4FFKA

X-ray structure of iron superoxide dismutase from acidilobus saccharovorans
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
212
structure length
212
Chain Sequence
SVVSLKRYELPPLPYNYDALEPIISAETLRYHHDKHHLGYVNGANAALDKLEKYLNGQLTDIDVRAVSRDFEFNYGGHILHTLYWLNMAPKGKGGGTPGGAIGDAINKFFGSFDKFKKLFGDAAKNVEGVGWAILAYDPVTGDLRILQVEKHNNVVTTNLIPLLAVDVFEHAYYIDYRNDRAKYVDSWWDLINWDDVEARYQKALNTPKLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title X-ray structure of iron superoxide dismutase from Acidilobus saccharovorans
rcsb
source organism Acidilobus saccharovorans
molecule tags Oxidoreductase
total genus 78
structure length 212
sequence length 212
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4ffkA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4ffkA02
1BT8A 4E4EA 4JYYA 1KKCA 2ADQB 1BS3A 1AR5A 1VARA 3K9SA 2RCVA 2P4KA 5AG2A 3TJTA 2QKAA 1MA1A 3C3SA 3KKYA 3OT7A 1EM1A 1I0HA 1PM9A 3C3TA 1B06A 1QNMA 1JA8A 3DC5A 1EN6A 1LUWA 1MMMA 4JZGA 1N0JA 1WB7A 1PL4A 2CE4A 1D5NA 1Y67A 3AK1A 3EVKA 1ZSPA 1MSDA 1JR9A 1WB8A 2QKCA 1ZLZA 4BR6A 1XUQA 1EN4A 1GN3A 3BFRA 4FFKA 4GUNA 3MDSA 3QVNA 3LSUA 1VEWA 1ZUQA 2CDYA 1GN4A 1N0NA 2AW9A 1ZTEA 3IC9A 3DC6A 1I08A 4YIPA 2ADPA 1LUVA 1IXBA 1XREA 1GN6A 5A9GA 1P7GA 3CEIA 1AVMA 1AP5A 3AK3A 4YIOA 3AK2A 1BSMA 1IDSA 1XILA 4C7UA 1AR4A 1MNGA 1SZXA 4F6EA 4JZ2A 2GDSA 4X9QA 1AP6A 1GN2A 1IX9A 1EN5A 3RN4A 1XDCA
chains in the Genus database with same CATH superfamily
2E76B 3N2KA 4O4LA 4DRXA 4IIJA 4LH7A 3FFQA 3QO5A 1JOYA 4N23A 1V54B 4CC5A 5J2TA 5KHKA 1OZ0A 1SQPH 3HKCA 2VRZA 4DXWA 4UV8A 2ITDC 4X89A 3E86A 4FM2A 3U11A 5A2QN 2B1GA 1N32O 1S77D 1BL8A 2VQFO 4JI7O 3GB7C 2HHHB 2UU9O 1L0LH 5DECA 3CCQV 3FAVA 1VIBA 5LMUO 3U0ZA 1IURA 3CRCA 2CGOA 3JALA 5B3SB 1VQ6V 4ZHQB 5L3DA 2WLHA 3JARB 3QVNA 4B3RB 3K0GA 3B2EE 4FLZA 3ZHSA 2YIBA 3AG1B 1QLEC 2MK3A 2XASA 3APQA 4QPKA 2ZD9A 4FMTA 1LUVA 3CS5A 5LP6A 1GRJA 4J9YB 1Q6IA 4AI8A 3CX5F 1GM9A 2M7WA 2UXCB 2LFRA 2HG5C 2EINB 1FXKB 4CH3A 3OM3B 2YUAA 1JJOA 2P90A 1OCZC 3RVZA 4UV9A 4JI5O 4TV8B 2R9RB 5FNVB 3H1JH 4I55B 1KU9A 1XNQB 1J5EO 5C93A 1AJQA 2P4KA 1BCCH 4EB6B 4GKJO 2ATKC 2M6YA 3GVMA 3KKYA 4BIUA 1X4TA 1JFFB 3OAAG 3K57A 4FLXA 1IZ3A 2VQEO 1PD3A 4OXSA 3FD9A 2BOBC 1ZL8B 2AZ0A 1D5NA 4NB5A 4JI4B 1DF5A 4QIWF 4DR7O 4OX9B 3JARA 3C90A 2F4VO 2QWRB 4FIPC 5L3BA 4LR3A 3BFRA 2C2AA 2UUBO 4LCUC 1MZEA 4MVUA 4LC1A 3BAAA 4FLYA 2H94A 2AW9A 1MZFA 5D5PA 2CTPA 3EXAA 4I50B 3H1IH 1S0VA 1KP3A 2DN9A 2JJ1G 3FB5C 3SJQC 5IJ9B 2P5OA 4K0KO 4DR1B 1OCRC 3H01A 3ZIAG 1SERA 1Q43A 5IDJA 2X6BA 1GM7A 4TV8A 1MNGA 5EYPB 5K1PA 1WPBA 5FNVA 2Q0OC 4I55A 4LFCB 4TUYB 2UXXA 1XMQO 1H5WA 4X64B 4DR3B 3CMEV 3RN4A 4NXMB 4EB6A 2LQTA 3RBZA 5DM6V 1XDCA 1BT8A 4YY3B 2R72A 1JFFA 2R9AA 3SR2C 5L3GA 1VF6A 4NXNO 1ZL8A 2ZE5A 5EK0A 3F5WC 2JJ2G 3WB2A 4J10A 4UB8Z 4DV2O 2F43G 3DC5A 1EN6A 1OCCB 1N0JA 4A5UB 2CTQA 2WSSG 3Q4HB 4G28B 2QM8A 3NR7A 3K79A 3ABKC 4GX0A 2PZSA 1RM1C 1DF4A 2JS5A 4UCVA 3AG4C 2ZINA 1GMGA 1NTKH 3ZCCA 5IY5C 2GTAA 4TWKA 3BABA 3ZHVA 4DUYO 4Q20A 3CCEV 4I50A 1VP7A 1EN4A 1BHBA 4JYAO 5IJ9A 4CS4A 2AHYA 2YIAA 2WLIB 2CDYA 1N8RW 2CGNA 1RFYA 1N36B 2OIGA 1QLEB 4FM1A 3SPJA 1K97A 1V55B 5EC1C 5EYPA 3AEIA 4TUYA 2PY5A 1AP5A 2Y0IA 3N27A 4MTXA 1FJGO 1M1KW 1IDSA 4JI3O 1JX9A 1S5LZ 2LW1A 2W6JG 3W7XA 3R66A 2QA4V 5BR8B 4AQYB 3M7MX 1TUBB 1YTFB 1CP9A 5TISZ 2YI8A 4TSFG 4KXRA 3K58A 5JJEB 3OEEG 3UM7A 4FLUA 2YSUB 1AP6A 2RN9A 4X20B 1I5XA 4P9OA 2Q67A 3RVYA 1Q86W 1VQ5V 1XNRO 5IJ0B 2GTSA 4PA9A 4ZKIA 3A0RA 3W7TA 1HNWB 5EIBC 2DYRC 3TXSA 5F2VO 4GT1A 1U96A 4JASA 3T4DA 3ZMVA 3Q4HA 3EHBB 1WAZA 4MW8A 3M99B 4GCZA 4HAMA 1B06A 2Q7HA 3F7YC 1O9GA 3ICXA 1JNBA 3L73H 3K59A 4JZGA 4DW0A 4JI0O 3G6EV 5KA5A 4FM0A 2WA4A 3PJSK 3P3PA 3FX7A 1AI5A 3ZHTA 3FB6C 5D5QA 3ZN1A 2WLIA 1KQSU 3LNMB 2EBOA 5KHJA 2QKCA 3RYCB 4J7KA 2XOKG 5IWAB 3ZRWB 4DV1B 1GN3A 1W0KG 3QNEA 2EIJB 5BMVB 2QEXV 4JI6B 2KSDA 5K1XA 5JH7B 1UPGA 3VQYA 1VF7A 1Q8IA 3LDCA 2Y69C 2OCCB 1H2LA 3SDLA 1I08A 1F51A 1TUBA 4DO2A 4UVAA 2L35A 1XMQB 3E8FA 3JCUZ 4GX2A 2Q5ZA 4X20A 4GYCB 3ASNC 1TGOA 3ZX6A 3FB7C 5IJ0A 1KKDA 2JK5C 3E8GA 4X66O 3ABLB 4JGSA 2JVDA 2BCCH 4F6EA 3L70H 4X9QA 4FK5C 1PNLA 4KHPB 1M57B 1NS1A 2D2CB 