUQA 3BFRA 5A9GA 2P4KA 1IDSA 4JZ2A 1AR5A 1PL4A 3LSUA 2ADQB 2CDYA 1EN6A 1BS3A 1D5NA 4JYYA 4X9QA 1I0HA 2CE4A 1N0NA 5AG2A 1XILA 1LUVA 1AR4A 1N0JA 2GDSA 3C3SA 2RCVA
chains in the Genus database with same CATH superfamily
3OAAG 4D7SA 1FYJA 4MTXA 3OMAB 5CA1B 2XOKG 1OCRC 3JAMN 5J2UA 2Z3YA 2BTOA 5L3DA 3C90A 4Z1MG 3B77A 1BT8A 3CRCA 4YJ3B 5KX5B 2UUAB 1K5SA 1W0KG 1YI2V 4O4JA 1K33A 1GM8A 5H5NA 4O4HB 4WFHA 3CS5A 3WB1A 2JGDB 1JFFA 3AEIA 2C2AA 2UXNA 1NR7A 1HNXB 3AK1A 4NXNO 2PI4A 2OCHA 1YXBA 4RWUA 2QR4A 5CBFA 2F95B 3OTOB 1DF5A 1D2DA 2WSSG 1Q8IA 4DV4O 2UXBB 2VQEO 3FB5C 4ABMA 2CTQA 4F4LA 2GV9A 2NLJC 5E1AC 4DV6B 1WB8A 2HVKC 3OUFA 4GZRB 2F4VB 1PNLA 1IBLO 1I94O 1FXKB 5JQGA 4Z1VA 2YEVB 1VP7A 3T4ZA 4KL1A 1SA0A 1AI5A 2EIKB 3CCVV 3OMIB 5B1BC 4XDJA 2FTKA 3I56V 5KAFZ 2PYLA 1N8RW 4I4TB 4KHPB 1W0JG 3B09A 3ZS8C 5JVDB 2BOCC 2CE4A 1Y74A 1FFTB 1FXHA 3B2EE 4FMTA 2XAGA 4QNHB 4JI5B 1GMGA 5DM6V 1N34O 1DTOA 4DUZB 1XMQO 2Q73A 3WG7B 1IJGA 3CRRA 4P9PA 5GW7A 1BQ0A 1R3JC 1I08A 1FFXA 2GHYA 4JAAA 4R8CA 2E5LB 4CC5A 2EILC 1JFFB 5KA5A 5J2TB 5L3CA 3OGCC 2BE3A 5JJEB 5KHGA 1AJQA 2V4DA 3JD1A 4X1YA 3ABLC 1Q86W 3CEIA 2LFRA 5EYPA 2JK5C 4FM2A 3RYIA 1GM9A 4LF4O 2Y69C 3LDEA 4O4LA 4MVRA 2R9AA 3A0HZ 3UCSC 4MSWC 5LL6Y 4J11A 2ADPA 4WFFA 5H9CA 4LFCO 2ZM6O 4JASA 2LFSA 5JQGB 1ZTEA 5EBLC 3E8HA 2DYRC 4LFAO 1DK1A 1JJOA 3BABA 4TOIA 2RQ6A 4C7UA 2AXTZ 2EZOA 2P90A 1SA0B 2HR3A 2ZDIC 4RUEA 3G4SV 4UV8A 1E1QG 1MMMA 1XMOO 4MTFA 4NR1A 5KUMA 3FAVA 5F2VO 5B5EZ 1A32A 1Y74B 1YDXA 4JI6O 3AG7A 3SYAA 4OXSA 2ZXWB 3PJSK 4QPJA 5ITZA 1QR9A 5FPRA 2W0FC 1K5QA 1R6KA 1S5JA 5FPOA 1OCZB 1XHXA 4J80A 1FFXB 4FM1A 3T2MA 1QLEC 4JF3A 4BAYA 2P7TC 5K1XA 3ZN1A 4B08A 4B3MO 1K92A 1SF9A 1XMQB 4ZOLA 1VQOV 2WLMA 3DC5A 4QIWF 1RM1C 4CBCA 5HFMA 2M7WA 2Y48A 4X1YB 4UCRA 2EINB 3HR0A 5EYPB 3RYIB 4J42A 5GONA 4MVUA 4CC6A 1Q6IA 2F43G 4O4LB 2JRIA 3K9SA 1Y67A 4FLTA 1AJPA 4ZKIA 3ZMSA 5IE9A 5B1OA 1JX9A 5IYZB 3CRQA 1W2BU 4LNUA 1Z5WA 1GRJA 1FKAO 1KP2A 2XAHA 4X62O 4JZGA 1VMGA 3ZX6A 4JI2O 1NJIW 3AG1C 2PZSA 5LMUB 2ITDC 2HLDG 4IGGA 4LF8O 3ZMVA 4B7EA 2WLIA 3B8NA 3H1LH 2MK3A 3FAVB 3SYCA 1IBKO 1ZSPA 3LSSA 4NTYA 3ZRXA 3RFRA 1H2KA 2Y4TA 5ITZB 2CTPA 1PD3A 3CD6V 3BEHA 2YXYA 4PDMA 1Q7YW 2QSAA 3KZIZ 4PI0A 2QWRB 3EHBB 1H8EG 1PL0A 1PL4A 1RPRA 1JNBA 3OR7C 2QKSA 2UU9O 2ZNJA 4NXMO 1D5NA 2QTSA 3AG2B 2IM9A 3DGEA 3K59A 1L0LH 4PA3A 5LHHA 2WA4A 3TXQA 1NI8A 4X8AA 4ZOLB 3JALB 4FLVA 2GBOA 3RYCA 4DYLA 4LF5B 2Z5UA 3OTFA 3ZHVA 4DR3O 2Q67A 1SQBH 1OCRB 3SGIA 1XHZA 2CGOA 4RQFA 4JI0O 1HR0O 1K8AW 1XNRO 1YVWA 1HP8A 1AP5A 1HDJA 4PI2A 4X20B 5B1AC 3D36C 3E35A 3ZRWA 1K7DA 4LNUB 4X66O 4DV1B 3A0RA 4MVSA 3SJAC 3JARA 1JR9A 2HHHB 4GKKO 1L1FA 2WLIB 4PA6A 3MHSC 4DK1A 2ZE7A 1JA8A 2PYJA 4JYAO 4EEQA 5KMGA 4ZIBA 4X62B 3JSLA 4JI2B 3J81N 1NTZH 2W0XA 3S3WA 4A5UB 3D3QA 4NKGB 1HWYA 1GKFA 1DLBA 2KG7B 2ATKC 3FB6C 2YSUB 5B1BB 2DN9A 3P3PA 4WFAV 4UB6Z 3P30A 3SR2C 2A0LA 3BY6A 3LSUA 1ROPA 2LO1A 3AG4C 3RW0A 4LF9O 3CWBH 4DR7B 3RYCB 4JYYA 2ZCEA 4FVMA 2HP8A 3RBZA 4JI7O 3X2QC 4O4IA 2EJ7A 4NXMB 1G4YB 1QU7A 3BA9A 3F5TA 4AQYB 2ZE5A 2HFEC 5K1PA 3JAWA 2IH1C 3ETEA 2JJ2G 4I0XA 1N33B 3I55V 4JTDB 3ZRWB 2EILB 4BW5A 4OX9O 1QBZA 3E8GA 2P6JA 1S76D 2YIDA 3QO5A 1BQZA 3F7YC 3JARB 1PV0A 2AZ0A 1E1RG 2OIGA 3IC7A 1J5EO 1OJHA 1XNQB 1HR0B 2JIZG 3ABLB 4UCUA 1XNRB 3BRCA 1KD1W 2B1GA 4NB5A 1IVSA 1WB7A 4QPKA 4FK5C 3TETA 4DR6B 2Y69B 2YXLA 5KAIZ 2QWQB 4LF6O 5KMGB 1NTKH 1OCCC 1WA8A 5DN6G 2OCCC 1HNWO 1IX9A 3RYFB 4ASUG 2P67A 2ZT9B 5CMUA 3VQVA 1R3LC 2DYRB 4GX0A 1JMKC 3CRAA 3E22A 4MW3A 2VWJA 1TA8A 2V1DA 1BE3H 1YSCA 4GLXA 1IURA 3R65A 5C8YA 1X4TA 4U7OA 1JCHA 1SKVA 4GT1A 3CCRV 1AILA 1SERA 4JI3B 4X1IA 5B3SC 4X64O 4O4IB 2P22C 2NN4A 1F4NA 3GWKC 4UVAA 3K3WA 3NR7A 3G71V 4X65B 3K04A 3JAWB 4MTOA 1QLEB 3GB7C 4I0XB 2PI5A 2LW7A 4DR1O 3ZHQA 1M56C 4JI7B 5IJ0B 3K58A 1AR4A 4N23A 2QTOA 1F23A 4J7ZA 2R70A 3QF7A 2ZE6A 3O9OA 3PN1A 1RM1B 1H2SB 1S5LZ 3JD3A 3JCZA 1SQXH 2UXCO 1XL6A 2W6JG 3K5OA 2DQ0A 4TV8A 2JGUA 4JI1O 2WLKA 1AP6A 3L75H 4BR6A 4OX9B 1WA8B 1V55C 3MHHC 2WLLA 3D36A 4L8JA 