4FFKA

X-ray structure of iron superoxide dismutase from acidilobus saccharovorans
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
212
structure length
212
Chain Sequence
SVVSLKRYELPPLPYNYDALEPIISAETLRYHHDKHHLGYVNGANAALDKLEKYLNGQLTDIDVRAVSRDFEFNYGGHILHTLYWLNMAPKGKGGGTPGGAIGDAINKFFGSFDKFKKLFGDAAKNVEGVGWAILAYDPVTGDLRILQVEKHNNVVTTNLIPLLAVDVFEHAYYIDYRNDRAKYVDSWWDLINWDDVEARYQKALNTPKLIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase
publication title X-ray structure of iron superoxide dismutase from Acidilobus saccharovorans
rcsb
source organism Acidilobus saccharovorans
molecule tags Oxidoreductase
total genus 78
structure length 212
sequence length 212
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00081 Sod_Fe_N Iron/manganese superoxide dismutases, alpha-hairpin domain
A PF02777 Sod_Fe_C Iron/manganese superoxide dismutases, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.990 Mainly Alpha Orthogonal Bundle Helix Hairpins Fe,Mn superoxide dismutase (SOD) domain 4ffkA01
2.40.500.20 Mainly Beta Beta Barrel Upper collar protein gp10 (connector protein) fold Upper collar protein gp10 (connector protein) fold 4ffkA02
3AK2A 2ADPA 4YIOA 1MMMA 4BR6A 4JZ2A 1XILA 1PL4A 3AK1A 4E4EA 1N0NA 1AP5A 1GN3A 1P7GA 1XDCA 2QKAA 3DC6A 1AP6A 2QKCA 1BS3A 3RN4A 1ZTEA 2CE4A 4C7UA 1BT8A 5A9GA 1EM1A 1EN5A 1VARA 1D5NA 3K9SA 2AW9A 1AR4A 1JA8A 4GUNA 1AR5A 1XUQA 1B06A 1PM9A 1EN4A 1ZLZA 2CDYA 1AVMA 1XREA 3CEIA 1BSMA 1WB8A 2P4KA 1Y67A 2GDSA 1SZXA 1LUWA 3BFRA 1KKCA 3C3TA 4X9QA 3MDSA 3EVKA 1MNGA 1N0JA 1ZUQA 4YIPA 1I0HA 1IXBA 3TJTA 1IX9A 1MA1A 1WB7A 1I08A 1LUVA 1GN4A 2RCVA 1QNMA 3AK3A 1GN6A 3KKYA 3QVNA 3LSUA 2ADQB 1EN6A 1ZSPA 3DC5A 4JZGA 4F6EA 3C3SA 1VEWA 1JR9A 3OT7A 3IC9A 5AG2A 1MSDA 1GN2A 1IDSA 4JYYA 4FFKA
chains in the Genus database with same CATH superfamily
4I9WA 4WFHA 2F95B 3BY6A 4G28B 4JZ2A 4DRXA 5JQGA 4FM2A 2JRIA 2WLLA 5IYZB 3H9VA 3H1LH 4O4IA 1SETA 3OUFA 4N21A 4R7CA 3H1KH 2CGNA 2OYQA 4K8ZA 4LWSB 5J2TA 4RUFA 2ETNA 1EM1A 1Q3EA 4UV9A 1B3QA 4K8XA 2F43G 2XAHA 4X1KB 1BE3H 2AW9A 2CGOA 1OCOC 1YVWA 2GUZB 1G6UA 3BABA 3CSXA 3ASOC 1EN4A 2LP7A 2YC0A 3HKBB 5BMVA 3F5TA 4WFAV 3OM3B 4CS3A 1XNQO 1HNWB 3EXAA 1Z5VA 3F5WC 2WLHA 4I50A 1DF4A 1WB8A 3STZC 5FNVA 3I5DA 1Q6HA 1EFRG 4TOIA 3MHSC 3EVKA 1ZWIC 3SPJA 2Q8VA 3K06A 5KA6A 3WB1A 1H2KA 3OGCC 3BA9A 1K34A 4ASUG 2UXDO 2OTLV 2KKWA 3TETA 2HR3A 4I55B 3ZCCA 1FKAO 5IE9A 5CBGA 1R6NA 4ICGA 1N32B 5KHHA 4QNHB 2ZNJA 1TVKA 1YSCA 3THOA 4ZI7B 3CCQV 1R6KA 1JR9A 5DM6V 2H94A 4YJ2A 5KMGB 1N33O 1JQ0A 3OMAB 2FKXA 1SKVA 2DQ0A 3CXHF 2O57A 2YI8A 4FLVA 1H2LA 2EILB 3JD4A 4R50A 2HLDG 4HAMA 3SJBC 2QKCA 1FAFA 2EX3A 1H38A 3RFRA 2QWNB 2AZ2A 4JI2B 3ZHUA 2EINC 