5LYJB 4W4LA 3DXRB 3KCYA 4P30A 1EZJA 1SQQH 3ZHQA 4FLVA 1H2MA 1K92A 3ZHRA 1Q6HA 3DTUB 1GO3F 4DR2O 4D7TA 4JAAA 5EZYB 5CA3A 3J7AU 1VQ8V 4WFAV 1UJWB 1WA8B 3P30A 3ASOC 4GKKO 1SRYA 1KP2A 3RYCA 2UXDB 1PL4A 3ZRWA 1W59A 1B04A 1Y67A 2KKWA 2V4DA 3OTFA 5BMVA 1S76D 4D7SA 5JH7A 2FTKA 3BPZA 4MW3A 5LHHA 3O9OA 1R6KA 4DV6O 3AG4B 1YITV 2Q9LA 4JI1B 3RW0A 2VWJA 1KECA 2A0LA 1K7DA 3ZMSA 3CCUV 1N33B 3I56V 3OR7C 4B7KA 5B1NA 1M56B 3MD0A 1ZTEA 2PYJA 1WN7A 1GKFA 3CP1A 1XEQA 5CN0A 1QR9A 2P4VA 1OCOC 5E1AC 3B8NA 4NKGB 4WFHA 1TA8A 5JQGB 2ZXWB 1BMFG 1NH2D 5JCOA 4IL6Z 2ZNJA 5CB4B 5LYJA 2XT9A 2B5UA 1KB9F 3DXRA 3RYHB 3B4SA 1JPXA 1ROPA 1YHQV 2N04A 3LSQA 2A06H 3UQ8A 2VWKA 2JDIG 3RWRD 1IBLB 2DOSA 1K5QA 2A7WA 3RGBA 1M90W 5EZYA 4DV3B 2Y0PA 3AG2B 4RQEA 3JAMN 2QE7G 1WA8A 3IGAC 1JQ0A 2HFEC 2RCVA 3D8CA 4JI2B 1GTOA 2HR3A 1K34A 2E3CA 3C3TA 2UXBO 1XL6A 4J7ZA 5EBWC 5FLXN 4XBFA 5B1OA 3T1HB 3ABUA 1L0NH 4LF4O 4JTCB 3OTOB 4DR4O 2MW2B 1W0JG 5B1BC 1HNXB 3TXQA 3CC2V 1Z5WA 5JVDB 1NTMH 1FXVA 4FVMA 4NTXA 2ZCEA 3CJHB 3CE2A 5BZBA 4DR5B 2ZM6B 3TCUA 1EFRG 3LSUA 5LMNB 5JQGA 1HR0B 1P7BA 4LF5O 2HJFC 4MTOA 3ML0A 2RQ6A 3P3NA 5KUMA 3B77A 5CB4A 3OMAB 3RYHA 4TQDA 3KG2A 1A32A 1K9MW 2HJDA 5KX5B 4EKWA 2EX3A 3KZIZ 2UUAO 2EIMC 2XAQA 3QO7A 3K04A 3SPGA 3AG7A 2W0FC 4BWAA 1E1QG 5H2FZ 2DWEC 1AB3A 3F5TA 1VF5B 5GTHZ 5L3CA 2UXNA 2ITCC 1GH6A 4DUZO 3ZS8C 3OMNB 3X2QC 1NJIW 2FKXA 2Q0AA 2IH3C 4PV1B 1F4NA 3LSSA 4JV5B 1BS3A 1KC8W 2E74B 4O4IB 2EIKC 5AG2A 3K08A 3TETA 2YXHA 4X88A 1SQGA 1XMOO 1NZ6A 5JVDA 2FYUH 4D6TH 4B3MB 3STZC 1NR1A 3CJHA 1N34O 2K1EA 4GZRB 3I5DA 3AK1A 2QWPB 4J80A 4DK1A 4BW9A 1D2DA 4OGQB 1ZSPA 1XHZA 4B3TO 1PP9H 4F6RB 1K4CC 3SYPA 4RAIA 3K3WA 4X65O 1FFXB 4WCEV 4R7CA 4UUJC 5EIBD 1AR1B 5CBFA 1NBMG 2ZDIC 2IJHA 1R6NA 2ETNA 1QVFU 4DYLA 4O2AB 2O57A 3IC7A 4ABMA 5KX5A 4ZHQA 2CUGA 4Z1MG 4DR6B 4LP8A 4JAVA 2ADPA 2W6IG 4LF6O 4XDLA 3ZEDA 1IBKO 1WJZA 2UUCO 1US6A 4Z2WA 4ICGA 1HNZO 2PI4A 1SZTA 3B40A 2QSAA 3G67A 4LF8B 2QM7A 2GDSA 1AJPA 3S3WA 1IX9A 1V9PA 5CA1B 3FB8C 2GUZB 4O4IA 3SJAC 3E89A 3K5OA 4KFMA 1FXKA 4H33A 1KKCA 1Y74B 1IBMB 4HNAB 4IGGA 1Q5OA 2OT5A 2P7TC 4JTAB 3T1YO 4PDVA 5LL6Y 1I94O 5KA6A 2BE3A 1WLEA 2BSKB 2CAZC 4GX1A 5KAIZ 2LO1A 4KL1A 1KYOF 3K0DA 1YJNV 2AZ2A 4FJCC 2KQXA 4F6RA 2FMLA 3QF7A 1I7FA 3UKMA 4YJ3B 1L1FA 1AILA 1FFXA 2CE4A 3T2MA 3CPWU 1F4MA 3G4SV 2DJVA 5KMGB 3J80N 1YJ9V 3CC7V 2NNUA 2ZT9B 2OTJV 4UCSA 4O2AA 1N32B 4J9ZB 2VQFB 4JI7B 3WG7C 1BZKA 5H9CA 3PN1A 1RPRA 3SPIA 4I4TB 2UU9B 4LWSB 4O4HB 2EILC 1QHTA 4OPAA 2JGUA 4LF9O 5LMUB 2GHYA 5JJNB 1FAFA 2OYQA 2WLKA 4TT3G 1H8EG 4PA7A 4OPHA 1FOUA 1WNSA 5B1AC 4B08A 2X0LA 2NN4A 3ABMC 1Z2GA 4MTGA 1GM8A 3G80A 5A9GA 5LBQA 4ZBMA 5IYZB 4B3SO 3CCRV 1H2NA 2IU0A 3AK3A 5B66Z 1YIJV 4DV4O 4DV7O 3OE7G 2WPDG 3E22B 2GUZA 1YVWA 2Q7GA 1ORQC 4LFAO 3OUSA 3W7UA 4C7UA 1DLBA 4RWUA 4H13B 4YHHO 1Y74A 2LP7A 4JI8O 2IJIA 4HNAA 4AILC 5FL7G 1P84F 3ZN0A 2HVKC 3CC4V 4LH6A 3H1KH 2JEXA 3D3QA 2DYSC 3JD2A 2ZE8A 4X1YB 3THOA 3OEHG 2BSKA 3JSLA 3IJ4A 1K4DC 1XMOB 4JYBA 1Q3EA 3CCVV 1VARA 4JI5B 1YEWA 3K9SA 4YJ3A 5JJJB 2E5LO 2CTRA 1P49A 5GONB 2QKAA 2EIKB 3MHSC 1J5EB 1EM1A 4FLWA 3DSQA 1YXBA 1VQ4V 5CMUA 5KMGA 3E2EA 3UO2A 4CH4A 4GKJB 3CHXA 1OCZB 1LR1A 4U3JB 1LUWA 3WB1A 4X62O 2KG7B 4I4TA 3VBBA 4LWSA 2Y48A 2VQEB 4LF7O 2F1MA 4O4HA 3HKDB 5LGNA 3JD3A 2PI5A 4UB6Z 4JF3A 1YF2A 1NTZH 3BRCA 1R1BA 4BR6A 3ABTA 2Q7EA 2ZKOA 4DR7B 1E1RG 3W7SA 4K8ZA 2F4VB 2DMXA 1P4RA 1PPJH 2PUSA 2XUMA 3K5NA 5J9PC 3H1LH 1COWG 5IYZA 1JMKC 1GN4A 4WFEA 1BE3H 2UUBB 1QR8A 5L3EA 3E22A 3ETGA 3JSNA 1K8AW 2QM4A 5LXTB 4LFBO 2E75B 1S72V 2HVJC 1GN6A 1NH2B 2FB5A 1P7GA 3SJBC 1MABG 2IH1C 5IYDO 4DV5O 5KHHA 5CBHA 1CEZA 4K0KB 5CBGA 4X1YA 2DWDC 5KAFZ 4DV0O 1ZAUA 1HWYA 1XI1A 1V54C 1SZXA 1WP8A 4UXNA 1EN5A 2PGGA 5GONA 3BY6A 3P32A 1OCRB 4CS3A 3L74H 1AR5A 3D36C 4QJFB 2ZR2A 2XHBA 2IJKA 4CBCA 2LW7A 4NVPA 4J42A 4U3JA 3OR6C 1AI4A 1XQ8A 2KG7A 2A9HA 5EC2C 1M93A 4UVBA 5B3SC 2R9IA 3HKDA 2QR4A 2HP8A 4R6ZA 3CWBH 2RDCA 4X1IB 2ZIMA 4NXNB 1H8HG 4R8CA 4J7JA 3IAYA 3VOUA 2HHHO 1SC5B 5IYCO 1SS3A 4ZIBA 4N21A 4DV2B 4IYIA 4DK0A 2WLNA 3EVKA 2NLJC 1Q81W 3SPCA 1FXHA 3D3IA 4QGPA 4B3RO 4JPRA 3OGIB 3WG7B 2K9PA 5KHIA 2YICA 3CRQA 5LXTA 4FFKA 2ZE6A 1FPOA 4K3AA 