3STLC 2XT9A 1BZKA 2PUSA 3GVMA 4GX2A 3WB0A 2RDCA 3M99B 3FD9A 4MT8A 1Q82W 3ZRSA 3CCEV 2NR5A 3AG1B 1CEZA 4LF6B 4K0KB 5LOVA 2UXDO 1EZVH 5CA0B 3VQYA 1R6TA 1LR1A 4DR2B 1HNWB 4L87A 2HEPA 4I7ZB 2XTAA 2A9HA 2EIMC 2QM8A 3B4SA 1TUEB 4X1IB 1B06A 3ZCCA 1NTMH 1FJGB 1N4CA 4JV5O 1BMFG 1J95A 3A0BZ 4GKJB 1ZUQA 4G2KA 5J9PC 3G67A 1IDSA 5IY5C 5A2QN 1URFA 1AR5A 3OM3B 2VQFO 2F66C 2XAJA 4OPHA 4UB8Z 2V7QG 4J9YB 2A7WA 3K5MA 1KUQA 1KP3A 3K0DA 3KDRA 5AG2A 4X88A 2GUZA 4UVBA 3CHXA 1YTFB 4TV8B 1H2LA 1QVGU 2QWOB 2ZR2A 1YJNV 5LMNO 2Q7HA 2B5UA 1UFIA 3ETGA 4J10A 4JI4O 4YJ2A 3T1YB 1P4RA 3P32A 3RVZA 2WLLB 4DV3O 1GM7A 5B1AB 5CB4B 3DXRA 1AI7A 4I55A 2ZE8A 2VS0A 3QO7A 1GN4A 3SYQA 5IYCO 4DV7O 1F51A 3KCYA 5J2UB 2YXHA 1THZA 4TT3G 4PDLA 3RWRD 2UUCO 3ZMTA 4LFBO 4HBNA 4X89A 5IWAO 3F7VC 4O4JB 3ML0A 1RFYA 1KQSU 2ZD9A 1B04A 1GN2A 1MNGA 3H1KH 2UUBO 4B3SO 5IYBO 1NVPB 4GX1A 1Q43A 4DV2O 5D5QA 1JQ0A 4YHHO 3LUTB 1M4UA 1M9NA 4FZ1A 1G6UA 3SJQC 1JVMA 4YY3O 2X6BA 4DO2A 2O57A 1HNZO 4FLWA 3OR6C 3AG4B 3SPHA 2WA3A 4NXNB 3QO8A 2A79B 1KU9A 3CXCU 3X2QB 2Q6AA 2GUZB 4F6RA 4LP8A 3L74H 4KUMA 4ICGA 3G80A 4HZ3A 2OIEA 4R6ZA 3RGBA 4DV4B 3FFQA 2VQEB 3W7UA 1YTFD 1N36O 2QWNB 4K35A 2JVDA 4YJ2B 4K8XA 4DR4O 1Z2GA 1COWG 1K3EA 2H94A 1N32O 1IBLB 2CH7A 1Z5VA 3DXRB 1I94B 4R50A 3L72H 1ZWIC 4CH4A 2FL4A 1HW7A 2G38A 3EFFK 1U96A 1CXZB 2YIAA 3SJCC 2D2CB 3H1JH 4LF7O 2N74A 4JI4B 2E3CA 1VQLV 2X6CA 2LQTA 1M57C 1BSMA 4JPRA 2FYUH 2EZPA 3RYHA 3UO2A 1OCCB 2H3OA 4PDVA 1N34B 4DV7B 2OCCB 1I7FA 4CH5A 2QA4V 3HPLC 3SPGA 2RMKB 5E79Z 4OPAA 3E8FA 1T5EA 1AVMA 4XDKA 5EC1C 3E8BA 4FM0A 1OV9A 2JDIG 1NVPD 3D8CA 3OD4A 5IWAB 2WLHA 1TUBA 3QG5A 3D3IA 3CCSV 5LBQA 3QTCA 4KFMA 5LGUA 3H1IH 1VQ7V 5LXTA 5B3SB 3T1HO 2YUAA 3WB2A 2QE7G 4WFGA 4F6RB 2IJJA 3UM7A 3K5LA 2R72A 2VRZA 4NYKA 5EK0A 4LF4B 3ZHTA 3TCUA 5EBWC 1BCCH 1FOUA 4DV0O 2VWKA 2CTRA 3ASOC 3JAKA 4EKWA 4LFCB 2HJDA 3ETQA 2ZM6B 3TXSA 2CH7B 1M56B 4WBNA 3ABKC 4RQEA 4UUJC 2NNUA 4LFAB 1KMIZ 3OE7G 1LUVA 5JCOA 2GDSA 1O9HA 5H2FZ 4JI8O 1XMOB 3JD0A 1YIJV 4DR4B 3NXSA 4F6EA 4B3RO 3RYHB 4JI6B 3UQ8A 3HKDA 3JD4A 4DV5O 2HVJC 1V55B 2DQ3A 4TQFA 4GUNA 5EBMC 4DUYO 2EJRA 4LC1A 3FYIB 3G6EV 1FXVA 4D6TH 4LBEC 2DMXA 1Q3EA 1TUBB 4H33A 2IJKA 2FB5A 4LH7A 1PM9A 5GONB 2Y0PA 1QHTA 2OWOA 2P06A 4B3MB 1QLNA 3ASNC 4X1KA 5LXTB 2LGQA 4PD4F 2EIMB 2A3QA 3CCQV 1G8MA 2XAFA 3HKCA 3ABMC 1TGOA 2Q4PA 2ZIMA 5CN0A 5DECA 2K9PA 2YC0A 3CJHA 2ETNA 2FMLA 1QVFU 1YITV 3AK2A 1P7GA 4B7KA 5CA3A 2QGNA 4LH6A 2AZ2A 5IY5B 2F93B 2D3OW 3BFRA 5LP6C 3ABTA 4W4LA 1K4DC 4PA9A 3SYPA 4WBNB 1PP9H 1Y76A 1M1KW 4CS2A 1ENVA 3U11A 4I9WA 2CDYA 3BCCH 5CBGA 1BS3A 4O2AA 5EIBD 2OT5A 3SPJA 4LF8B 1I0HA 4DV0B 5IYDO 3OUSA 5KHKA 2ZR3A 1NR1A 2GTAA 3MAQA 1IBKB 4CS3A 1V54C 1OZ0A 2KSDA 2BTQA 1XUQA 2AHZA 1WP8A 1PNMA 1KB9F 2AGAA 3CE2A 1VEWA 1KYOF 1AJNA 2UU9B 2ITCC 1EM1A 4HNAA 2JEXA 1QCEA 1B3QA 4UFZA 4DR5O 2LW1A 4P2ZA 2QM4A 3K0GA 5FNVA 4DV5B 2Q7GA 3JYCA 4I5SA 1M5IA 1M93A 3CCLV 4DUYB 1I5YA 3W7XA 4X1KB 2WLJA 3AK3A 3P3NA 4DR3B 3HKCB 3MDSA 4J41A 3TGUH 5JJNB 3LSQA 1AI6A 3CJHB 1XQ8A 4JI0B 4J7KA 4YXWG 1VF7A 4PA7A 3AG3C 3IFXA 4DW1A 4J7JA 1TAEA 3SPIA 3BA8A 4IT5A 2AW9A 2QKAA 2P4VA 4I50A 2X7RB 1Y76B 2F23A 4X66B 4YIPA 4B3TO 1B6QA 2ILMA 2IU3A 1OCOC 4FZ0A 1H2NA 4O2AB 1P84F 1NQTA 1PPJH 4GKKB 4ZHQA 1P49A 3JASA 4UCSA 4I9QA 3IJ4A 3IGAC 1YHQV 4JYAB 4X9QA 1VQ6V 2ARHA 1GTOA 3KG2A 4PA4A 2BTQB 2KQXA 1N0NA 2XUMA 2M6YA 1V9PA 3HKBA 3RT3C 4HNAB 1HNXO 3LNMB 1GO3F 2IBZH 5LHIA 3E2EA 5FNVB 2RJZA 4NTXA 3OTOO 4UVCA 4JTCB 1M57B 4LF9B 1VQNV 3EVKA 4UCOA 4E2LA 4QGPA 3UT5A 3W7TA 4LWSA 4EFEA 1YF2A 2UXBO 4IL6Z 3DTUB 3ZIAG 4OGQB 2LGWA 1K73W 1NS1A 4DV6O 1XBLA 3LDCA 2F4VO 1XOUA 3WFVA 1JJ2U 4EFBA 1XI1A 1S5HC 4IYHA 3W7WA 2RNBA 3K03A 4U3FH 2KKWA 4PV1B 3EXAA 2EX3A 3VQXA 4I50B 1NZ6A 4FLUA 3CXHF 1EN4A 4MVOA 4MS2A 1QQCA 1FXKA 3K06A 4AHCA 1J5EB 4BIOA 2GSMB 4RAIA 3W7SA 2DW4A 2FKXA 2YEVA 1H5WA 4ZHQB 1LUWA 4JI5O 4GCZA 3E22B 3JASB 5L3GA 4DUZO 1RPOA 1Q81W 3OT7A 1VQ4V 4K8ZA 3ZN0A 3M7MX 1WP7A 5C8YB 3ASOB 3LNNA 4B3TB 3QNEA 2K1EA 4P30A 4QJFB 5LP6A 