3UO2A 4C7UA 3FB5C 4DRXB 2CTQA 3WG7C 1NH2D 4GX0A 5JQGB 2WLLB 5DECA 4DR3B 2DMXA 4JI5O 3LSSA 4MVUA 4DV1B 2OCCB 5E79Z 4U3JB 3KDRA 1PPJH 3ZEDA 1JA8A 1Q6UA 1FXKC 2XT9A 5J2TB 3X2QB 2Q7HA 4LF5B 1PV0A 1SQVH 3P32A 4KXRA 2WWWA 4AI8A 1DK1A 3OFNG 1WAZA 1WJZA 4ZBMA 1V54C 1R3KC 2NNUA 2E75B 4TQFA 3T1HO 1Q81W 2RJZA 5B3SB 4JI3B 2PZSA 4PA4A 5BMVB 4P9PA 3C3TA 5EK0A 1CPYA 4I50B 1WPBA 5FNVB 1NVPB 1WP7A 2XASA 3CRAA 4NYKA 2D3OW 4GX2A 2CAZC 3RVZA 1LUVA 3IFXA 1RPOA 1VF5B 3OR7C 3SR2C 1XMQO 2V1DA 3CJHA 4B08A 2RMKB 5KHGA 2ZM6B 3QO7A 1IZ3A 1VQ7V 1G4YB 2DW4A 2JIZG 5LXTA 4PDMA 3P30A 1P4RA 2JGDB 3OR6C 4JI0O 1KB9F 4WCEV 2EIJC 5JVDA 4J41A 3MHHC 3L71H 4LH6A 4JTDB 4HZ3A 4DR5B 4Q6GA 2Y4TA 1TVKB 2X6AA 4PA3A 1BHBA 5EC2C 4YJ2B 4EFEA 4LF8B 3ZHSA 3K5OA 1NT2B 2HJFC 1I94O 3F7VC 4CZZA 2IU3A 4GLXA 5B5EZ 1ZTEA 3PJSK 2UXCO 1EN5A 3MAQA 5DN6G 4J7KA 4D6TH 3CC4V 4I4TA 3RYHA 4X66O 5LMNO 3LNNA 1YZBA 2VS0A 4KUMA 4GZRB 1K92A 2P6JA 1JFFA 1YJNV 4U7OA 4UVAA 3ABLB 1SERA 5GTIZ 3K04A 2G38A 3VBBA 1CXZB 3UT5A 3AG3B 1H2NA 2R70A 4TUYA 4UCUA 3MDSA 3VQVA 1V55B 2Q67A 4LFBO 1ZUQA 4YHHO 1I0HA 2EULA 2VRZA 3A0BZ 4R8CA 2UUBB 1FS0G 4DV5O 3SPCA 4Z1MG 1MA1A 2YS8A 3W7TA 4FIPC 5CMUA 4OPHA 2Q6AA 2JGUA 3ZHVA 1R73A 4GT1A 4TT3G 3RWRD 2EIKB 5LMUO 5CN0A 3JYCA 1PP9H 3CCUV 2VQEB 2OT5A 1UJWB 4UCRA 4JV5O 3CJHB 4X8AA 4MT8A 3JAWA 1K73W 3OEEG 3H1HH 1IDSA 5L3CA 4FFKA 1JNBA 4TV9A 5LXTB 1YJ9V 3CXCU 4H13B 2WLNA 3A8TA 3T1HB 2DYSC 4U3FH 5JVDB 3SPHA 3DXRA 2PI5A 4UB8Z 5C93A 4X88A 4DR7B 2CUGA 2Q68A 2LW1A 1K9MW 4I5SA 2E5LB 3M99B 1CEZA 3VQXA 4LH7A 4B3MO 1LR1A 3JASA 2GTAA 5FPOA 1JJOA 5GTHZ 3SPGA 1RM1C 1VQMV 1AR5A 2EBOA 3K0GA 3UCSC 2ZNIA 1OCZB 1GAXA 4IGGA 1UPGA 2C2AA 3CRMA 4I4TB 3RYHB 3LNMB 2IM9A 1L1FA 2Q0AA 3ML0A 4DV6O 4JI0B 4MVMA 2P90A 3HR0A 4JI6O 3OW2U 4YY3O 4JI7O 1WA8A 1JFFB 1Q6IA 1YCIA 4PHZA 3R66A 2A06H 1N0JA 3CRQA 3IC7A 4XBFA 1AI7A 3SJQC 3UT5B 1XHZA 4AQYB 2CTRA 4OXSA 4DUYO 4NXNB 4JI1O 2RDCA 4TUYB 1MZFA 5CB4A 3K57A 4UCTA 1HWYA 4B7EA 3SYOA 2ADQB 2OWOA 1IBKB 1W2BU 2PYLA 3MD0A 2QA4V 2Y0IA 3FFQA 2W0FC 3C3SA 5L3GA 1M4UA 3E8BA 1JX9A 3T1CA 1VQLV 1SZTA 3FB6C 4DR1O 4DR2B 1KD1W 4BR6A 5LGUA 4KFMA 4QGPA 2JJ2G 4DV0O 3JAWB 4X89A 3DC6A 5IDJA 4UXNA 4JI8B 3JATA 1HNXB 2P7TC 5A9GA 5EBWC 3QO5A 1I5XA 3LUTB 4B3TB 4PDLA 3JAMN 3DXRB 5K1PA 2UXBO 3APQA 1VF7A 2VQFO 4IIJA 3ZMTA 1VQ6V 2GBOA 4P30A 2NN4A 3JCUZ 4AILC 4LC1A 1XMOB 1O9GA 3AG2C 3ABMB 4PD4F 3JASB 3UM7A 4LF9B 3E83A 1BQZA 2BTQA 4R6ZA 3WU2Z 1YTFB 1KMIZ 4TQDA 2F1MA 2GDSA 2R72A 1SA0A 3JALA 1KKDA 3A0RA 1J5EO 2EJ7A 4B3SB 1R3JC 3FKSG 4FLUA 2IW5A 1PKXA 2UU9B 3H1JH 1IXBA 4DV7O 2XTAA 1NTMH 4B3RB 1WA8B 2AHYA 4FLWA 1I08A 1KU9A 4MVQA 3B09A 3JAKA 5IT9N 2N05A 3K3WA 3IAYA 2UUAB 5HFMA 2DWDC 3B4SA 2QWOB 4DV2O 4LFCB 1FFXA 1K3EA 3J80N 