3CSXA 4MVOA 2EILB 4DUYB 5CA0B 4Q6GA 3BVOA 2EINC 3CCSV 4IHJB 4JYAB 1S5JA 1XOUA 2W0XA 3IC9A 1R3JC 1GK9A 3S3XA 2Z5UA 3ABKB 1QLNA 4YIPA 3APOA 1RM1B 2UXCO 1H2SB 4TQFA 4U3FH 3ABMB 5IY5B 2XAGA 1GAXA 2ZQMA 3QO8A 3T4ZA 1N4CA 1BSMA 4KUMA 5HFMA 3HR0A 1VQOV 2Y4UA 2OIEA 1FJGB 4JI3B 1XL4A 2PYLA 5EBMC 5C8YB 3JYCA 3M8AA 1NR7A 2JIZG 5BY1A 3G6BA 2XTAA 2B1IA 4PHZA 3JCZA 2B9ZA 5J2UB 1XNQO 1VF6C 2DYSB 4E4EA 4JYYA 2EJ7A 3WFVA 3JATB 4HYOA 3RYIB 1XNRB 4X1IA 1Z5VA 5J2TB 1VQMV 1PKXA 2IJJA 1LNQA 2AXTZ 1OJHA 3C3SA 1HDJA 1VQKV 3ZMUA 4MVQA 1Q7YW 1Y4MA 4PI0A 1J95A 4JI4O 5LHGA 3JD0A 1FYJA 4OX9O 4R50A 4W4KA 1XHXA 3CCJV 4TV9B 1CPYA 4YJ2B 2ZNIA 5LHIA 1URFA 3UCSC 2ZIOA 2DYRB 4JI0B 5CA0A 1VQLV 4CZZA 2QGNA 3K06A 4IHJA 2YDEA 4E2LA 4BW5A 4MVZA 1IXMA 2F23A 3LDDA 4HBNA 1K3EA 3MDSA 5LGTA 1YI2V 3JD4A 2XAJA 2QWOB 1OHHG 4RUEA 4H37A 3DC6A 4DR1O 3CRMA 4MT8A 1PL0A 3UO3A 5EBLC 3E83A 4WFFA 4U7NA 2EZOA 4PI2A 5C8YA 3STLC 3A0HZ 2JEUA 4LFCO 2YEVB 2YS8A 5J2UA 3LUTB 3QTCA 3HB3B 4X64O 4DR3O 3E8HA 2ILMA 3JATA 4NXMO 1RP3B 3RYIA 2Y69B 4FZ0A 4YY3O 4X66B 3CMAV 1JJ2U 3FYIB 1WP7A 2F66C 3HKBB 4TOIA 3DGEA 5GTIZ 1OCCC 1G4YB 1YCIA 2ADQB 5KLVH 1B3QA 2KB1A 4XDKA 1QU7A 3L75H 4BIOA 3ASNB 4KP4A 2P6JA 5H6RA 4O2BB 2XAHA 4TV9A 3OT7A 1TVKB 5IYBO 4YJ2A 1QQCA 3K03A 1PM9A 1MSWD 1SA0B 1EZVH 1NVPD 3ZRVA 1SQFA 2R70A 1QNMA 1PV0A 5LA6B 1YSCA 1SQVH 3CB2A 4FLTA 4CC6A 3ZMZA 4DR2B 1KBHA 3IFXA 3FKSG 4PA4A 4PJ0Z 4AHCA 2LGQA 1CXZB 2IM9A 4GKKB 1V55C 3VQXA 3JASB 1FS0G 2HEPA 3HPLC 4NYKA 1XUQA 2EJRA 2F93B 2CTWA 4DV6B 1IVSA 1N36O 4RUFA 2NR5A 3ASOB 3BCCH 4ZI7B 1N0NA 1QVGU 1S5HC 4RQFA 2QTOA 2YEVA 3JAWB 1O9HA 3OW2U 2YI9A 3CRAA 4K35A 2QDOA 4I9QA 1XREA 1SESA 4UVCA 3JAKB 5ITZB 5BR8O 4ZOLB 2CK3G 4AQYO 2DE0X 3CCMV 3VQVA 3OUFA 3JD1A 2JGDB 5H6QA 1XILA 2OWOA 1T5EA 3HKBA 1R3LC 2ARHA 2ZR3A 3SPHA 3CRRA 3BA9A 4QE9A 1PNKA 4WF9V 2YIBD 4FFBB 3L72H 4I9WA 2JS3A 4QE7A 2YXYA 1K33A 3D36A 1GN2A 2L6LA 5E79Z 1G6UA 3QG5A 2N05A 1HNWO 1H2GA 4HZ3A 4O2BA 1OCOB 3GWKC 4EFBA 1TVKA 1JVMA 1SA0A 4G27B 4U7OA 2OCHA 4MVSA 4PA6A 1HP8A 5LA6A 1AJNA 2Q8VA 4WFBV 1PNMA 2A3QA 5LOVB 3G71V 3TJTA 1FD9A 4H0LB 4LBEC 4G2KA 4MTFA 2VS0A 3H1HH 3CXHF 2DQ0A 3VQWA 2EIJC 3E8BA 3JASA 1U97A 5HFLA 4P9PA 3CXCU 2HKOA 1JA8A 1SQBH 1M9NA 3U10A 1R3KC 1YZBA 3L9DA 2OCCC 2UXBB 1R3IC 4RO2A 1G1XB 2GSMB 1D5AA 3OFNG 3ETQA 1SKVA 5L3FA 5IWAO 4QPJA 4DV1O 2X7RB 4BIZA 2XNDG 4LF4B 4ZI7A 4JI6O 4DR4B 4F4LA 1MSDA 1WB8A 1ZLZA 2BTOA 3JAWA 1NI8A 2P22C 4GUNA 5DN6G 3ABLC 3JAKA 3ZJZA 3TK1A 5ITZA 1ZUQA 2IBZH 4ZOLA 3RFRA 1SETA 3WB0A 1KMIZ 2A79B 2JGDA 5FPOA 4PD4F 5B1BB 1K73W 1BHAA 1M57C 4O4JB 5JCOC 4LF5B 2Q73A 4FFBA 3AG3C 3O65A 1AVMA 2H3OA 3B8MA 3AK2A 3ZHUA 4X8AA 4MVRA 1AI6A 1SQXH 3SJCC 4I7ZB 1NU1H 1KUQA 2BOCC 4KHPO 4LNUB 4UCTA 2UUAB 4PELA 2GV9A 4GLXA 5LOVA 1DGSA 4WFGA 2QTSA 4UCRA 1ENVA 3CD6V 4DUZB 3A0BZ 4EFEA 3OMIB 5CA1A 1R73A 1FFTB 1Y6XA 2CH7B 4CH5A 1VQPV 1DK1A 2EIMB 2LGWA 2D3OW 1NQTA 2JRIA 4I0XB 1Q82W 1I0HA 3NXSA 2UXDO 3LDEA 3GWOA 2ZE7A 1K5SA 3X2QB 1MMMA 1M56C 1WB7A 2WAMA 3LNNA 2GBOA 1N34B 2Q4PA 4JI1O 4K8XA 2IW5A 1ZX3A 1BGYH 1QCEA 1G8MA 2LJ2A 4H44B 3E35A 1KD1W 1WPXA 1THZA 4MSWC 1N33O 4JAUA 3K5LA 4B3TB 3K9AA 1YJWV 2ZXWC 4O4JA 5B5EZ 3CYOA 3J81N 5JWPA 4YXWG 2YIDA 4X65B 1NKDA 3W7WA 2QWQB 3KCXA 3A8TA 1VQ9V 3SYAA 1ZWIC 1I5YA 4X1KB 4I5SA 1VMGA 1SF9A 4MS2A 5H5NA 1S3JA 2X6CA 4LNUA 1H2KA 3CEIA 5GW7A 2V1DA 2Q68A 1M4UA 1TAEA 2Q69A 4PDLA 4YIOA 3AG2C 1HW7A 1NT2B 4NTYA 1TUEB 4LF6B 2F95B 5LP6C 4BAYA 1IBKB 1L8DA 4QNHB 1IBLO 5IE9A 2WLMA 2Z0AA 4IT5A 2UUCB 4B7EA 4JZ2A 2CH7A 1HNZB 4DV3O 4MVMA 2PF4E 4PDMA 1R6TA 4IYHA 4I0XA 1E79G 1VQ7V 3KDRA 4JI2O 1RPOA 1FKAO 5BXZA 1DTOA 2HLDG 2IU3A 3RYFB 1EBOA 2ODMA 2WWWA 3T1HO 3T1YB 2Y4TA 1X59A 3OTOO 3SYOA 1I94B 1F7YA 3BHPA 4J11A 1HNXO 4L87A 1UFIA 4CH6A 1BQ0A 2WA3A 2V7QG 1AI7A 3FYEB 4DR5O 2ZM6O 3BA8A 1JR9A 3MAQA 3SGIA 5LMNO 3H9VA 3HKEB 1HR0O 4X1KA 1RSOB 3R65A 2XAFA 1VEWA 2Z3YA 3AG1C 2Q6AA 2BTQB 2RJZA 1M5IA 4LF9B 3OD4A 4JTDB 4WBNB 2RMKB 2YXLA 1QBZA 3B09A 2ZDIA 4UFZA 3EFFK 2QWNB 5KUKA 3T1CA 3BEHA 1MG1A 3AG3B 3ETDA 3UT5B 5KHGA 2EULA 4B3SB 1XBLA 1FXKC 4DV4B 4Z1VA 4DV7B 4LFAB 4JV5O 2WLJA 4YHHB 2DQ3A 3N2GB 4FZ1A 4JI8B 1YTFD 3RYFA 2N74A 2YC0A 5B1AB 4CS2A 