4BIZA 4AILC 2HG5C 2E5LO 2OTJV 2ZQMA 3ABKB 3HKBB 4TSFG 1GK9A 3ZHUA 4DXWA 4KXRA 2DOSA 2LJ2A 3FX7A 5FLXN 4H44B 1VQKV 3CP1A 2EIJC 1SQPH 4MVMA 1D5AA 3UT5B 4LWSB 2DWEC 4FPPA 1S77D 4PELA 1O9GA 1FAFA 4X64B 3CCUV 5J2TA 1VF5B 1CP9A 1M90W 1BHAA 5JCOC 4MVQA 1DF4A 2XAQA 3C3TA 5LA6A 1XDCA 1SQVH 4DRXA 3STZC 1QR8A 3N27A 2Q68A 4IYIA 1NH2B 4UCVA 1WAZA 1R3KC 2LP7A 1VQ9V 2Q5ZA 4DR1B 1GAXA 2GTSA 3LDDA 2YICA 3ASNB 4G28B 2B1IA 2DE0X 3T4DA 1I5XA 4BW9A 1MOFA 2N05A 2Z0AA 2ODMA 2UXCB 1DGSA 4BIUA 3OW2U 3ABMB 3B40A 4JAUA 3ICXA 4JI1B 5JH7A 4HYOA 5C93A 1SRYA 5LOVB 4D7TA 2UXXA 3CC4V 2CAZC 4G27B 5BMVA 2JEUA 3Q4HA 5LP6B 1H38A 1SQGA 3O65A 1EN5A 2WAMA 4BWAA 1Q90D 4QE7A 1F7YA 4LR3A 4FFBA 1KBHA 3CRMA 3FB8C 2Y0IA 4CS4A 4Z2WA 1E79G 4MVZA 2P4KA 2MW2B 5BXZA 2Q69A 2UXDB 1RSOA 4JGSA 4DK0A 3K08A 2YI9A 1R1BA 3L73H 3APQA 1H2GA 1V54B 1NT2B 2DYSC 1XILA 3KCXA 2ZIOA 4JV5B 1ORQC 4IHJA 1WLEA 4FLYA 3BAAA 1MZFA 5KLVH 1GN6A 1WN7A 5LA6B 1Y6XA 4JYCA 4R7CA 4DRXB 1PKXA 3DC6A 1AR1B 5LMUO 2CUGA 3CCMV 1VQ5V 2AHYA 3B8MA 2VQFB 5CBHA 1VF6C 1IXBA 1G1XB 1WPXA 4FLZA 1QNMA 5HFLA 1NH2D 5IYZA 1IXMA 2YDEA 2DWDC 1FPOA 3N2KA 2BOBC 4I55B 4J9ZB 4XBFA 4QE9A 1K9MW 2WWWA 3J80N 2CGNA 4NTWA 5LMNB 3OFNG 1SZXA 5JH7B 3GWOA 1SS3A 2N04A 5L3EA 3AG3B 2QJ1A 4DV3B 4UCTA 5BMVB 4DW0A 3Q4HB 3H1HH 1R3IC 4IIJA 2PF4E 4FFBB 1GN3A 5FL7G 1Y66A 1AI4A 1OCOB 2IH3C 4LF5O 3E83A 3FKSG 2E76B 1U97A 1RSOB 3CMEV 4XDLA 2UUCB 2P5OA 3JSNA 4LFBB 3K9AA 4PDRA 4RUFA 5A9GA 2XHBA 2JS3A 2XNDG 5KUKA 4H37A 5BR8O 4LCUC 2UUBB 4B3SB 2B9ZA 2W6IG 3JALA 3OEEG 4DV2B 3SYOA 4YHHB 1L0NH 3CC7V 1S3JA 3CC2V 4IHJB 4GX5A 3TK1A 3K79A 1TVKA 1EBOA 4DV1O 4YY3B 4CH6A 4AI8A 2EBOA 1N0JA 3C3SA 2RCVA 1HNZB 2HHHO 2OTLV 1BHBA 4ZI7A 5GTIZ 1NKDA 4CZZA 2OYQA 4K3AA 3WU2Z 1BL8A 4X20A 5D5PA 1YJWV 4TV9A 2X0LA 1KECA 3N2KB 2HJFC 4WF9V 2YI8A 3J7AU 3THOA 1KC8W 1XL4A 1AB3A 3TJTA 3CCJV 1P7BA 3L9DA 3N2GA 4FFKA 2Q8VA 3JATA 1N36B 3BVOA 1FS0G 3H01A 1ZLZA 4FIPC 2BSKA 2YIBA 4JYBA 4TQDA 4WFEA 1N32B 3CB2A 4IIJB 1UPGA 3ETDA 5TISZ 3SPCA 4DR7O 3BHPA 4H13B 3UO3A 3RVYA 2WLNA 4LF7B 4JAVA 2JJ1G 1MA1A 2KG7A 1VARA 4RO2A 5KA6A 1L8DA 1MZEA 3CPWU 1MSWD 3ZHRA 3ZRVA 2L6LA 4YIOA 3ABUA 4AQYO 1VQPV 1NBMG 2IJHA 2HKOA 4MW8A 3HKEA 1SZTA 1N33O 4U3JA 1YEWA 2L35A 4JZ2A 1FXKC 2XASA 1R6NA 3DSQA 4EB6A 3JCUZ 1TVKB 4O2BA 3R66A 1EN6A 2QEXV 2Y4UA 2EIKC 5EZYA 1WJZA 2R9RB 5BR8B 5GTHZ 1JPXA 1XNQO 4ZI7B 1F4MA 2EIJB 1KKDA 1EFRG 1H8HG 2E74B 3JAKB 1SESA 4PHZA 4WFBV 2JS5A 4DR6O 5KHHA 4TV9B 4TUYA 3T1HB 3K57A 4UXNA 5LGNA 2QM7A 3ZEDA 3WG7C 4W4KA 4NVPA 3N2GB 1VQ8V 2IU0A 3JATB 2Q7EA 3VQWA 1KKCA 3OEHG 2QKCA 4FJCC 2BSKB 4JTAB 2PY5A 1FD9A 1XREA 4P9OA 5H6QA 1VF6A 1SQQH 3QVNA 3HKDB 3RN4A 1H2MA 3RYFA 5B66Z 3SDLA 1Q6HA 2WPDG 1PNKA 2H8PC 4JI3O 1YZBA 1MG1A 3A8TA 5JJJB 1UJWB 3F5WC 4JI8B 5KHIA 2ZDIA 4B3RB 2Q0OC 5LYJA 3BPZA 1BGYH 2YS8A 1Q6UA 1K34A 2KB1A 1MABG 2F1MA 4X65O 2ZNIA 1X59A 2ZINA 3HKEB 1R73A 2RN9A 4U3JB 1Q5OA 1OHHG 3H9VA 4EB6B 3I5DA 4O2BB 3VOUA 3L70H 1IBMO 4U7NA 5EZYB 3ZMZA 4CH3A 2DJVA 4ZBMA 2IJIA 4FLXA 4TUYB 1XEQA 2Q9LA 3L71H 5L3BA 2ZKOA 5IJ0A 2DYSB 1AROP 1US6A 2E75B 1ZL8A 2ZXWC 3ZHSA 1YJ9V 1ZX3A 2QWPB 5LGTA 3VBBA 1SQFA 3IAYA 5IJ9A 4WCEV 1CPYA 3E86A 3OGIB 3UKMA 1OCZC 5JWPA 4GYCB 1S72V 3CMAV 3G6BA 3U0ZA 1ZAUA 4N21A 3ZJZA 4K0KO 3K5NA 3M8AA 1NU1H 2UUAO 4Q6GA 4Q20A 1EZJA 3ZBHA 4DR2O 2CTWA 2YIBD 3APOA 1VIBA 1LNQA 4TWKA 3S3XA 2A06H 5CA1A 5DEDA 3CX5F 1RP3B 1WNSA 1FJGO 3IC9A 3KKYA 1VQMV 2EINC 5LYJB 4E4EA 4GKJO 3JD2A 3CSXA 4YJ3A 5KX5A 5CA0A 4UV9A 5LHGA 1MSDA 4HAMA 2PGGA 3FB7C 2QDOA 3ZMUA 3E89A 4O4HA 3A2FA 2JGDA 5H6RA 5IDJA 1WPBA 5B1NA 2BCCH 4KP4A 4DR5B 5BY1A 1GH6A 5EIBC 3SJBC 5BZBA 3T1CA 1ZL8B 4PJ0Z 3CYOA 1S0VA 4KHPO 5L3FA 1YCIA 3T1YO 5IT9N 1IBMB 2Q0AA 2ADQB 2X6AA 5IJ9B 3HB3B 5EC2C 1K4CC 1W59A 1JOYA 3OMNB 3U10A 2PTMA 1IZ3A 3MD0A 4H0LB 1Y4MA 2CK3G 1SETA 1K97A 3AG2C 1SC5B 4MTGA 3FYEB 2EULA 2IW5A 5KHJA 4I4TA 5JVDA 2R9IA 5CB4A
chains in the Genus database with same CATH topology