4P2ZA 3BEHA 3NR7A 4PDVA 4TV8A 4ZOLB 3A0HZ 2P22C 3ZBHA 4X64B 5CB4B 1SQGA 4O2AA 1NZ6A 3F7YC 3OAAG 5BXZA 3E2EA 2OCHA 1AROP 4JYYA 4DR6O 1JPXA 1HW7A 4DV4O 4OPAA 2F4VO 3M8AA 2ITDC 1AJPA 4PDRA 3D36C 4ZHQA 3OUSA 3H01A 5B1AC 4DXWA 1P7GA 1KC8W 4WBNA 5H5NA 1AJNA 1JCHA 5IY5C 3BVOA 2CE4A 3WB0A 2YXYA 5B1BC 2ZD9A 1ENVA 4DV3O 4NXMO 4WFEA 5LP6C 2P06A 4NTWA 1I7FA 1R1BA 1S5HC 2ZE8A 1RPRA 1HR0O 1FD9A 1MABG 3JATB 1RP3B 2Z3YA 4FM0A 2ZXWC 3WFVA 4O4LA 2HHHB 1IBLB 2RQ6A 3RT3C 4IIJB 4F6RA 4RAIA 5IWAO 4BIUA 1S3JA 5FLXN 1SQQH 4J10A 4BW5A 3EHBB 3QO8A 2ZE7A 4HBNA 3STLC 2WPDG 2QDOA 4JI4B 3CWBH 1PL0A 1EZVH 3RW0A 4JGSA 5BR8B 1SA0B 1R3IC 3JALB 4AHCA 5L3EA 2UUCO 1RSOA 1Y74A 4X65B 2YSUB 5LL6Y 2HP8A 3W7SA 1WB7A 3APOA 3AEIA 1M56B 1VF6C 4W4LA 3L9DA 3T2MA 3ETQA 1G1XB 2ZE5A 4DR4B 1OCRB 1Y66A 2IH1C 3DGEA 3JAKB 1F4MA 4PJ0Z 5AG2A 1YITV 2OIGA 5LGNA 2JEUA 3T1YO 4H0LB 2Y48A 3RYFA 2PGGA 4KHPO 4FK5C 2QWRB 1FFXB 3HKCA 4TV8B 4K0KO 1P84F 4YIOA 1MMMA 3CD6V 2ARHA 4LFAO 4O2AB 1XILA 3TXSA 5FL7G 1YEWA 2YIAA 4JTCB 1AP6A 1GM9A 2FMLA 1BS3A 2R9AA 4L87A 3AG4C 3RN4A 2AGAA 3CMAV 1JMKC 2YXHA 1Q7YW 3WG7B 1HNZO 4JYAO 4LBEC 3CPWU 4ZHQB 2IJKA 2ZIMA 1TGOA 2X0LA 5JH7A 4WBNB 4Q20A 4DK1A 2JDIG 4DUZO 4MW3A 1XUQA 2WLMA 1W59A 1YDXA 3ABTA 3TXQA 4DV2B 1J95A 3CYOA 3ASNB 4N23A 1BSMA 3OTOB 1QLEC 1F4NA 3HPLC 1SZXA 4PA7A 4O4IB 1WNSA 3L70H 4DV4B 1Y4MA 4O4LB 4EFBA 5LBQA 3QTCA 2FTKA 4F6RB 3E86A 1H2MA 1PD3A 5EYPA 3QNEA 1DF5A 1IX9A 1KBHA 1NH2B 4GKKB 1NBMG 2W6IG 4X62B 1GN6A 1QNMA 2Q69A 5JWPA 2WSSG 2DYRC 5KA5A 2BE3A 1COWG 2AHZA 1RSOB 1Y74B 2PYJA 4FZ0A 2RNBA 1SQXH 3B8NA 3I55V 4JZGA 4F6EA 1H8HG 2LQTA 1VEWA 1NVPD 3OT7A 5KX5A 2B9ZA 2HVKC 2EIJB 3E8FA 2A9HA 2Z0AA 3K9AA 5B1OA 4G2KA 3CCRV 5EBMC 2ADPA 2OTJV 3D3IA 2OCCC 2L6LA 5IWAB 3Q4HA 2VWKA 4RUEA 5KHJA 1N0NA 1I5YA 2HFEC 2YDEA 1XDCA 3X2QC 3RYFB 3AG1C 5L3BA 5CBHA 2QJ1A 3ZN1A 4U7NA 1NR1A 1Y76A 3B77A 2KG7A 3ZN0A 3P3PA 1XNQB 3CRRA 1D5NA 1NI8A 5LHGA 5IYBO 5D5PA 3FB8C 4J7ZA 2ZKOA 2QWQB 1Q86W 3K58A 1VQ9V 1BZKA 5JH7B 2Y0PA 3CCJV 3H1IH 1IBMO 2FYUH 1OZ0A 1KP3A 5IJ9A 2ZDIA 4H44B 1DTOA 4LF6O 1Y67A 1AI4A 4L8JA 3SYAA 4MVOA 4OGQB 2BSKA 2UXDB 3FYEB 2IU0A 4JYBA 2EIMB 1CP9A 4F4LA 4UCOA 1QVGU 4HYOA 1FJGO 1P7BA 5C8YA 2JS3A 1WPXA 3BRCA 5EYPB 4BIOA 5B66Z 1N33B 3ABUA 4IL6Z 1IURA 3D8CA 2CTWA 2CH7A 5CA1A 1H2GA 1M93A 2IJJA 4JF3A 1OJHA 3IC9A 2XAGA 2UXNA 3OEHG 3ZS8C 3E8GA 3NXSA 5KX5B 2OIEA 2DYSB 5DEDA 1VQKV 2WA3A 4J7JA 1QQCA 4JI5B 3ZRSA 4LF7O 3OD4A 1M1KW 1E1RG 2Q5ZA 3ETEA 1XNRO 2YIBD 1KYOF 3U10A 3Q4HB 2ILMA 2QR4A 2Y69B 1QLNA 1AR1B 5HFLA 4TSFG 3SJAC 3AG3C 3K9SA 3S3XA 1RM1B 5KAFZ 4UB6Z 1N36O 1V55C 3RGBA 4PA6A 5LHIA 1Y76B 2LW7A 2KG7B 5EBLC 4K3AA 1N4CA 1OCCB 1VMGA 1M9NA 3LDDA 4IHJA 4J80A 5BY1A 3RYCA 1UFIA 3ETDA 3RYIA 2QSAA 