4JYCA 1W2BU 4EEQA 3RT3C 3OGCC 1Y76B 2X6AA 1NVPB 2WLLB 5IT9N 4B3MO 1IJGA 3ZMTA 3TGUH 2PTMA 1MA1A 1Y66A 3N2KB 2E5LB 4O4LB 3ETEA 4DRXB 4IIJB 4XDJA 2FL4A 3K5MA 3ZBHA 2EZPA 3A2FA 4P2ZA 3CCLV 1BQZA 1JCHA 4NR1A 3HKEA 4PDRA 4GX5A 1RSOA 4X62B 1H38A 3L71H 3HKCB 2BTQA 4LF7B 4DW1A 3ZRXA 4ASUG 3F7VC 3SYQA 4WBNA 4UCUA 1AROP 2H8PC 5DEDA 1OV9A 2OTLV 2P06A 2G38A 2P67A 4DR6O 1YDXA 4FPPA 3FAVB 3WU2Z 3UT5A 3JALB 2AHZA 2QJ1A 4L8JA 5LGUA 1IXBA 1Q90D 2LFSA 4LFBB 4J41A 3SYCA 4UCOA 1MOFA 3N2GA 4LF8O 4NTWA 1Q6UA 2RNBA 1B6QA 4PA3A 1AR4A 5LP6B 3I55V 4DV5B 1VQNV 3MHHC 2QKSA 2DW4A 3ZRSA 1Y76A 4DV0B 1IBMO 1F23A 2WLLA 5FPRA 2AGAA
chains in the Genus database with same CATH topology
1BT8A 4E4EA 4JYYA 1KKCA 2ADQB 3KDRA 1BS3A 1AR5A 1VARA 3K9SA 2RCVA 2P4KA 5AG2A 3TJTA 2QKAA 1MA1A 3C3SA 3KKYA 3OT7A 1EM1A 1I0HA 1PM9A 3C3TA 1B06A 1QNMA 1JA8A 3DC5A 1EN6A 1LUWA 1MMMA 4JZGA 1N0JA 1WB7A 1PL4A 2CE4A 1D5NA 1Y67A 3AK1A 3EVKA 1ZSPA 1MSDA 1JR9A 1WB8A 2QKCA 1ZLZA 4BR6A 1XUQA 1EN4A 1GN3A 3BFRA 4FFKA 4GUNA 3MDSA 3QVNA 3LSUA 1VEWA 1ZUQA 2CDYA 1GN4A 1N0NA 2AW9A 1ZTEA 3IC9A 3DC6A 1I08A 4YIPA 2ADPA 1LUVA 1IXBA 1XREA 1GN6A 5A9GA 1P7GA 3CEIA 1AVMA 1AP5A 3AK3A 4YIOA 3AK2A 1BSMA 1IDSA 1XILA 4C7UA 1AR4A 1MNGA 1SZXA 4F6EA 4JZ2A 2GDSA 4X9QA 1AP6A 1GN2A 1IX9A 1EN5A 3RN4A 1XDCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BT8 A;  4E4E A;  4JYY A;  1KKC A;  2ADQ B;  1BS3 A;  1AR5 A;  1VAR A;  3K9S A;  2RCV A;  2P4K A;  5AG2 A;  3TJT A;  2QKA A;  1MA1 A;  3C3S A;  3KKY A;  3OT7 A;  1EM1 A;  1I0H A;  1PM9 A;  3C3T A;  1B06 A;  1QNM A;  1JA8 A;  3DC5 A;  1EN6 A;  1LUW A;  1MMM A;  4JZG A;  1N0J A;  1WB7 A;  1PL4 A;  2CE4 A;  1D5N A;  1Y67 A;  3AK1 A;  3EVK A;  1ZSP A;  1MSD A;  1JR9 A;  1WB8 A;  2QKC A;  1ZLZ A;  4BR6 A;  1XUQ A;  1EN4 A;  1GN3 A;  3BFR A;  4FFK A;  4GUN A;  3MDS A;  3QVN A;  3LSU A;  1VEW A;  1ZUQ A;  2CDY A;  1GN4 A;  1N0N A;  2AW9 A;  1ZTE A;  3IC9 A;  3DC6 A;  1I08 A;  4YIP A;  2ADP A;  1LUV A;  1IXB A;  1XRE A;  1GN6 A;  5A9G A;  1P7G A;  3CEI A;  1AVM A;  1AP5 A;  3AK3 A;  4YIO A;  3AK2 A;  1BSM A;  1IDS A;  1XIL A;  4C7U A;  1AR4 A;  1MNG A;  1SZX A;  4F6E A;  4JZ2 A;  2GDS A;  4X9Q A;  1AP6 A;  1GN2 A;  1IX9 A;  1EN5 A;  3RN4 A;  1XDC A; 
#chains in the Genus database with same CATH topology
 2E76 B;  3N2K A;  4O4L A;  4DRX A;  4IIJ A;  4LH7 A;  3FFQ A;  3QO5 A;  1JOY A;  4N23 A;  1V54 B;  4CC5 A;  5J2T A;  5KHK A;  1OZ0 A;  1SQP H;  3HKC A;  2VRZ A;  4DXW A;  4UV8 A;  2ITD C;  4X89 A;  3E86 A;  4FM2 A;  3U11 A;  5A2Q N;  2B1G A;  1N32 O;  1S77 D;  1BL8 A;  2VQF O;  4JI7 O;  3GB7 C;  2HHH B;  2UU9 O;  1L0L H;  5DEC A;  3CCQ V;  3FAV A;  1VIB A;  5LMU O;  3U0Z A;  1IUR A;  3CRC A;  2CGO A;  3JAL A;  5B3S B;  1VQ6 V;  4ZHQ B;  5L3D A;  2WLH A;  3JAR B;  3QVN A;  4B3R B;  3K0G A;  3B2E E;  4FLZ A;  3ZHS A;  2YIB A;  3AG1 B;  1QLE C;  2MK3 A;  2XAS A;  3APQ A;  4QPK A;  2ZD9 A;  4FMT A;  1LUV A;  3CS5 A;  5LP6 A;  1GRJ A;  4J9Y B;  1Q6I A;  4AI8 A;  3CX5 F;  1GM9 A;  2M7W A;  2UXC B;  2LFR A;  2HG5 C;  2EIN B;  1FXK B;  4CH3 A;  3OM3 B;  2YUA A;  1JJO A;  2P90 A;  1OCZ C;  3RVZ A;  4UV9 A;  4JI5 O;  4TV8 B;  2R9R B;  5FNV B;  3H1J H;  4I55 B;  1KU9 A;  1XNQ B;  1J5E O;  5C93 A;  1AJQ A;  2P4K A;  1BCC H;  4EB6 B;  4GKJ O;  2ATK C;  2M6Y A;  3GVM A;  3KKY A;  4BIU A;  1X4T A;  1JFF B;  3OAA G;  3K57 A;  4FLX A;  1IZ3 A;  2VQE O;  1PD3 A;  4OXS A;  3FD9 A;  2BOB C;  1ZL8 B;  2AZ0 A;  1D5N A;  4NB5 A;  4JI4 B;  1DF5 A;  4QIW F;  4DR7 O;  4OX9 B;  3JAR A;  3C90 A;  2F4V O;  2QWR B;  4FIP C;  5L3B A;  4LR3 A;  3BFR A;  2C2A A;  2UUB O;  4LCU C;  1MZE A;  4MVU A;  4LC1 A;  3BAA A;  4FLY A;  2H94 A;  2AW9 A;  1MZF A;  5D5P A;  2CTP A;  3EXA A;  4I50 B;  3H1I H;  1S0V A;  1KP3 A;  2DN9 A;  2JJ1 G;  3FB5 C;  3SJQ C;  5IJ9 B;  2P5O A;  4K0K O;  4DR1 B;  1OCR C;  3H01 A;  3ZIA G;  1SER A;  1Q43 A;  5IDJ A;  2X6B A;  1GM7 A;  4TV8 A;  1MNG A;  5EYP B;  5K1P A;  1WPB A;  5FNV A;  2Q0O C;  4I55 A;  4LFC B;  4TUY B;  2UXX A;  1XMQ O;  1H5W A;  4X64 B;  4DR3 B;  3CME V;  3RN4 A;  4NXM B;  4EB6 A;  2LQT A;  3RBZ A;  5DM6 V;  1XDC A;  