1I08A 1XUQA 4F6EA 1GN6A 1VEWA 3DC6A 3DC5A 1KKCA 2QKCA 1EM1A 3EVKA 1IXBA 1BT8A 1AP5A 1AP6A 1QNMA 4GUNA 1XREA 3TJTA 1GN4A 1BSMA 4FFKA 3C3TA 4BR6A 1XDCA 3QVNA 3IC9A 3KKYA 3K9SA 1WB7A 1Y67A 1ZLZA 4E4EA 3RN4A 3AK3A 3CEIA 3MDSA 1PM9A 1MSDA 1JR9A 1SZXA 3AK1A 1AVMA 1IX9A 1GN2A 1MNGA 4JZGA 1JA8A 2ADPA 1EN4A 1MA1A 1VARA 1GN3A 1ZTEA 2AW9A 2QKAA 1B06A 4C7UA 1LUWA 1ZSPA 1WB8A 4YIPA 3AK2A 1P7GA 4YIOA 1EN5A 3OT7A 1MMMA 1ZUQA 3BFRA 5A9GA 2P4KA 1IDSA 4JZ2A 1AR5A 1PL4A 3LSUA 2ADQB 2CDYA 1EN6A 1BS3A 1D5NA 4JYYA 4X9QA 1I0HA 2CE4A 1N0NA 3KDRA 5AG2A 1XILA 1LUVA 1AR4A 1N0JA 2GDSA 3C3SA 2RCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I08 A;  1XUQ A;  4F6E A;  1GN6 A;  1VEW A;  3DC6 A;  3DC5 A;  1KKC A;  2QKC A;  1EM1 A;  3EVK A;  1IXB A;  1BT8 A;  1AP5 A;  1AP6 A;  1QNM A;  4GUN A;  1XRE A;  3TJT A;  1GN4 A;  1BSM A;  4FFK A;  3C3T A;  4BR6 A;  1XDC A;  3QVN A;  3IC9 A;  3KKY A;  3K9S A;  1WB7 A;  1Y67 A;  1ZLZ A;  4E4E A;  3RN4 A;  3AK3 A;  3CEI A;  3MDS A;  1PM9 A;  1MSD A;  1JR9 A;  1SZX A;  3AK1 A;  1AVM A;  1IX9 A;  1GN2 A;  1MNG A;  4JZG A;  1JA8 A;  2ADP A;  1EN4 A;  1MA1 A;  1VAR A;  1GN3 A;  1ZTE A;  2AW9 A;  2QKA A;  1B06 A;  4C7U A;  1LUW A;  1ZSP A;  1WB8 A;  4YIP A;  3AK2 A;  1P7G A;  4YIO A;  1EN5 A;  3OT7 A;  1MMM A;  1ZUQ A;  3BFR A;  5A9G A;  2P4K A;  1IDS A;  4JZ2 A;  1AR5 A;  1PL4 A;  3LSU A;  2ADQ B;  2CDY A;  1EN6 A;  1BS3 A;  1D5N A;  4JYY A;  4X9Q A;  1I0H A;  2CE4 A;  1N0N A;  5AG2 A;  1XIL A;  1LUV A;  1AR4 A;  1N0J A;  2GDS A;  3C3S A;  2RCV A; 
#chains in the Genus database with same CATH topology
 3OAA G;  4D7S A;  1FYJ A;  4MTX A;  3OMA B;  5CA1 B;  2XOK G;  1OCR C;  3JAM N;  5J2U A;  2Z3Y A;  2BTO A;  5L3D A;  3C90 A;  4Z1M G;  3B77 A;  1BT8 A;  3CRC A;  4YJ3 B;  5KX5 B;  2UUA B;  1K5S A;  1W0K G;  1YI2 V;  4O4J A;  1K33 A;  1GM8 A;  5H5N A;  4O4H B;  4WFH A;  3CS5 A;  3WB1 A;  2JGD B;  1JFF A;  3AEI A;  2C2A A;  2UXN A;  1NR7 A;  1HNX B;  3AK1 A;  4NXN O;  2PI4 A;  2OCH A;  1YXB A;  4RWU A;  2QR4 A;  5CBF A;  2F95 B;  3OTO B;  1DF5 A;  1D2D A;  2WSS G;  1Q8I A;  4DV4 O;  2UXB B;  2VQE O;  3FB5 C;  4ABM A;  2CTQ A;  4F4L A;  2GV9 A;  2NLJ C;  5E1A C;  4DV6 B;  1WB8 A;  2HVK C;  3OUF A;  4GZR B;  2F4V B;  1PNL A;  1IBL O;  1I94 O;  1FXK B;  5JQG A;  4Z1V A;  2YEV B;  1VP7 A;  3T4Z A;  4KL1 A;  1SA0 A;  1AI5 A;  2EIK B;  3CCV V;  3OMI B;  5B1B C;  4XDJ A;  2FTK A;  3I56 V;  5KAF Z;  2PYL A;  1N8R W;  4I4T B;  4KHP B;  1W0J G;  3B09 A;  3ZS8 C;  5JVD B;  2BOC C;  2CE4 A;  1Y74 A;  1FFT B;  1FXH A;  3B2E E;  4FMT A;  2XAG A;  4QNH B;  4JI5 B;  1GMG A;  5DM6 V;  1N34 O;  1DTO A;  4DUZ B;  1XMQ O;  2Q73 A;  3WG7 B;  1IJG A;  3CRR A;  4P9P A;  5GW7 A;  1BQ0 A;  1R3J C;  1I08 A;  1FFX A;  2GHY A;  4JAA A;  4R8C A;  2E5L B;  4CC5 A;  2EIL C;  1JFF B;  5KA5 A;  5J2T B;  5L3C A;  3OGC C;  2BE3 A;  5JJE B;  5KHG A;  1AJQ A;  2V4D A;  3JD1 A;  4X1Y A;  3ABL C;  1Q86 W;  3CEI A;  2LFR A;  5EYP A;  2JK5 C;  4FM2 A;  3RYI A;  1GM9 A;  4LF4 O;  2Y69 C;  3LDE A;  4O4L A;  4MVR A;  2R9A A;  3A0H Z;  3UCS C;  4MSW C;  5LL6 Y;  4J11 A;  2ADP A;  4WFF A;  5H9C A;  4LFC O;  2ZM6 O;  4JAS A;  2LFS A;  5JQG B;  1ZTE A;  5EBL C;  3E8H A;  2DYR C;  4LFA O;  1DK1 A;  1JJO A;  3BAB A;  4TOI A;  2RQ6 A;  4C7U A;  2AXT Z;  2EZO A;  2P90 A;  1SA0 B;  2HR3 A;  2ZDI C;  4RUE A;  3G4S V;  4UV8 A;  1E1Q G;  1MMM A;  1XMO O;  4MTF A;  4NR1 A;  5KUM A;  3FAV A;  5F2V O;  5B5E Z;  1A32 A;  1Y74 B;  1YDX A;  4JI6 O;  3AG7 A;  3SYA A;  4OXS A;  2ZXW B;  3PJS K;  4QPJ A;  5ITZ A;  1QR9 A;  5FPR A;  2W0F C;  1K5Q A;  1R6K A;  1S5J A;  5FPO A;  1OCZ B;  1XHX A;  4J80 A;  1FFX B;  4FM1 A;  3T2M A;  1QLE C;  4JF3 A;  4BAY A;  2P7T C;  5K1X A;  3ZN1 A;  4B08 A;  4B3M O;  1K92 A;  1SF9 A;  1XMQ B;  4ZOL A;  1VQO V;  2WLM A;  3DC5 A;  4QIW F;  1RM1 C;  4CBC A;  5HFM A;  2M7W A;  2Y48 A;  4X1Y B;  4UCR A;  2EIN B;  3HR0 A;  5EYP B;  3RYI B;  4J42 A;  5GON A;  4MVU A;  4CC6 A;  1Q6I A;  2F43 G;  4O4L B;  2JRI A;  3K9S A;  1Y67 A;  4FLT A;  1AJP