3J7AU 3CS5A 5IJ9B 1XMQB 3LSQA 3TK1A 4OX9O 4YIPA 1S5JA 4GKJO 2F66C 1BHAA 2BSKB 4X1YA 3SYPA 4LF4O 3G71V 3QVNA 3B40A 1Q90D 3CRCA 1VIBA 2JK5C 1K5SA 5KAIZ 3L75H 1EN6A 1N34O 5C8YB 2WLJA 4X1IA 1YF2A 2ITCC 3G4SV 1I94B 2Z5UA 2IJHA 2H8PC 2ZR2A 2CH7B 5CA1B 1FOUA 2LFRA 1S0VA 1L0LH 3G6BA 3QF7A 2UXCB 2ZE6A 4LF6B 1B04A 3AK1A 3C90A 3TGUH 5LP6A 3JD0A 1AP5A 5K1XA 3BPZA 4X66B 5LMNB 1HP8A 1NQTA 3ICXA 1D2DA 1JVMA 3U11A 3OMIB 3T4DA 1S5LZ 2W0XA 4D7SA 4GUNA 2AXTZ 1IXMA 2DQ3A 2QE7G 1AILA 1Q5OA 1H2SB 5KUKA 1ORQC 1AVMA 2E3CA 4TV9B 5BZBA 2LGWA 2R9IA 2UXXA 4LFBB 1KP2A 5H6RA 4YHHB 1KUQA 3K08A 1ZX3A 3ZMUA 2YUAA 2NR5A 1Q82W 1W0KG 1TUBA 4DV5B 4ABMA 3CB2A 1BGYH 4FZ1A 3G80A 4RQFA 4X9QA 4LR3A 3E8HA 2Q7EA 4BWAA 1HNWO 3M7MX 4IHJB 5LMUB 4A5UB 1DGSA 2BCCH 3SPIA 3RYCB 1ZAUA 1YTFD 1GRJA 3HB3B 3KCYA 2RCVA 3RYIB 4JV5B 2X7RB 5LA6A 1VQOV 2GTSA 5J2UA 1ZSPA 5A2QN 4X1YB 4LCUC 2QM8A 5IYDO 4QPKA 1MSDA 4FLXA 2P67A 3GB7C 5LOVA 3N2KA 2FL4A 1N32O 1AI5A 2Q9LA 1PNMA 3CE2A 2MW2B 1SQPH 2FB5A 2K9PA 1VQNV 4X1IB 4B3MB 1YHQV 4UCSA 1FXHA 3ABKB 1NR7A 1K33A 4FMTA 5L3DA 3FAVA 2YIDA 5IY5B 2M6YA 5B1BB 1XI1A 2B5UA 2JJ1G 1BT8A 1GH6A 4RO2A 5LP6B 2ZINA 3LDCA 2NLJC 5GW7A 3IGAC 4BW9A 4WFGA 4B7KA 4DV6B 1M57C 2XAQA 4JI2O 4JI6B 4YY3B 4JI7B 1B06A 2CDYA 3D3QA 4DR3O 4GYCB 3ZJZA 1FXKA 3CEIA 2QWPB 4DV1O 4YJ3A 4O4HA 3RBZA 4TWKA 1AI6A 1V9PA 4LF5O 4DUYB 4JI1B 1OCOB 5KMGA 4J9YB 2WLKA 4P9OA 2RN9A 1NKDA 3ASOB 1OHHG 1NS1A 1TUBB 2AZ0A 4JI3O 4HNAA 4G27B 2W6JG 4JYCA 1E79G 4J42A 3JD3A 3CMEV 3JSLA 4MTOA 3G6EV 4FLTA 4PELA 4DR1B 1N8RW 3ETGA 2BTQB 4MS2A 4RQEA 1VQ8V 4J9ZB 3FYIB 4U3JA 3ZMVA 2A79B 5LA6B 1H8EG 3B2EE 4DV0B 5ITZA 2Q73A 2ZM6O 1K4DC 4ZIBA 5J2UB 3CCVV 4CBCA 4Z1VA 4UFZA 2A3QA 5CA3A 1BL8A 2PF4E 4MTFA 1PL4A 3B8MA 5LOVB 3AG4B 3N2KB 1WN7A 2UXBB 2VQFB 1VQPV 4DR5O 5KLVH 5TISZ 4LF8O 2PY5A 3I56V 3KG2A 1S76D 1QR9A 4UCVA 3FAVB 3CC2V 4FVMA 3ZRWA 1XL4A 2WA4A 1J5EB 1MOFA 3BCCH 3VOUA 2Q0OC 5FPRA 3J81N 3L72H 2B1IA 3RVYA 2EINB 2R9RB 1NTZH 4GCZA 3OTFA 2DOSA 1QLEB 5JJEB 5JCOC 4MVRA 2JGDA 3CHXA 5KHKA 4DV7B 3JSNA 2PI4A 1RFYA 3CX5F 5IYCO 1KECA 4NTYA 2PTMA 1M56C 3AG7A 3DTUB 2ODMA 5KHIA 3CC7V 1FXKB 3FD9A 4YJ3B 3ZHTA 4YXWG 1OCRC 4O4HB 3TJTA 1MZEA 4BIZA 3PN1A 1V54B 3ZMZA 2MK3A 1SF9A 1U96A 1GN4A 3ZHQA 4FM1A 2DYRB 3K5MA 2JS5A 3E35A 5F2VO 1XHXA 5EIBD 4O2BA 4QIWF 4DR6B 4HNAB 2UUBO 2F4VB 1THZA 3O65A 4DK0A 2K1EA 1G8MA 5H9CA 3GWOA 4J11A 3W7XA 1JOYA 4PI0A 1QBZA 2M7WA 2BOCC 3AK2A 5CA0A 2VQEO 5JJJB 5ITZB 1EBOA 4DV3B 4NXMB 2EZPA 3AG1B 4PV1B 3ZRVA 3UQ8A 2EILC 1VP7A 1PNLA 4BAYA 1HR0B 3OMNB 3ASNC 2LJ2A 2YI9A 1XOUA 2F23A 3U0ZA 1VARA 2LGQA 4E2LA 4NVPA 5B1NA 1F23A 4DR7O 2HJDA 2P4VA 5EIBC 2LFSA 2E5LO 2V4DA 2DWEC 1PM9A 2BOBC 4DW0A 3OE7G 2XOKG 3HKCB 4CH3A 3JD2A 1XREA 2D2CB 4QPJA 