1BT8 A;  4YY3 B;  2R72 A;  1JFF A;  2R9A A;  3SR2 C;  5L3G A;  1VF6 A;  4NXN O;  1ZL8 A;  2ZE5 A;  5EK0 A;  3F5W C;  2JJ2 G;  3WB2 A;  4J10 A;  4UB8 Z;  4DV2 O;  2F43 G;  3DC5 A;  1EN6 A;  1OCC B;  1N0J A;  4A5U B;  2CTQ A;  2WSS G;  3Q4H B;  4G28 B;  2QM8 A;  3NR7 A;  3K79 A;  3ABK C;  4GX0 A;  2PZS A;  1RM1 C;  1DF4 A;  2JS5 A;  4UCV A;  3AG4 C;  2ZIN A;  1GMG A;  1NTK H;  3ZCC A;  5IY5 C;  2GTA A;  4TWK A;  3BAB A;  3ZHV A;  4DUY O;  4Q20 A;  3CCE V;  4I50 A;  1VP7 A;  1EN4 A;  1BHB A;  4JYA O;  5IJ9 A;  4CS4 A;  2AHY A;  2YIA A;  2WLI B;  2CDY A;  1N8R W;  2CGN A;  1RFY A;  1N36 B;  2OIG A;  1QLE B;  4FM1 A;  3SPJ A;  1K97 A;  1V55 B;  5EC1 C;  5EYP A;  3AEI A;  4TUY A;  2PY5 A;  1AP5 A;  2Y0I A;  3N27 A;  4MTX A;  1FJG O;  1M1K W;  1IDS A;  4JI3 O;  1JX9 A;  1S5L Z;  2LW1 A;  2W6J G;  3W7X A;  3R66 A;  2QA4 V;  5BR8 B;  4AQY B;  3M7M X;  1TUB B;  1YTF B;  1CP9 A;  5TIS Z;  2YI8 A;  4TSF G;  4KXR A;  3K58 A;  5JJE B;  3OEE G;  3UM7 A;  4FLU A;  2YSU B;  1AP6 A;  2RN9 A;  4X20 B;  1I5X A;  4P9O A;  2Q67 A;  3RVY A;  1Q86 W;  1VQ5 V;  1XNR O;  5IJ0 B;  2GTS A;  4PA9 A;  4ZKI A;  3A0R A;  3W7T A;  1HNW B;  5EIB C;  2DYR C;  3TXS A;  5F2V O;  4GT1 A;  1U96 A;  4JAS A;  3T4D A;  3ZMV A;  3Q4H A;  3EHB B;  1WAZ A;  4MW8 A;  3M99 B;  4GCZ A;  4HAM A;  1B06 A;  2Q7H A;  3F7Y C;  1O9G A;  3ICX A;  1JNB A;  3L73 H;  3K59 A;  4JZG A;  4DW0 A;  4JI0 O;  3G6E V;  5KA5 A;  4FM0 A;  2WA4 A;  3PJS K;  3P3P A;  3FX7 A;  1AI5 A;  3ZHT A;  3FB6 C;  5D5Q A;  3ZN1 A;  2WLI A;  1KQS U;  3LNM B;  2EBO A;  5KHJ A;  2QKC A;  3RYC B;  4J7K A;  2XOK G;  5IWA B;  3ZRW B;  4DV1 B;  1GN3 A;  1W0K G;  3QNE A;  2EIJ B;  5BMV B;  2QEX V;  4JI6 B;  2KSD A;  5K1X A;  5JH7 B;  1UPG A;  3VQY A;  1VF7 A;  1Q8I A;  3LDC A;  2Y69 C;  2OCC B;  1H2L A;  3SDL A;  1I08 A;  1F51 A;  1TUB A;  4DO2 A;  4UVA A;  2L35 A;  1XMQ B;  3E8F A;  3JCU Z;  4GX2 A;  2Q5Z A;  4X20 A;  4GYC B;  3ASN C;  1TGO A;  3ZX6 A;  3FB7 C;  5IJ0 A;  1KKD A;  2JK5 C;  3E8G A;  4X66 O;  3ABL B;  4JGS A;  2JVD A;  2BCC H;  4F6E A;  3L70 H;  4X9Q A;  4FK5 C;  1PNL A;  4KHP B;  1M57 B;  1NS1 A;  2D2C B;  5LYJ B;  4W4L A;  3DXR B;  3KCY A;  4P30 A;  1EZJ A;  1SQQ H;  3ZHQ A;  4FLV A;  1H2M A;  1K92 A;  3ZHR A;  1Q6H A;  3DTU B;  1GO3 F;  4DR2 O;  4D7T A;  4JAA A;  5EZY B;  5CA3 A;  3J7A U;  1VQ8 V;  4WFA V;  1UJW B;  1WA8 B;  3P30 A;  3ASO C;  4GKK O;  1SRY A;  1KP2 A;  3RYC A;  2UXD B;  1PL4 A;  3ZRW A;  1W59 A;  1B04 A;  1Y67 A;  2KKW A;  2V4D A;  3OTF A;  5BMV A;  1S76 D;  4D7S A;  5JH7 A;  2FTK A;  3BPZ A;  4MW3 A;  5LHH A;  3O9O A;  1R6K A;  4DV6 O;  3AG4 B;  1YIT V;  2Q9L A;  4JI1 B;  3RW0 A;  2VWJ A;  1KEC A;  2A0L A;  1K7D A;  3ZMS A;  3CCU V;  1N33 B;  3I56 V;  3OR7 C;  4B7K A;  5B1N A;  1M56 B;  3MD0 A;  1ZTE A;  2PYJ A;  1WN7 A;  1GKF A;  3CP1 A;  1XEQ A;  5CN0 A;  1QR9 A;  2P4V A;  1OCO C;  5E1A C;  3B8N A;  4NKG B;  4WFH A;  1TA8 A;  5JQG B;  2ZXW B;  1BMF G;  1NH2 D;  5JCO A;  4IL6 Z;  2ZNJ A;  5CB4 B;  5LYJ A;  2XT9 A;  2B5U A;  1KB9 F;  3DXR A;  3RYH B;  3B4S A;  1JPX A;  1ROP A;  1YHQ V;  2N04 A;  3LSQ A;  2A06 H;  3UQ8 A;  2VWK A;  2JDI G;  3RWR D;  1IBL B;  2DOS A;  1K5Q A;  2A7W A;  3RGB A;  1M90 W;  5EZY A;  4DV3 B;  2Y0P A;  3AG2 B;  4RQE A;  3JAM N;  2QE7 G;  1WA8 A;  3IGA C;  1JQ0 A;  2HFE C;  2RCV A;  3D8C A;  4JI2 B;  1GTO A;  2HR3 A;  1K34 A;  2E3C A;  3C3T A;  2UXB O;  1XL6 A;  4J7Z A;  5EBW C;  5FLX N;  4XBF A;  5B1O A;  3T1H B;  3ABU A;  1L0N H;  4LF4 O;  4JTC B;  3OTO B;  4DR4 O;  2MW2 B;  1W0J G;  5B1B C;  1HNX B;  3TXQ A;  3CC2 V;  1Z5W A;  5JVD B;  1NTM H;  1FXV A;  4FVM A;  4NTX A;  2ZCE A;  3CJH B;  3CE2 A;  5BZB A;  4DR5 B;  2ZM6 B;  3TCU A;  1EFR G;  3LSU A;  5LMN B;  5JQG A;  1HR0 B;  1P7B A;  4LF5 O;  2HJF C;  4MTO A;  3ML0 A;  2RQ6 A;  3P3N A;  5KUM A;  3B77 A;  5CB4 A;  3OMA B;  3RYH A;  4TQD A;  3KG2 A;  1A32 A;  1K9M W;  2HJD A;  5KX5 B;  4EKW A;  2EX3 A;  3KZI Z;  2UUA O;  2EIM C;  2XAQ A;  3QO7 A;  3K04 A;  3SPG A;  3AG7 A;  2W0F C;  4BWA A;  1E1Q G;  5H2F Z;  2DWE C;  1AB3 A;  3F5T A;  1VF5 B;  5GTH Z;  