A;  4ZKI A;  3ZMS A;  5IE9 A;  5B1O A;  1JX9 A;  5IYZ B;  3CRQ A;  1W2B U;  4LNU A;  1Z5W A;  1GRJ A;  1FKA O;  1KP2 A;  2XAH A;  4X62 O;  4JZG A;  1VMG A;  3ZX6 A;  4JI2 O;  1NJI W;  3AG1 C;  2PZS A;  5LMU B;  2ITD C;  2HLD G;  4IGG A;  4LF8 O;  3ZMV A;  4B7E A;  2WLI A;  3B8N A;  3H1L H;  2MK3 A;  3FAV B;  3SYC A;  1IBK O;  1ZSP A;  3LSS A;  4NTY A;  3ZRX A;  3RFR A;  1H2K A;  2Y4T A;  5ITZ B;  2CTP A;  1PD3 A;  3CD6 V;  3BEH A;  2YXY A;  4PDM A;  1Q7Y W;  2QSA A;  3KZI Z;  4PI0 A;  2QWR B;  3EHB B;  1H8E G;  1PL0 A;  1PL4 A;  1RPR A;  1JNB A;  3OR7 C;  2QKS A;  2UU9 O;  2ZNJ A;  4NXM O;  1D5N A;  2QTS A;  3AG2 B;  2IM9 A;  3DGE A;  3K59 A;  1L0L H;  4PA3 A;  5LHH A;  2WA4 A;  3TXQ A;  1NI8 A;  4X8A A;  4ZOL B;  3JAL B;  4FLV A;  2GBO A;  3RYC A;  4DYL A;  4LF5 B;  2Z5U A;  3OTF A;  3ZHV A;  4DR3 O;  2Q67 A;  1SQB H;  1OCR B;  3SGI A;  1XHZ A;  2CGO A;  4RQF A;  4JI0 O;  1HR0 O;  1K8A W;  1XNR O;  1YVW A;  1HP8 A;  1AP5 A;  1HDJ A;  4PI2 A;  4X20 B;  5B1A C;  3D36 C;  3E35 A;  3ZRW A;  1K7D A;  4LNU B;  4X66 O;  4DV1 B;  3A0R A;  4MVS A;  3SJA C;  3JAR A;  1JR9 A;  2HHH B;  4GKK O;  1L1F A;  2WLI B;  4PA6 A;  3MHS C;  4DK1 A;  2ZE7 A;  1JA8 A;  2PYJ A;  4JYA O;  4EEQ A;  5KMG A;  4ZIB A;  4X62 B;  3JSL A;  4JI2 B;  3J81 N;  1NTZ H;  2W0X A;  3S3W A;  4A5U B;  3D3Q A;  4NKG B;  1HWY A;  1GKF A;  1DLB A;  2KG7 B;  2ATK C;  3FB6 C;  2YSU B;  5B1B B;  2DN9 A;  3P3P A;  4WFA V;  4UB6 Z;  3P30 A;  3SR2 C;  2A0L A;  3BY6 A;  3LSU A;  1ROP A;  2LO1 A;  3AG4 C;  3RW0 A;  4LF9 O;  3CWB H;  4DR7 B;  3RYC B;  4JYY A;  2ZCE A;  4FVM A;  2HP8 A;  3RBZ A;  4JI7 O;  3X2Q C;  4O4I A;  2EJ7 A;  4NXM B;  1G4Y B;  1QU7 A;  3BA9 A;  3F5T A;  4AQY B;  2ZE5 A;  2HFE C;  5K1P A;  3JAW A;  2IH1 C;  3ETE A;  2JJ2 G;  4I0X A;  1N33 B;  3I55 V;  4JTD B;  3ZRW B;  2EIL B;  4BW5 A;  4OX9 O;  1QBZ A;  3E8G A;  2P6J A;  1S76 D;  2YID A;  3QO5 A;  1BQZ A;  3F7Y C;  3JAR B;  1PV0 A;  2AZ0 A;  1E1R G;  2OIG A;  3IC7 A;  1J5E O;  1OJH A;  1XNQ B;  1HR0 B;  2JIZ G;  3ABL B;  4UCU A;  1XNR B;  3BRC A;  1KD1 W;  2B1G A;  4NB5 A;  1IVS A;  1WB7 A;  4QPK A;  4FK5 C;  3TET A;  4DR6 B;  2Y69 B;  2YXL A;  5KAI Z;  2QWQ B;  4LF6 O;  5KMG B;  1NTK H;  1OCC C;  1WA8 A;  5DN6 G;  2OCC C;  1HNW O;  1IX9 A;  3RYF B;  4ASU G;  2P67 A;  2ZT9 B;  5CMU A;  3VQV A;  1R3L C;  2DYR B;  4GX0 A;  1JMK C;  3CRA A;  3E22 A;  4MW3 A;  2VWJ A;  1TA8 A;  2V1D A;  1BE3 H;  1YSC A;  4GLX A;  1IUR A;  3R65 A;  5C8Y A;  1X4T A;  4U7O A;  1JCH A;  1SKV A;  4GT1 A;  3CCR V;  1AIL A;  1SER A;  4JI3 B;  4X1I A;  5B3S C;  4X64 O;  4O4I B;  2P22 C;  2NN4 A;  1F4N A;  3GWK C;  4UVA A;  3K3W A;  3NR7 A;  3G71 V;  4X65 B;  3K04 A;  3JAW B;  4MTO A;  1QLE B;  3GB7 C;  4I0X B;  2PI5 A;  2LW7 A;  4DR1 O;  3ZHQ A;  1M56 C;  4JI7 B;  5IJ0 B;  3K58 A;  1AR4 A;  4N23 A;  2QTO A;  1F23 A;  4J7Z A;  2R70 A;  3QF7 A;  2ZE6 A;  3O9O A;  3PN1 A;  1RM1 B;  1H2S B;  1S5L Z;  3JD3 A;  3JCZ A;  1SQX H;  2UXC O;  1XL6 A;  2W6J G;  3K5O A;  2DQ0 A;  4TV8 A;  2JGU A;  4JI1 O;  2WLK A;  1AP6 A;  3L75 H;  4BR6 A;  4OX9 B;  1WA8 B;  1V55 C;  3MHH C;  2WLL A;  3D36 A;  4L8J A;  3STL C;  2XT9 A;  1BZK A;  2PUS A;  3GVM A;  4GX2 A;  3WB0 A;  2RDC A;  3M99 B;  3FD9 A;  4MT8 A;  1Q82 W;  3ZRS A;  3CCE V;  2NR5 A;  3AG1 B;  1CEZ A;  4LF6 B;  4K0K B;  5LOV A;  2UXD O;  1EZV H;  5CA0 B;  3VQY A;  1R6T A;  1LR1 A;  4DR2 B;  1HNW B;  4L87 A;  2HEP A;  4I7Z B;  2XTA A;  2A9H A;  2EIM C;  2QM8 A;  3B4S A;  1TUE B;  4X1I B;  1B06 A;  3ZCC A;  1NTM H;  1FJG B;  1N4C A;  4JV5 O;  1BMF G;  1J95 A;  3A0B Z;  4GKJ B;  1ZUQ A;  4G2K A;  5J9P C;  3G67 A;  1IDS A;  5IY5 C;  5A2Q N;  1URF A;  1AR5 A;  3OM3 B;  2VQF O;  2F66 C;  2XAJ A;  4OPH A;  4UB8 Z;  2V7Q G;  4J9Y B;  2A7W A;  3K5M A;  1KUQ A;  1KP3 A;  3K0D A;  3KDR A;  5AG2 A;  4X88 A;  2GUZ A;  4UVB A;  3CHX A;  1YTF B;  4TV8 B;  1H2L A;  1QVG U;  2QWO B;  2ZR2 A;  1YJN V;  5LMN O;  2Q7H A;  