4LNUA 1O9HA 1BCCH 4XDLA 3ZRWB 2GSMB 4FPPA 4IYHA 3OGIB 4I0XA 4O4JA 1ROPA 2UUCB 2YIBA 5B3SC 3DSQA 2GV9A 3SDLA 2P5OA 1NJIW 1BMFG 2HVJC 1S77D 1IJGA 2XAJA 1QHTA 3R65A 1IVSA 4KL1A 3W7UA 4WFFA 3K59A 3FB7C 3G67A 4FJCC 3T1YB 4KHPB 1SC5B 3JARA 5H2FZ 1K4CC 3DC5A 4CC6A 4K0KB 4AQYO 4NXNO 1FXVA 4LFAB 4DW1A 1U97A 3SYQA 2ZT9B 1GMGA 2KSDA 4FFBA 3K5NA 3HKEA 1B6QA 3BHPA 2ZIOA 3GVMA 1IBKO 4O2BB 4QE7A 5LYJA 1HNZB 4JYAB 2Q7GA 1KQSU 1HDJA 3ZMSA 4CC5A 4X20A 1Z5WA 1H5WA 2CK3G 1GN3A 4FLZA 4DO2A 4JASA 1GKFA 4DUZB 2QM4A 4H37A 5CA0B 4DR2O 2KQXA 5GONA 1GM7A 3ZRXA 3N2GA 4Z2WA 1MG1A 4D7TA 1AJQA 2IBZH 1ZL8A 2QM7A 4RWUA 3K79A 3P3NA 4W4KA 1E1QG 4JI8O 1TAEA 2WLIA 1EZJA 1HNXO 3CCEV 1W0JG 3BAAA 1Y6XA 2EIMC 1R6TA 4MSWC 4MVSA 5D5QA 4B3TO 2JVDA 3ABLC 1BQ0A 4EEQA 1LUWA 5LGTA 3HKDA 1MSWD 2ZCEA 1TUEB 1XMOO 2N74A 2QGNA 4LF9O 2HKOA 4LNUB 1SQBH 1MNGA 3UKMA 4CS2A 4I0XB 4O4JB 4WFBV 4EB6A 2IH3C 3QG5A 1Q8IA 2X6BA 4I9QA 3JCZA 2YICA 4EKWA 4B3SO 3ZX6A 3CCSV 2KB1A 3LSUA 3CCMV 5JJNB 2E74B 2DE0X 1NTKH 4PA9A 4UUJC 2EIKC 2UU9O 4B3RO 1QU7A 5KUMA 3SYCA 2X6CA 2XHBA 2XUMA 4MTGA 3BA8A 5EZYA 2HEPA 1M5IA 5IJ0A 2UUAO 3JARB 4IT5A 2Y69C 4LFCO 2B1GA 3W7WA 2HG5C 4X64O 4FFBB 2Y4UA 3HKEB 1F51A 3UO3A 1S72V 3L74H 4MVZA 4ZKIA 1SQFA 3FX7A 5LYJB 1T5EA 3D36A 2YEVA 1M90W 1GTOA 4KP4A 1OCCC 4I7ZB 4CS4A 1XEQA 1WP8A 4X20B 2XAFA 1F7YA 1IBMB 3IJ4A 5L3FA 3SGIA 4MTXA 1FFTB 1GK9A 2L35A 1DLBA 1AR4A 1XL6A 2GHYA 4IYIA 5GONB 3N2GB 1L8DA 2ZDIC 1OCZC 2H3OA 3T4ZA 1ZLZA 4NKGB 1Q43A 1ZL8B 1AB3A 1QCEA 2ZQMA 4ZOLA 3K0DA 2VWJA 1Z2GA 3E22A 4XDJA 4JAAA 2WLIB 3BFRA 2QTSA 1OV9A 4GX5A 1KKCA 1PNKA 3SJCC 1FJGB 1X59A 1GM8A 2HHHO 1IBLO 1L0NH 1LNQA 3AG2B 1XBLA 1R3LC 1SESA 3HKDB 1VQ5V 4XDKA 1YI2V 4UVBA 4WF9V 3AK3A 1YIJV 3S3WA 1X4TA 3LDEA 1NU1H 4QJFB 2ATKC 3JD1A 3KKYA 4JI4O 1JJ2U 1XQ8A 1D5AA 5BR8O 3CCLV 4EB6B 3KCXA 1TA8A 4X65O 4JAUA 1WLEA 3N27A 3ZHRA 2XNDG 3A2FA 1VF6A 3VQWA 5J9PC 2DJVA 3TCUA 2N04A 1YJWV 1URFA 5IYZA 3ZIAG 4CH5A 4LF7B 4JPRA 1GN2A 1P49A 3EFFK 1VQ4V 4DYLA 4NR1A 1XNRB 4DR4O 2QTOA 4LWSA 1SRYA 2QKSA 5EZYB 1K8AW 2ZR3A 4E4EA 3K03A 5IJ0B 2QKAA 2E76B 4X1KA 4FLYA 2LO1A 1SS3A 4GX1A 4K35A 3E89A 2Q4PA 1N36B 2BTOA 2GUZA 2PUSA 4JAVA 1QVFU 2A7WA 3HKBA 3KZIZ 5CBFA 5JCOA 2YEVB 1M57B 3CP1A 1K97A 5B1AB 2F93B 2JEXA 4H33A 3ABMC 4OX9B 1YXBA 4GKJB 2P4KA 1US6A 2DN9A 3L73H 3WB2A 4LP8A 2YXLA 3GWKC 4LF4B 1A32A 1K5QA 2WAMA 4I55A 5EC1C 3E22B 2EJRA 4UVCA 3VQYA 2EZOA 5H6QA 3OTOO 2ZXWB 2IJIA 1GO3F 1QR8A 1N34B 3K5LA 2V7QG 4CH4A 4ZI7A 4CH6A 4JTAB 1K7DA 4PI2A 1FPOA 3ABKC 4GKKO 4UV8A 4X62O 2A0LA 2CTPA 5E1AC 5LHHA 4NB5A 1FYJA 4QE9A 2QEXV 4NTXA 4MW8A 3O9OA
chains in the Genus database with same CATH topology