5L3C A;  2UXN A;  2ITC C;  1GH6 A;  4DUZ O;  3ZS8 C;  3OMN B;  3X2Q C;  1NJI W;  2FKX A;  2Q0A A;  2IH3 C;  4PV1 B;  1F4N A;  3LSS A;  4JV5 B;  1BS3 A;  1KC8 W;  2E74 B;  4O4I B;  2EIK C;  5AG2 A;  3K08 A;  3TET A;  2YXH A;  4X88 A;  1SQG A;  1XMO O;  1NZ6 A;  5JVD A;  2FYU H;  4D6T H;  4B3M B;  3STZ C;  1NR1 A;  3CJH A;  1N34 O;  2K1E A;  4GZR B;  3I5D A;  3AK1 A;  2QWP B;  4J80 A;  4DK1 A;  4BW9 A;  1D2D A;  4OGQ B;  1ZSP A;  1XHZ A;  4B3T O;  1PP9 H;  4F6R B;  1K4C C;  3SYP A;  4RAI A;  3K3W A;  4X65 O;  1FFX B;  4WCE V;  4R7C A;  4UUJ C;  5EIB D;  1AR1 B;  5CBF A;  1NBM G;  2ZDI C;  2IJH A;  1R6N A;  2ETN A;  1QVF U;  4DYL A;  4O2A B;  2O57 A;  3IC7 A;  4ABM A;  5KX5 A;  4ZHQ A;  2CUG A;  4Z1M G;  4DR6 B;  4LP8 A;  4JAV A;  2ADP A;  2W6I G;  4LF6 O;  4XDL A;  3ZED A;  1IBK O;  1WJZ A;  2UUC O;  1US6 A;  4Z2W A;  4ICG A;  1HNZ O;  2PI4 A;  1SZT A;  3B40 A;  2QSA A;  3G67 A;  4LF8 B;  2QM7 A;  2GDS A;  1AJP A;  3S3W A;  1IX9 A;  1V9P A;  5CA1 B;  3FB8 C;  2GUZ B;  4O4I A;  3SJA C;  3E89 A;  3K5O A;  4KFM A;  1FXK A;  4H33 A;  1KKC A;  1Y74 B;  1IBM B;  4HNA B;  4IGG A;  1Q5O A;  2OT5 A;  2P7T C;  4JTA B;  3T1Y O;  4PDV A;  5LL6 Y;  1I94 O;  5KA6 A;  2BE3 A;  1WLE A;  2BSK B;  2CAZ C;  4GX1 A;  5KAI Z;  2LO1 A;  4KL1 A;  1KYO F;  3K0D A;  1YJN V;  2AZ2 A;  4FJC C;  2KQX A;  4F6R A;  2FML A;  3QF7 A;  1I7F A;  3UKM A;  4YJ3 B;  1L1F A;  1AIL A;  1FFX A;  2CE4 A;  3T2M A;  3CPW U;  1F4M A;  3G4S V;  2DJV A;  5KMG B;  3J80 N;  1YJ9 V;  3CC7 V;  2NNU A;  2ZT9 B;  2OTJ V;  4UCS A;  4O2A A;  1N32 B;  4J9Z B;  2VQF B;  4JI7 B;  3WG7 C;  1BZK A;  5H9C A;  3PN1 A;  1RPR A;  3SPI A;  4I4T B;  2UU9 B;  4LWS B;  4O4H B;  2EIL C;  1QHT A;  4OPA A;  2JGU A;  4LF9 O;  5LMU B;  2GHY A;  5JJN B;  1FAF A;  2OYQ A;  2WLK A;  4TT3 G;  1H8E G;  4PA7 A;  4OPH A;  1FOU A;  1WNS A;  5B1A C;  4B08 A;  2X0L A;  2NN4 A;  3ABM C;  1Z2G A;  4MTG A;  1GM8 A;  3G80 A;  5A9G A;  5LBQ A;  4ZBM A;  5IYZ B;  4B3S O;  3CCR V;  1H2N A;  2IU0 A;  3AK3 A;  5B66 Z;  1YIJ V;  4DV4 O;  4DV7 O;  3OE7 G;  2WPD G;  3E22 B;  2GUZ A;  1YVW A;  2Q7G A;  1ORQ C;  4LFA O;  3OUS A;  3W7U A;  4C7U A;  1DLB A;  4RWU A;  4H13 B;  4YHH O;  1Y74 A;  2LP7 A;  4JI8 O;  2IJI A;  4HNA A;  4AIL C;  5FL7 G;  1P84 F;  3ZN0 A;  2HVK C;  3CC4 V;  4LH6 A;  3H1K H;  2JEX A;  3D3Q A;  2DYS C;  3JD2 A;  2ZE8 A;  4X1Y B;  3THO A;  3OEH G;  2BSK A;  3JSL A;  3IJ4 A;  1K4D C;  1XMO B;  4JYB A;  1Q3E A;  3CCV V;  1VAR A;  4JI5 B;  1YEW A;  3K9S A;  4YJ3 A;  5JJJ B;  2E5L O;  2CTR A;  1P49 A;  5GON B;  2QKA A;  2EIK B;  3MHS C;  1J5E B;  1EM1 A;  4FLW A;  3DSQ A;  1YXB A;  1VQ4 V;  5CMU A;  5KMG A;  3E2E A;  3UO2 A;  4CH4 A;  4GKJ B;  3CHX A;  1OCZ B;  1LR1 A;  4U3J B;  1LUW A;  3WB1 A;  4X62 O;  2KG7 B;  4I4T A;  3VBB A;  4LWS A;  2Y48 A;  2VQE B;  4LF7 O;  2F1M A;  4O4H A;  3HKD B;  5LGN A;  3JD3 A;  2PI5 A;  4UB6 Z;  4JF3 A;  1YF2 A;  1NTZ H;  3BRC A;  1R1B A;  4BR6 A;  3ABT A;  2Q7E A;  2ZKO A;  4DR7 B;  1E1R G;  3W7S A;  4K8Z A;  2F4V B;  2DMX A;  1P4R A;  1PPJ H;  2PUS A;  2XUM A;  3K5N A;  5J9P C;  3H1L H;  1COW G;  5IYZ A;  1JMK C;  1GN4 A;  4WFE A;  1BE3 H;  2UUB B;  1QR8 A;  5L3E A;  3E22 A;  3ETG A;  3JSN A;  1K8A W;  2QM4 A;  5LXT B;  4LFB O;  2E75 B;  1S72 V;  2HVJ C;  1GN6 A;  1NH2 B;  2FB5 A;  1P7G A;  3SJB C;  1MAB G;  2IH1 C;  5IYD O;  4DV5 O;  5KHH A;  5CBH A;  1CEZ A;  4K0K B;  5CBG A;  4X1Y A;  2DWD C;  5KAF Z;  4DV0 O;  1ZAU A;  1HWY A;  1XI1 A;  1V54 C;  1SZX A;  1WP8 A;  4UXN A;  1EN5 A;  2PGG A;  5GON A;  3BY6 A;  3P32 A;  1OCR B;  4CS3 A;  3L74 H;  1AR5 A;  3D36 C;  4QJF B;  2ZR2 A;  2XHB A;  2IJK A;  4CBC A;  2LW7 A;  4NVP A;  4J42 A;  4U3J A;  3OR6 C;  1AI4 A;  1XQ8 A;  2KG7 A;  2A9H A;  5EC2 C;  1M93 A;  4UVB A;  5B3S C;  2R9I A;  3HKD A;  2QR4 A;  2HP8 A;  4R6Z A;  3CWB H;  2RDC A;  4X1I B;  2ZIM A;  4NXN B;  1H8H G;  4R8C A;  4J7J A;  3IAY A;  3VOU A;  2HHH O;  1SC5 B;  5IYC O;  1SS3 A;  4ZIB A;  4N21 A;  4DV2 B;  4IYI A;  4DK0 A;  2WLN A;  3EVK A;  2NLJ C;  1Q81 W;  3SPC A;  1FXH A;  3D3I A;  4QGP A;  4B3R O;  4JPR A;  