2B5U A;  1UFI A;  3ETG A;  4J10 A;  4JI4 O;  4YJ2 A;  3T1Y B;  1P4R A;  3P32 A;  3RVZ A;  2WLL B;  4DV3 O;  1GM7 A;  5B1A B;  5CB4 B;  3DXR A;  1AI7 A;  4I55 A;  2ZE8 A;  2VS0 A;  3QO7 A;  1GN4 A;  3SYQ A;  5IYC O;  4DV7 O;  1F51 A;  3KCY A;  5J2U B;  2YXH A;  1THZ A;  4TT3 G;  4PDL A;  3RWR D;  2UUC O;  3ZMT A;  4LFB O;  4HBN A;  4X89 A;  5IWA O;  3F7V C;  4O4J B;  3ML0 A;  1RFY A;  1KQS U;  2ZD9 A;  1B04 A;  1GN2 A;  1MNG A;  3H1K H;  2UUB O;  4B3S O;  5IYB O;  1NVP B;  4GX1 A;  1Q43 A;  4DV2 O;  5D5Q A;  1JQ0 A;  4YHH O;  3LUT B;  1M4U A;  1M9N A;  4FZ1 A;  1G6U A;  3SJQ C;  1JVM A;  4YY3 O;  2X6B A;  4DO2 A;  2O57 A;  1HNZ O;  4FLW A;  3OR6 C;  3AG4 B;  3SPH A;  2WA3 A;  4NXN B;  3QO8 A;  2A79 B;  1KU9 A;  3CXC U;  3X2Q B;  2Q6A A;  2GUZ B;  4F6R A;  4LP8 A;  3L74 H;  4KUM A;  4ICG A;  3G80 A;  4HZ3 A;  2OIE A;  4R6Z A;  3RGB A;  4DV4 B;  3FFQ A;  2VQE B;  3W7U A;  1YTF D;  1N36 O;  2QWN B;  4K35 A;  2JVD A;  4YJ2 B;  4K8X A;  4DR4 O;  1Z2G A;  1COW G;  1K3E A;  2H94 A;  1N32 O;  1IBL B;  2CH7 A;  1Z5V A;  3DXR B;  1I94 B;  4R50 A;  3L72 H;  1ZWI C;  4CH4 A;  2FL4 A;  1HW7 A;  2G38 A;  3EFF K;  1U96 A;  1CXZ B;  2YIA A;  3SJC C;  2D2C B;  3H1J H;  4LF7 O;  2N74 A;  4JI4 B;  2E3C A;  1VQL V;  2X6C A;  2LQT A;  1M57 C;  1BSM A;  4JPR A;  2FYU H;  2EZP A;  3RYH A;  3UO2 A;  1OCC B;  2H3O A;  4PDV A;  1N34 B;  4DV7 B;  2OCC B;  1I7F A;  4CH5 A;  2QA4 V;  3HPL C;  3SPG A;  2RMK B;  5E79 Z;  4OPA A;  3E8F A;  1T5E A;  1AVM A;  4XDK A;  5EC1 C;  3E8B A;  4FM0 A;  1OV9 A;  2JDI G;  1NVP D;  3D8C A;  3OD4 A;  5IWA B;  2WLH A;  1TUB A;  3QG5 A;  3D3I A;  3CCS V;  5LBQ A;  3QTC A;  4KFM A;  5LGU A;  3H1I H;  1VQ7 V;  5LXT A;  5B3S B;  3T1H O;  2YUA A;  3WB2 A;  2QE7 G;  4WFG A;  4F6R B;  2IJJ A;  3UM7 A;  3K5L A;  2R72 A;  2VRZ A;  4NYK A;  5EK0 A;  4LF4 B;  3ZHT A;  3TCU A;  5EBW C;  1BCC H;  1FOU A;  4DV0 O;  2VWK A;  2CTR A;  3ASO C;  3JAK A;  4EKW A;  4LFC B;  2HJD A;  3ETQ A;  2ZM6 B;  3TXS A;  2CH7 B;  1M56 B;  4WBN A;  3ABK C;  4RQE A;  4UUJ C;  2NNU A;  4LFA B;  1KMI Z;  3OE7 G;  1LUV A;  5JCO A;  2GDS A;  1O9H A;  5H2F Z;  4JI8 O;  1XMO B;  3JD0 A;  1YIJ V;  4DR4 B;  3NXS A;  4F6E A;  4B3R O;  3RYH B;  4JI6 B;  3UQ8 A;  3HKD A;  3JD4 A;  4DV5 O;  2HVJ C;  1V55 B;  2DQ3 A;  4TQF A;  4GUN A;  5EBM C;  4DUY O;  2EJR A;  4LC1 A;  3FYI B;  3G6E V;  1FXV A;  4D6T H;  4LBE C;  2DMX A;  1Q3E A;  1TUB B;  4H33 A;  2IJK A;  2FB5 A;  4LH7 A;  1PM9 A;  5GON B;  2Y0P A;  1QHT A;  2OWO A;  2P06 A;  4B3M B;  1QLN A;  3ASN C;  4X1K A;  5LXT B;  2LGQ A;  4PD4 F;  2EIM B;  2A3Q A;  3CCQ V;  1G8M A;  2XAF A;  3HKC A;  3ABM C;  1TGO A;  2Q4P A;  2ZIM A;  5CN0 A;  5DEC A;  2K9P A;  2YC0 A;  3CJH A;  2ETN A;  2FML A;  1QVF U;  1YIT V;  3AK2 A;  1P7G A;  4B7K A;  5CA3 A;  2QGN A;  4LH6 A;  2AZ2 A;  5IY5 B;  2F93 B;  2D3O W;  3BFR A;  5LP6 C;  3ABT A;  4W4L A;  1K4D C;  4PA9 A;  3SYP A;  4WBN B;  1PP9 H;  1Y76 A;  1M1K W;  4CS2 A;  1ENV A;  3U11 A;  4I9W A;  2CDY A;  3BCC H;  5CBG A;  1BS3 A;  4O2A A;  5EIB D;  2OT5 A;  3SPJ A;  4LF8 B;  1I0H A;  4DV0 B;  5IYD O;  3OUS A;  5KHK A;  2ZR3 A;  1NR1 A;  2GTA A;  3MAQ A;  1IBK B;  4CS3 A;  1V54 C;  1OZ0 A;  2KSD A;  2BTQ A;  1XUQ A;  2AHZ A;  1WP8 A;  1PNM A;  1KB9 F;  2AGA A;  3CE2 A;  1VEW A;  1KYO F;  1AJN A;  2UU9 B;  2ITC C;  1EM1 A;  4HNA A;  2JEX A;  1QCE A;  1B3Q A;  4UFZ A;  4DR5 O;  2LW1 A;  4P2Z A;  2QM4 A;  3K0G A;  5FNV A;  4DV5 B;  2Q7G A;  3JYC A;  4I5S A;  1M5I A;  1M93 A;  3CCL V;  4DUY B;  1I5Y A;  3W7X A;  4X1K B;  2WLJ A;  3AK3 A;  3P3N A;  4DR3 B;  3HKC B;  3MDS A;  4J41 A;  3TGU H;  5JJN B;  3LSQ A;  1AI6 A;  3CJH B;  1XQ8 A;  4JI0 B;  4J7K A;  4YXW G;  1VF7 A;  4PA7 A;  3AG3 C;  3IFX A;  4DW1 A;  4J7J A;  1TAE A;  3SPI A;  3BA8 A;  4IT5 A;  2AW9 A;  2QKA A;  2P4V A;  4I50 A;  2X7R B;  1Y76 B;  2F23 A;  4X66 B;  4YIP A;  4B3T O;  1B6Q A;  2ILM A;  2IU3 A;  1OCO C;  4FZ0 A;  1H2N A;  4O2A