3AK2A 2ADPA 4YIOA 1MMMA 4BR6A 4JZ2A 1XILA 1PL4A 3AK1A 4E4EA 1N0NA 1AP5A 1GN3A 1P7GA 1XDCA 2QKAA 3DC6A 1AP6A 2QKCA 1BS3A 3RN4A 1ZTEA 2CE4A 4C7UA 1BT8A 5A9GA 1EM1A 1EN5A 1VARA 1D5NA 3K9SA 2AW9A 3KDRA 1AR4A 1JA8A 4GUNA 1AR5A 1XUQA 1B06A 1PM9A 1EN4A 1ZLZA 2CDYA 1AVMA 1XREA 3CEIA 1BSMA 1WB8A 2P4KA 1Y67A 2GDSA 1SZXA 1LUWA 3BFRA 1KKCA 3C3TA 4X9QA 3MDSA 3EVKA 1MNGA 1N0JA 1ZUQA 4YIPA 1I0HA 1IXBA 3TJTA 1IX9A 1MA1A 1WB7A 1I08A 1LUVA 1GN4A 2RCVA 1QNMA 3AK3A 1GN6A 3KKYA 3QVNA 3LSUA 2ADQB 1EN6A 1ZSPA 3DC5A 4JZGA 4F6EA 3C3SA 1VEWA 1JR9A 3OT7A 3IC9A 5AG2A 1MSDA 1GN2A 1IDSA 4JYYA 4FFKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AK2 A;  2ADP A;  4YIO A;  1MMM A;  4BR6 A;  4JZ2 A;  1XIL A;  1PL4 A;  3AK1 A;  4E4E A;  1N0N A;  1AP5 A;  1GN3 A;  1P7G A;  1XDC A;  2QKA A;  3DC6 A;  1AP6 A;  2QKC A;  1BS3 A;  3RN4 A;  1ZTE A;  2CE4 A;  4C7U A;  1BT8 A;  5A9G A;  1EM1 A;  1EN5 A;  1VAR A;  1D5N A;  3K9S A;  2AW9 A;  1AR4 A;  1JA8 A;  4GUN A;  1AR5 A;  1XUQ A;  1B06 A;  1PM9 A;  1EN4 A;  1ZLZ A;  2CDY A;  1AVM A;  1XRE A;  3CEI A;  1BSM A;  1WB8 A;  2P4K A;  1Y67 A;  2GDS A;  1SZX A;  1LUW A;  3BFR A;  1KKC A;  3C3T A;  4X9Q A;  3MDS A;  3EVK A;  1MNG A;  1N0J A;  1ZUQ A;  4YIP A;  1I0H A;  1IXB A;  3TJT A;  1IX9 A;  1MA1 A;  1WB7 A;  1I08 A;  1LUV A;  1GN4 A;  2RCV A;  1QNM A;  3AK3 A;  1GN6 A;  3KKY A;  3QVN A;  3LSU A;  2ADQ B;  1EN6 A;  1ZSP A;  3DC5 A;  4JZG A;  4F6E A;  3C3S A;  1VEW A;  1JR9 A;  3OT7 A;  3IC9 A;  5AG2 A;  1MSD A;  1GN2 A;  1IDS A;  4JYY A;  4FFK A; 
#chains in the Genus database with same CATH topology
 4I9W A;  4WFH A;  2F95 B;  3BY6 A;  4G28 B;  4JZ2 A;  4DRX A;  5JQG A;  4FM2 A;  2JRI A;  2WLL A;  5IYZ B;  3H9V A;  3H1L H;  4O4I A;  1SET A;  3OUF A;  4N21 A;  4R7C A;  3H1K H;  2CGN A;  2OYQ A;  4K8Z A;  4LWS B;  5J2T A;  4RUF A;  2ETN A;  1EM1 A;  1Q3E A;  4UV9 A;  1B3Q A;  4K8X A;  2F43 G;  2XAH A;  4X1K B;  1BE3 H;  2AW9 A;  2CGO A;  1OCO C;  1YVW A;  2GUZ B;  1G6U A;  3BAB A;  3CSX A;  3ASO C;  1EN4 A;  2LP7 A;  2YC0 A;  3HKB B;  5BMV A;  3F5T A;  4WFA V;  3OM3 B;  4CS3 A;  1XNQ O;  1HNW B;  3EXA A;  1Z5V A;  3F5W C;  2WLH A;  4I50 A;  1DF4 A;  1WB8 A;  3STZ C;  5FNV A;  3I5D A;  1Q6H A;  1EFR G;  4TOI A;  3MHS C;  3EVK A;  1ZWI C;  3SPJ A;  2Q8V A;  3K06 A;  5KA6 A;  3WB1 A;  1H2K A;  3OGC C;  3BA9 A;  1K34 A;  4ASU G;  2UXD O;  2OTL V;  2KKW A;  3TET A;  2HR3 A;  4I55 B;  3ZCC A;  1FKA O;  5IE9 A;  5CBG A;  1R6N A;  4ICG A;  1N32 B;  5KHH A;  4QNH B;  2ZNJ A;  1TVK A;  1YSC A;  3THO A;  4ZI7 B;  3CCQ V;  1R6K A;  1JR9 A;  5DM6 V;  2H94 A;  4YJ2 A;  5KMG B;  1N33 O;  1JQ0 A;  3OMA B;  2FKX A;  1SKV A;  2DQ0 A;  3CXH F;  2O57 A;  2YI8 A;  4FLV A;  1H2L A;  2EIL B;  3JD4 A;  4R50 A;  2HLD G;  4HAM A;  