3OGI B;  3WG7 B;  2K9P A;  5KHI A;  2YIC A;  3CRQ A;  5LXT A;  4FFK A;  2ZE6 A;  1FPO A;  4K3A A;  3CSX A;  4MVO A;  2EIL B;  4DUY B;  5CA0 B;  4Q6G A;  3BVO A;  2EIN C;  3CCS V;  4IHJ B;  4JYA B;  1S5J A;  1XOU A;  2W0X A;  3IC9 A;  1R3J C;  1GK9 A;  3S3X A;  2Z5U A;  3ABK B;  1QLN A;  4YIP A;  3APO A;  1RM1 B;  2UXC O;  1H2S B;  4TQF A;  4U3F H;  3ABM B;  5IY5 B;  2XAG A;  1GAX A;  2ZQM A;  3QO8 A;  3T4Z A;  1N4C A;  1BSM A;  4KUM A;  5HFM A;  3HR0 A;  1VQO V;  2Y4U A;  2OIE A;  1FJG B;  4JI3 B;  1XL4 A;  2PYL A;  5EBM C;  5C8Y B;  3JYC A;  3M8A A;  1NR7 A;  2JIZ G;  5BY1 A;  3G6B A;  2XTA A;  2B1I A;  4PHZ A;  3JCZ A;  2B9Z A;  5J2U B;  1XNQ O;  1VF6 C;  2DYS B;  4E4E A;  4JYY A;  2EJ7 A;  3WFV A;  3JAT B;  4HYO A;  3RYI B;  1XNR B;  4X1I A;  1Z5V A;  5J2T B;  1VQM V;  1PKX A;  2IJJ A;  1LNQ A;  2AXT Z;  1OJH A;  3C3S A;  1HDJ A;  1VQK V;  3ZMU A;  4MVQ A;  1Q7Y W;  1Y4M A;  4PI0 A;  1J95 A;  4JI4 O;  5LHG A;  3JD0 A;  1FYJ A;  4OX9 O;  4R50 A;  4W4K A;  1XHX A;  3CCJ V;  4TV9 B;  1CPY A;  4YJ2 B;  2ZNI A;  5LHI A;  1URF A;  3UCS C;  2ZIO A;  2DYR B;  4JI0 B;  5CA0 A;  1VQL V;  4CZZ A;  2QGN A;  3K06 A;  4IHJ A;  2YDE A;  4E2L A;  4BW5 A;  4MVZ A;  1IXM A;  2F23 A;  3LDD A;  4HBN A;  1K3E A;  3MDS A;  5LGT A;  1YI2 V;  3JD4 A;  2XAJ A;  2QWO B;  1OHH G;  4RUE A;  4H37 A;  3DC6 A;  4DR1 O;  3CRM A;  4MT8 A;  1PL0 A;  3UO3 A;  5EBL C;  3E83 A;  4WFF A;  4U7N A;  2EZO A;  4PI2 A;  5C8Y A;  3STL C;  3A0H Z;  2JEU A;  4LFC O;  2YEV B;  2YS8 A;  5J2U A;  3LUT B;  3QTC A;  3HB3 B;  4X64 O;  4DR3 O;  3E8H A;  2ILM A;  3JAT A;  4NXM O;  1RP3 B;  3RYI A;  2Y69 B;  4FZ0 A;  4YY3 O;  4X66 B;  3CMA V;  1JJ2 U;  3FYI B;  1WP7 A;  2F66 C;  3HKB B;  4TOI A;  3DGE A;  5GTI Z;  1OCC C;  1G4Y B;  1YCI A;  2ADQ B;  5KLV H;  1B3Q A;  2KB1 A;  4XDK A;  1QU7 A;  3L75 H;  4BIO A;  3ASN B;  4KP4 A;  2P6J A;  5H6R A;  4O2B B;  2XAH A;  4TV9 A;  3OT7 A;  1TVK B;  5IYB O;  4YJ2 A;  1QQC A;  3K03 A;  1PM9 A;  1MSW D;  1SA0 B;  1EZV H;  1NVP D;  3ZRV A;  1SQF A;  2R70 A;  1QNM A;  1PV0 A;  5LA6 B;  1YSC A;  1SQV H;  3CB2 A;  4FLT A;  4CC6 A;  3ZMZ A;  4DR2 B;  1KBH A;  3IFX A;  3FKS G;  4PA4 A;  4PJ0 Z;  4AHC A;  2LGQ A;  1CXZ B;  2IM9 A;  4GKK B;  1V55 C;  3VQX A;  3JAS B;  1FS0 G;  2HEP A;  3HPL C;  4NYK A;  1XUQ A;  2EJR A;  2F93 B;  2CTW A;  4DV6 B;  1IVS A;  1N36 O;  4RUF A;  2NR5 A;  3ASO B;  3BCC H;  4ZI7 B;  1N0N A;  1QVG U;  1S5H C;  4RQF A;  2QTO A;  2YEV A;  3JAW B;  1O9H A;  3OW2 U;  2YI9 A;  3CRA A;  4K35 A;  2QDO A;  4I9Q A;  1XRE A;  1SES A;  4UVC A;  3JAK B;  5ITZ B;  5BR8 O;  4ZOL B;  2CK3 G;  4AQY O;  2DE0 X;  3CCM V;  3VQV A;  3OUF A;  3JD1 A;  2JGD B;  5H6Q A;  1XIL A;  2OWO A;  1T5E A;  3HKB A;  1R3L C;  2ARH A;  2ZR3 A;  3SPH A;  3CRR A;  3BA9 A;  4QE9 A;  1PNK A;  4WF9 V;  2YIB D;  4FFB B;  3L72 H;  4I9W A;  2JS3 A;  4QE7 A;  2YXY A;  1K33 A;  3D36 A;  1GN2 A;  2L6L A;  5E79 Z;  1G6U A;  3QG5 A;  2N05 A;  1HNW O;  1H2G A;  4HZ3 A;  4O2B A;  1OCO B;  3GWK C;  4EFB A;  1TVK A;  1JVM A;  1SA0 A;  4G27 B;  4U7O A;  2OCH A;  4MVS A;  4PA6 A;  1HP8 A;  5LA6 A;  1AJN A;  2Q8V A;  4WFB V;  1PNM A;  2A3Q A;  5LOV B;  3G71 V;  3TJT A;  1FD9 A;  4H0L B;  4LBE C;  4G2K A;  4MTF A;  2VS0 A;  3H1H H;  3CXH F;  2DQ0 A;  3VQW A;  2EIJ C;  3E8B A;  3JAS A;  1U97 A;  5HFL A;  4P9P A;  3CXC U;  2HKO A;  1JA8 A;  1SQB H;  1M9N A;  3U10 A;  1R3K C;  1YZB A;  3L9D A;  2OCC C;  2UXB B;  1R3I C;  4RO2 A;  1G1X B;  2GSM B;  1D5A A;  3OFN G;  3ETQ A;  1SKV A;  5L3F A;  5IWA O;  4QPJ A;  4DV1 O;  2X7R B;  4BIZ A;  2XND G;  4LF4 B;  4ZI7 A;  4JI6 O;  4DR4 B;  4F4L A;  1MSD A;  1WB8 A;  1ZLZ A;  2BTO A;  3JAW A;  1NI8 A;  2P22 C;  4GUN A;  5DN6 G;  3ABL C;  3JAK A;  3ZJZ A;  3TK1 A;  5ITZ A;  1ZUQ A;  2IBZ H;  4ZOL A;  3RFR A;  1SET A;  3WB0 A;  1KMI Z;  2A79 B;  2JGD A;  5FPO A;  4PD4 F;  5B1B B;  1K73 W;  1BHA A;  1M57 C;  4O4J B;  5JCO C;  4LF5 B;  2Q73 A;  4FFB A;  3AG3 C;  3O65 A;  1AVM A;  2H3O A;  3B8M A;  3AK2 A;  3ZHU A;  4X8A A;  4MVR A;  1AI6 A;  1SQX H;  3SJC C;  4I7Z B;  1NU1 H;  1KUQ A;  2BOC C;  