B;  1P84 F;  1NQT A;  1PPJ H;  4GKK B;  4ZHQ A;  1P49 A;  3JAS A;  4UCS A;  4I9Q A;  3IJ4 A;  3IGA C;  1YHQ V;  4JYA B;  4X9Q A;  1VQ6 V;  2ARH A;  1GTO A;  3KG2 A;  4PA4 A;  2BTQ B;  2KQX A;  1N0N A;  2XUM A;  2M6Y A;  1V9P A;  3HKB A;  3RT3 C;  4HNA B;  1HNX O;  3LNM B;  1GO3 F;  2IBZ H;  5LHI A;  3E2E A;  5FNV B;  2RJZ A;  4NTX A;  3OTO O;  4UVC A;  4JTC B;  1M57 B;  4LF9 B;  1VQN V;  3EVK A;  4UCO A;  4E2L A;  4QGP A;  3UT5 A;  3W7T A;  4LWS A;  4EFE A;  1YF2 A;  2UXB O;  4IL6 Z;  3DTU B;  3ZIA G;  4OGQ B;  2LGW A;  1K73 W;  1NS1 A;  4DV6 O;  1XBL A;  3LDC A;  2F4V O;  1XOU A;  3WFV A;  1JJ2 U;  4EFB A;  1XI1 A;  1S5H C;  4IYH A;  3W7W A;  2RNB A;  3K03 A;  4U3F H;  2KKW A;  4PV1 B;  3EXA A;  2EX3 A;  3VQX A;  4I50 B;  1NZ6 A;  4FLU A;  3CXH F;  1EN4 A;  4MVO A;  4MS2 A;  1QQC A;  1FXK A;  3K06 A;  4AHC A;  1J5E B;  4BIO A;  2GSM B;  4RAI A;  3W7S A;  2DW4 A;  2FKX A;  2YEV A;  1H5W A;  4ZHQ B;  1LUW A;  4JI5 O;  4GCZ A;  3E22 B;  3JAS B;  5L3G A;  4DUZ O;  1RPO A;  1Q81 W;  3OT7 A;  1VQ4 V;  4K8Z A;  3ZN0 A;  3M7M X;  1WP7 A;  5C8Y B;  3ASO B;  3LNN A;  4B3T B;  3QNE A;  2K1E A;  4P30 A;  4QJF B;  5LP6 A;  4BIZ A;  4AIL C;  2HG5 C;  2E5L O;  2OTJ V;  2ZQM A;  3ABK B;  3HKB B;  4TSF G;  1GK9 A;  3ZHU A;  4DXW A;  4KXR A;  2DOS A;  2LJ2 A;  3FX7 A;  5FLX N;  4H44 B;  1VQK V;  3CP1 A;  2EIJ C;  1SQP H;  4MVM A;  1D5A A;  3UT5 B;  4LWS B;  2DWE C;  4FPP A;  1S77 D;  4PEL A;  1O9G A;  1FAF A;  4X64 B;  3CCU V;  5J2T A;  1VF5 B;  1CP9 A;  1M90 W;  1BHA A;  5JCO C;  4MVQ A;  1DF4 A;  2XAQ A;  3C3T A;  5LA6 A;  1XDC A;  1SQV H;  4DRX A;  3STZ C;  1QR8 A;  3N27 A;  2Q68 A;  4IYI A;  1NH2 B;  4UCV A;  1WAZ A;  1R3K C;  2LP7 A;  1VQ9 V;  2Q5Z A;  4DR1 B;  1GAX A;  2GTS A;  3LDD A;  2YIC A;  3ASN B;  4G28 B;  2B1I A;  2DE0 X;  3T4D A;  1I5X A;  4BW9 A;  1MOF A;  2N05 A;  2Z0A A;  2ODM A;  2UXC B;  1DGS A;  4BIU A;  3OW2 U;  3ABM B;  3B40 A;  4JAU A;  3ICX A;  4JI1 B;  5JH7 A;  4HYO A;  5C93 A;  1SRY A;  5LOV B;  4D7T A;  2UXX A;  3CC4 V;  2CAZ C;  4G27 B;  5BMV A;  2JEU A;  3Q4H A;  5LP6 B;  1H38 A;  1SQG A;  3O65 A;  1EN5 A;  2WAM A;  4BWA A;  1Q90 D;  4QE7 A;  1F7Y A;  4LR3 A;  4FFB A;  1KBH A;  3CRM A;  3FB8 C;  2Y0I A;  4CS4 A;  4Z2W A;  1E79 G;  4MVZ A;  2P4K A;  2MW2 B;  5BXZ A;  2Q69 A;  2UXD B;  1RSO A;  4JGS A;  4DK0 A;  3K08 A;  2YI9 A;  1R1B A;  3L73 H;  3APQ A;  1H2G A;  1V54 B;  1NT2 B;  2DYS C;  1XIL A;  3KCX A;  2ZIO A;  4JV5 B;  1ORQ C;  4IHJ A;  1WLE A;  4FLY A;  3BAA A;  1MZF A;  5KLV H;  1GN6 A;  1WN7 A;  5LA6 B;  1Y6X A;  4JYC A;  4R7C A;  4DRX B;  1PKX A;  3DC6 A;  1AR1 B;  5LMU O;  2CUG A;  3CCM V;  1VQ5 V;  2AHY A;  3B8M A;  2VQF B;  5CBH A;  1VF6 C;  1IXB A;  1G1X B;  1WPX A;  4FLZ A;  1QNM A;  5HFL A;  1NH2 D;  5IYZ A;  1IXM A;  2YDE A;  2DWD C;  1FPO A;  3N2K A;  2BOB C;  4I55 B;  4J9Z B;  4XBF A;  4QE9 A;  1K9M W;  2WWW A;  3J80 N;  2CGN A;  4NTW A;  5LMN B;  3OFN G;  1SZX A;  5JH7 B;  3GWO A;  1SS3 A;  2N04 A;  5L3E A;  3AG3 B;  2QJ1 A;  4DV3 B;  4UCT A;  5BMV B;  4DW0 A;  3Q4H B;  3H1H H;  1R3I C;  4IIJ A;  2PF4 E;  4FFB B;  1GN3 A;  5FL7 G;  1Y66 A;  1AI4 A;  1OCO B;  2IH3 C;  4LF5 O;  3E83 A;  3FKS G;  2E76 B;  1U97 A;  1RSO B;  3CME V;  4XDL A;  2UUC B;  2P5O A;  3JSN A;  4LFB B;  3K9A A;  4PDR A;  4RUF A;  5A9G A;  2XHB A;  2JS3 A;  2XND G;  5KUK A;  4H37 A;  5BR8 O;  4LCU C;  2UUB B;  4B3S B;  2B9Z A;  2W6I G;  3JAL A;  3OEE G;  4DV2 B;  3SYO A;  4YHH B;  1L0N H;  3CC7 V;  1S3J A;  3CC2 V;  4IHJ B;  4GX5 A;  3TK1 A;  3K79 A;  1TVK A;  1EBO A;  4DV1 O;  4YY3 B;  4CH6 A;  4AI8 A;  2EBO A;  1N0J A;  3C3S A;  2RCV A;  1HNZ B;  2HHH O;  2OTL V;  1BHB A;  4ZI7 A;  5GTI Z;  1NKD A;  4CZZ A;  2OYQ A;  4K3A A;  3WU2 Z;  1BL8 A;  4X20 A;  5D5P A;  1YJW V;  4TV9 A;  2X0L A;  1KEC A;  3N2K B;  2HJF C;  4WF9 V;  2YI8 A;  3J7A U;  3THO A;  1KC8 W;  1XL4 A;  1AB3 A;  3TJT A;  3CCJ V;  1P7B A;  3L9D A;  3N2G A;  4FFK A;  