3SJB C;  2QKC A;  1FAF A;  2EX3 A;  1H38 A;  3RFR A;  2QWN B;  2AZ2 A;  4JI2 B;  3ZHU A;  2EIN C;  3UO2 A;  4C7U A;  3FB5 C;  4DRX B;  2CTQ A;  3WG7 C;  1NH2 D;  4GX0 A;  5JQG B;  2WLL B;  5DEC A;  4DR3 B;  2DMX A;  4JI5 O;  3LSS A;  4MVU A;  4DV1 B;  2OCC B;  5E79 Z;  4U3J B;  3KDR A;  1PPJ H;  3ZED A;  1JA8 A;  1Q6U A;  1FXK C;  2XT9 A;  5J2T B;  3X2Q B;  2Q7H A;  4LF5 B;  1PV0 A;  1SQV H;  3P32 A;  4KXR A;  2WWW A;  4AI8 A;  1DK1 A;  3OFN G;  1WAZ A;  1WJZ A;  4ZBM A;  1V54 C;  1R3K C;  2NNU A;  2E75 B;  4TQF A;  3T1H O;  1Q81 W;  2RJZ A;  5B3S B;  4JI3 B;  2PZS A;  4PA4 A;  5BMV B;  4P9P A;  3C3T A;  5EK0 A;  1CPY A;  4I50 B;  1WPB A;  5FNV B;  1NVP B;  1WP7 A;  2XAS A;  3CRA A;  4NYK A;  2D3O W;  4GX2 A;  2CAZ C;  3RVZ A;  1LUV A;  3IFX A;  1RPO A;  1VF5 B;  3OR7 C;  3SR2 C;  1XMQ O;  2V1D A;  3CJH A;  4B08 A;  2RMK B;  5KHG A;  2ZM6 B;  3QO7 A;  1IZ3 A;  1VQ7 V;  1G4Y B;  2DW4 A;  2JIZ G;  5LXT A;  4PDM A;  3P30 A;  1P4R A;  2JGD B;  3OR6 C;  4JI0 O;  1KB9 F;  4WCE V;  2EIJ C;  5JVD A;  4J41 A;  3MHH C;  3L71 H;  4LH6 A;  4JTD B;  4HZ3 A;  4DR5 B;  4Q6G A;  2Y4T A;  1TVK B;  2X6A A;  4PA3 A;  1BHB A;  5EC2 C;  4YJ2 B;  4EFE A;  4LF8 B;  3ZHS A;  3K5O A;  1NT2 B;  2HJF C;  1I94 O;  3F7V C;  4CZZ A;  2IU3 A;  4GLX A;  5B5E Z;  1ZTE A;  3PJS K;  2UXC O;  1EN5 A;  3MAQ A;  5DN6 G;  4J7K A;  4D6T H;  3CC4 V;  4I4T A;  3RYH A;  4X66 O;  5LMN O;  3LNN A;  1YZB A;  2VS0 A;  4KUM A;  4GZR B;  1K92 A;  2P6J A;  1JFF A;  1YJN V;  4U7O A;  4UVA A;  3ABL B;  1SER A;  5GTI Z;  3K04 A;  2G38 A;  3VBB A;  1CXZ B;  3UT5 A;  3AG3 B;  1H2N A;  2R70 A;  4TUY A;  4UCU A;  3MDS A;  3VQV A;  1V55 B;  2Q67 A;  4LFB O;  1ZUQ A;  4YHH O;  1I0H A;  2EUL A;  2VRZ A;  3A0B Z;  4R8C A;  2UUB B;  1FS0 G;  4DV5 O;  3SPC A;  4Z1M G;  1MA1 A;  2YS8 A;  3W7T A;  4FIP C;  5CMU A;  4OPH A;  2Q6A A;  2JGU A;  3ZHV A;  1R73 A;  4GT1 A;  4TT3 G;  3RWR D;  2EIK B;  5LMU O;  5CN0 A;  3JYC A;  1PP9 H;  3CCU V;  2VQE B;  2OT5 A;  1UJW B;  4UCR A;  4JV5 O;  3CJH B;  4X8A A;  4MT8 A;  3JAW A;  1K73 W;  3OEE G;  3H1H H;  1IDS A;  5L3C A;  4FFK A;  1JNB A;  4TV9 A;  5LXT B;  1YJ9 V;  3CXC U;  4H13 B;  2WLN A;  3A8T A;  3T1H B;  2DYS C;  4U3F H;  5JVD B;  3SPH A;  3DXR A;  2PI5 A;  4UB8 Z;  5C93 A;  4X88 A;  4DR7 B;  2CUG A;  2Q68 A;  2LW1 A;  1K9M W;  4I5S A;  2E5L B;  3M99 B;  1CEZ A;  3VQX A;  4LH7 A;  4B3M O;  1LR1 A;  3JAS A;  2GTA A;  5FPO A;  1JJO A;  5GTH Z;  3SPG A;  1RM1 C;  1VQM V;  1AR5 A;  2EBO A;  3K0G A;  3UCS C;  2ZNI A;  1OCZ B;  1GAX A;  4IGG A;  1UPG A;  2C2A A;  3CRM A;  4I4T B;  3RYH B;  3LNM B;  2IM9 A;  1L1F A;  2Q0A A;  3ML0 A;  4DV6 O;  4JI0 B;  4MVM A;  2P90 A;  