4KHP O;  4LNU B;  4UCT A;  2UUA B;  4PEL A;  2GV9 A;  4GLX A;  5LOV A;  1DGS A;  4WFG A;  2QTS A;  4UCR A;  1ENV A;  3CD6 V;  4DUZ B;  3A0B Z;  4EFE A;  3OMI B;  5CA1 A;  1R73 A;  1FFT B;  1Y6X A;  2CH7 B;  4CH5 A;  1VQP V;  1DK1 A;  2EIM B;  2LGW A;  2D3O W;  1NQT A;  2JRI A;  4I0X B;  1Q82 W;  1I0H A;  3NXS A;  2UXD O;  3LDE A;  3GWO A;  2ZE7 A;  1K5S A;  3X2Q B;  1MMM A;  1M56 C;  1WB7 A;  2WAM A;  3LNN A;  2GBO A;  1N34 B;  2Q4P A;  4JI1 O;  4K8X A;  2IW5 A;  1ZX3 A;  1BGY H;  1QCE A;  1G8M A;  2LJ2 A;  4H44 B;  3E35 A;  1KD1 W;  1WPX A;  1THZ A;  4MSW C;  1N33 O;  4JAU A;  3K5L A;  4B3T B;  3K9A A;  1YJW V;  2ZXW C;  4O4J A;  5B5E Z;  3CYO A;  3J81 N;  5JWP A;  4YXW G;  2YID A;  4X65 B;  1NKD A;  3W7W A;  2QWQ B;  3KCX A;  3A8T A;  1VQ9 V;  3SYA A;  1ZWI C;  1I5Y A;  4X1K B;  4I5S A;  1VMG A;  1SF9 A;  4MS2 A;  5H5N A;  1S3J A;  2X6C A;  4LNU A;  1H2K A;  3CEI A;  5GW7 A;  2V1D A;  2Q68 A;  1M4U A;  1TAE A;  2Q69 A;  4PDL A;  4YIO A;  3AG2 C;  1HW7 A;  1NT2 B;  4NTY A;  1TUE B;  4LF6 B;  2F95 B;  5LP6 C;  4BAY A;  1IBK B;  1L8D A;  4QNH B;  1IBL O;  5IE9 A;  2WLM A;  2Z0A A;  4IT5 A;  2UUC B;  4B7E A;  4JZ2 A;  2CH7 A;  1HNZ B;  4DV3 O;  4MVM A;  2PF4 E;  4PDM A;  1R6T A;  4IYH A;  4I0X A;  1E79 G;  1VQ7 V;  3KDR A;  4JI2 O;  1RPO A;  1FKA O;  5BXZ A;  1DTO A;  2HLD G;  2IU3 A;  3RYF B;  1EBO A;  2ODM A;  2WWW A;  3T1H O;  3T1Y B;  2Y4T A;  1X59 A;  3OTO O;  3SYO A;  1I94 B;  1F7Y A;  3BHP A;  4J11 A;  1HNX O;  4L87 A;  1UFI A;  4CH6 A;  1BQ0 A;  2WA3 A;  2V7Q G;  1AI7 A;  3FYE B;  4DR5 O;  2ZM6 O;  3BA8 A;  1JR9 A;  3MAQ A;  3SGI A;  5LMN O;  3H9V A;  3HKE B;  1HR0 O;  4X1K A;  1RSO B;  3R65 A;  2XAF A;  1VEW A;  2Z3Y A;  3AG1 C;  2Q6A A;  2BTQ B;  2RJZ A;  1M5I A;  4LF9 B;  3OD4 A;  4JTD B;  4WBN B;  2RMK B;  2YXL A;  1QBZ A;  3B09 A;  2ZDI A;  4UFZ A;  3EFF K;  2QWN B;  5KUK A;  3T1C A;  3BEH A;  1MG1 A;  3AG3 B;  3ETD A;  3UT5 B;  5KHG A;  2EUL A;  4B3S B;  1XBL A;  1FXK C;  4DV4 B;  4Z1V A;  4DV7 B;  4LFA B;  4JV5 O;  2WLJ A;  4YHH B;  2DQ3 A;  3N2G B;  4FZ1 A;  4JI8 B;  1YTF D;  3RYF A;  2N74 A;  2YC0 A;  5B1A B;  4CS2 A;  4JYC A;  1W2B U;  4EEQ A;  3RT3 C;  3OGC C;  1Y76 B;  2X6A A;  1NVP B;  2WLL B;  5IT9 N;  4B3M O;  1IJG A;  3ZMT A;  3TGU H;  2PTM A;  1MA1 A;  1Y66 A;  3N2K B;  2E5L B;  4O4L B;  3ETE A;  4DRX B;  4IIJ B;  4XDJ A;  2FL4 A;  3K5M A;  3ZBH A;  2EZP A;  3A2F A;  4P2Z A;  3CCL V;  1BQZ A;  1JCH A;  4NR1 A;  3HKE A;  4PDR A;  4GX5 A;  1RSO A;  4X62 B;  1H38 A;  3L71 H;  3HKC B;  2BTQ A;  4LF7 B;  4DW1 A;  3ZRX A;  4ASU G;  3F7V C;  3SYQ A;  4WBN A;  4UCU A;  1ARO P;  2H8P C;  5DED A;  1OV9 A;  2OTL V;  2P06 A;  2G38 A;  2P67 A;  4DR6 O;  1YDX A;  4FPP A;  3FAV B;  3WU2 Z;  3UT5 A;  3JAL B;  2AHZ A;  2QJ1 A;  4L8J A;  5LGU A;  1IXB A;  1Q90 D;  2LFS A;  4LFB B;  4J41 A;  3SYC A;  4UCO A;  1MOF A;  3N2G A;  4LF8 O;  4NTW A;  1Q6U A;  2RNB A;  1B6Q A;  4PA3 A;  1AR4 A;  5LP6 B;  3I55 V;  4DV5 B;  1VQN V;  3MHH C;  2QKS A;  2DW4 A;  3ZRS A;  1Y76 A;  4DV0 B;  1IBM O;  1F23 A;  2WLL A;  5FPR A;  2AGA A; 
#chains in the Genus database with same CATH homology
 1BT8 A;  4E4E A;  4JYY A;  1KKC A;  2ADQ B;  3KDR A;  1BS3 A;  1AR5 A;  1VAR A;  3K9S A;  2RCV A;  2P4K A;  5AG2 A;  3TJT A;  2QKA A;  1MA1 A;  3C3S A;  3KKY A;  3OT7 A;  1EM1 A;  1I0H A;  1PM9 A;  3C3T A;  1B06 A;  1QNM A;  1JA8 A;  3DC5 A;  1EN6 A;  1LUW A;  1MMM A;  4JZG A;  1N0J A;  1WB7 A;  1PL4 A;  2CE4 A;  1D5N A;  1Y67 A;  3AK1 A;  3EVK A;  1ZSP A;  1MSD A;  1JR9 A;  1WB8 A;  2QKC A;  1ZLZ A;  4BR6 A;  1XUQ A;  1EN4 A;  1GN3 A;  3BFR A;  4FFK A;  4GUN A;  3MDS A;  3QVN A;  3LSU A;  1VEW A;  1ZUQ A;  2CDY A;  1GN4 A;  1N0N A;  2AW9 A;  1ZTE A;  3IC9 A;  3DC6 A;  1I08 A;  4YIP A;  2ADP A;  1LUV A;  1IXB A;  1XRE A;  1GN6 A;  5A9G A;  1P7G A;  3CEI A;  1AVM A;  1AP5 A;  3AK3 A;  4YIO A;  3AK2 A;  1BSM A;  1IDS A;  1XIL A;  4C7U A;  1AR4 A;  1MNG A;  1SZX A;  4F6E A;  4JZ2 A;  2GDS A;  4X9Q A;  1AP6 A;  1GN2 A;  1IX9 A;  1EN5 A;  3RN4 A;  1XDC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...