2Q8V A;  3JAT A;  1N36 B;  3BVO A;  1FS0 G;  3H01 A;  1ZLZ A;  4FIP C;  2BSK A;  2YIB A;  4JYB A;  4TQD A;  4WFE A;  1N32 B;  3CB2 A;  4IIJ B;  1UPG A;  3ETD A;  5TIS Z;  3SPC A;  4DR7 O;  3BHP A;  4H13 B;  3UO3 A;  3RVY A;  2WLN A;  4LF7 B;  4JAV A;  2JJ1 G;  1MA1 A;  2KG7 A;  1VAR A;  4RO2 A;  5KA6 A;  1L8D A;  1MZE A;  3CPW U;  1MSW D;  3ZHR A;  3ZRV A;  2L6L A;  4YIO A;  3ABU A;  4AQY O;  1VQP V;  1NBM G;  2IJH A;  2HKO A;  4MW8 A;  3HKE A;  1SZT A;  1N33 O;  4U3J A;  1YEW A;  2L35 A;  4JZ2 A;  1FXK C;  2XAS A;  1R6N A;  3DSQ A;  4EB6 A;  3JCU Z;  1TVK B;  4O2B A;  3R66 A;  1EN6 A;  2QEX V;  2Y4U A;  2EIK C;  5EZY A;  1WJZ A;  2R9R B;  5BR8 B;  5GTH Z;  1JPX A;  1XNQ O;  4ZI7 B;  1F4M A;  2EIJ B;  1KKD A;  1EFR G;  1H8H G;  2E74 B;  3JAK B;  1SES A;  4PHZ A;  4WFB V;  2JS5 A;  4DR6 O;  5KHH A;  4TV9 B;  4TUY A;  3T1H B;  3K57 A;  4UXN A;  5LGN A;  2QM7 A;  3ZED A;  3WG7 C;  4W4K A;  4NVP A;  3N2G B;  1VQ8 V;  2IU0 A;  3JAT B;  2Q7E A;  3VQW A;  1KKC A;  3OEH G;  2QKC A;  4FJC C;  2BSK B;  4JTA B;  2PY5 A;  1FD9 A;  1XRE A;  4P9O A;  5H6Q A;  1VF6 A;  1SQQ H;  3QVN A;  3HKD B;  3RN4 A;  1H2M A;  3RYF A;  5B66 Z;  3SDL A;  1Q6H A;  2WPD G;  1PNK A;  2H8P C;  4JI3 O;  1YZB A;  1MG1 A;  3A8T A;  5JJJ B;  1UJW B;  3F5W C;  4JI8 B;  5KHI A;  2ZDI A;  4B3R B;  2Q0O C;  5LYJ A;  3BPZ A;  1BGY H;  2YS8 A;  1Q6U A;  1K34 A;  2KB1 A;  1MAB G;  2F1M A;  4X65 O;  2ZNI A;  1X59 A;  2ZIN A;  3HKE B;  1R73 A;  2RN9 A;  4U3J B;  1Q5O A;  1OHH G;  3H9V A;  4EB6 B;  3I5D A;  4O2B B;  3VOU A;  3L70 H;  1IBM O;  4U7N A;  5EZY B;  3ZMZ A;  4CH3 A;  2DJV A;  4ZBM A;  2IJI A;  4FLX A;  4TUY B;  1XEQ A;  2Q9L A;  3L71 H;  5L3B A;  2ZKO A;  5IJ0 A;  2DYS B;  1ARO P;  1US6 A;  2E75 B;  1ZL8 A;  2ZXW C;  3ZHS A;  1YJ9 V;  1ZX3 A;  2QWP B;  5LGT A;  3VBB A;  1SQF A;  3IAY A;  5IJ9 A;  4WCE V;  1CPY A;  3E86 A;  3OGI B;  3UKM A;  1OCZ C;  5JWP A;  4GYC B;  1S72 V;  3CMA V;  3G6B A;  3U0Z A;  1ZAU A;  4N21 A;  3ZJZ A;  4K0K O;  3K5N A;  3M8A A;  1NU1 H;  2UUA O;  4Q6G A;  4Q20 A;  1EZJ A;  3ZBH A;  4DR2 O;  2CTW A;  2YIB D;  3APO A;  1VIB A;  1LNQ A;  4TWK A;  3S3X A;  2A06 H;  5CA1 A;  5DED A;  3CX5 F;  1RP3 B;  1WNS A;  1FJG O;  3IC9 A;  3KKY A;  1VQM V;  2EIN C;  5LYJ B;  4E4E A;  4GKJ O;  3JD2 A;  3CSX A;  4YJ3 A;  5KX5 A;  5CA0 A;  4UV9 A;  5LHG A;  1MSD A;  4HAM A;  2PGG A;  3FB7 C;  2QDO A;  3ZMU A;  3E89 A;  4O4H A;  3A2F A;  2JGD A;  5H6R A;  5IDJ A;  1WPB A;  5B1N A;  2BCC H;  4KP4 A;  4DR5 B;  5BY1 A;  1GH6 A;  5EIB C;  3SJB C;  5BZB A;  3T1C A;  1ZL8 B;  4PJ0 Z;  3CYO A;  1S0V A;  4KHP O;  5L3F A;  1YCI A;  3T1Y O;  5IT9 N;  1IBM B;  2Q0A A;  2ADQ B;  2X6A A;  5IJ9 B;  3HB3 B;  5EC2 C;  1K4C C;  1W59 A;  1JOY A;  3OMN B;  3U10 A;  2PTM A;  1IZ3 A;  3MD0 A;  4H0L B;  1Y4M A;  2CK3 G;  1SET A;  1K97 A;  3AG2 C;  1SC5 B;  4MTG A;  3FYE B;  2EUL A;  2IW5 A;  5KHJ A;  4I4T A;  5JVD A;  2R9I A;  5CB4 A; 
#chains in the Genus database with same CATH homology
 1I08 A;  1XUQ A;  4F6E A;  1GN6 A;  1VEW A;  3DC6 A;  3DC5 A;  1KKC A;  2QKC A;  1EM1 A;  3EVK A;  1IXB A;  1BT8 A;  1AP5 A;  1AP6 A;  1QNM A;  4GUN A;  1XRE A;  3TJT A;  1GN4 A;  1BSM A;  4FFK A;  3C3T A;  4BR6 A;  1XDC A;  3QVN A;  3IC9 A;  3KKY A;  3K9S A;  1WB7 A;  1Y67 A;  1ZLZ A;  4E4E A;  3RN4 A;  3AK3 A;  3CEI A;  3MDS A;  1PM9 A;  1MSD A;  1JR9 A;  1SZX A;  3AK1 A;  1AVM A;  1IX9 A;  1GN2 A;  1MNG A;  4JZG A;  1JA8 A;  2ADP A;  1EN4 A;  1MA1 A;  1VAR A;  1GN3 A;  1ZTE A;  2AW9 A;  2QKA A;  1B06 A;  4C7U A;  1LUW A;  1ZSP A;  1WB8 A;  4YIP A;  3AK2 A;  1P7G A;  4YIO A;  1EN5 A;  3OT7 A;  1MMM A;  1ZUQ A;  3BFR A;  5A9G A;  2P4K A;  1IDS A;  4JZ2 A;  1AR5 A;  1PL4 A;  3LSU A;  2ADQ B;  2CDY A;  1EN6 A;  1BS3 A;  1D5N A;  4JYY A;  4X9Q A;  1I0H A;  2CE4 A;  1N0N A;  3KDR A;  5AG2 A;  1XIL A;  1LUV A;  1AR4 A;  1N0J A;  2GDS A;  3C3S A;  2RCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...