3HR0 A;  4JI6 O;  3OW2 U;  4YY3 O;  4JI7 O;  1WA8 A;  1JFF B;  1Q6I A;  1YCI A;  4PHZ A;  3R66 A;  2A06 H;  1N0J A;  3CRQ A;  3IC7 A;  4XBF A;  1AI7 A;  3SJQ C;  3UT5 B;  1XHZ A;  4AQY B;  2CTR A;  4OXS A;  4DUY O;  4NXN B;  4JI1 O;  2RDC A;  4TUY B;  1MZF A;  5CB4 A;  3K57 A;  4UCT A;  1HWY A;  4B7E A;  3SYO A;  2ADQ B;  2OWO A;  1IBK B;  1W2B U;  2PYL A;  3MD0 A;  2QA4 V;  2Y0I A;  3FFQ A;  2W0F C;  3C3S A;  5L3G A;  1M4U A;  3E8B A;  1JX9 A;  3T1C A;  1VQL V;  1SZT A;  3FB6 C;  4DR1 O;  4DR2 B;  1KD1 W;  4BR6 A;  5LGU A;  4KFM A;  4QGP A;  2JJ2 G;  4DV0 O;  3JAW B;  4X89 A;  3DC6 A;  5IDJ A;  4UXN A;  4JI8 B;  3JAT A;  1HNX B;  2P7T C;  5A9G A;  5EBW C;  3QO5 A;  1I5X A;  3LUT B;  4B3T B;  4PDL A;  3JAM N;  3DXR B;  5K1P A;  2UXB O;  3APQ A;  1VF7 A;  2VQF O;  4IIJ A;  3ZMT A;  1VQ6 V;  2GBO A;  4P30 A;  2NN4 A;  3JCU Z;  4AIL C;  4LC1 A;  1XMO B;  1O9G A;  3AG2 C;  3ABM B;  4PD4 F;  3JAS B;  3UM7 A;  4LF9 B;  3E83 A;  1BQZ A;  2BTQ A;  4R6Z A;  3WU2 Z;  1YTF B;  1KMI Z;  4TQD A;  2F1M A;  2GDS A;  2R72 A;  1SA0 A;  3JAL A;  1KKD A;  3A0R A;  1J5E O;  2EJ7 A;  4B3S B;  1R3J C;  3FKS G;  4FLU A;  2IW5 A;  1PKX A;  2UU9 B;  3H1J H;  1IXB A;  4DV7 O;  2XTA A;  1NTM H;  4B3R B;  1WA8 B;  2AHY A;  4FLW A;  1I08 A;  1KU9 A;  4MVQ A;  3B09 A;  3JAK A;  5IT9 N;  2N05 A;  3K3W A;  3IAY A;  2UUA B;  5HFM A;  2DWD C;  3B4S A;  2QWO B;  4DV2 O;  4LFC B;  1FFX A;  1K3E A;  3J80 N;  4P2Z A;  3BEH A;  3NR7 A;  4PDV A;  4TV8 A;  4ZOL B;  3A0H Z;  2P22 C;  3ZBH A;  4X64 B;  5CB4 B;  1SQG A;  4O2A A;  1NZ6 A;  3F7Y C;  3OAA G;  5BXZ A;  3E2E A;  2OCH A;  1ARO P;  4JYY A;  4DR6 O;  1JPX A;  1HW7 A;  4DV4 O;  4OPA A;  2F4V O;  3M8A A;  2ITD C;  1AJP A;  4PDR A;  3D36 C;  4ZHQ A;  3OUS A;  3H01 A;  5B1A C;  4DXW A;  1P7G A;  1KC8 W;  4WBN A;  5H5N A;  1AJN A;  1JCH A;  5IY5 C;  3BVO A;  2CE4 A;  3WB0 A;  2YXY A;  5B1B C;  2ZD9 A;  1ENV A;  4DV3 O;  4NXM O;  4WFE A;  5LP6 C;  2P06 A;  4NTW A;  1I7F A;  1R1B A;  1S5H C;  2ZE8 A;  1RPR A;  1HR0 O;  1FD9 A;  1MAB G;  3JAT B;  1RP3 B;  2Z3Y A;  4FM0 A;  2ZXW C;  3WFV A;  4O4L A;  2HHH B;  1IBL B;  2RQ6 A;  3RT3 C;  4IIJ B;  4F6R A;  4RAI A;  5IWA O;  4BIU A;  1S3J A;  5FLX N;  1SQQ H;  4J10 A;  4BW5 A;  3EHB B;  3QO8 A;  2ZE7 A;  4HBN A;  3STL C;  2WPD G;  2QDO A;  4JI4 B;  3CWB H;  1PL0 A;  1EZV H;  3RW0 A;  4JGS A;  5BR8 B;  1SA0 B;  1R3I C;  3JAL B;  4AHC A;  5L3E A;  2UUC O;  1RSO A;  1Y74 A;  4X65 B;  2YSU B;  5LL6 Y;  2HP8 A;  3W7S A;  1WB7 A;  3APO A;  3AEI A;  1M56 B;  1VF6 C;  4W4L A;  3L9D A;  3T2M A;  3ETQ A;  1G1X B;  2ZE5 A;  4DR4 B;  1OCR B;  1Y66 A;  2IH1 C;  3DGE A;  3JAK B;  1F4M A;  4PJ0 Z;  5AG2 A;  1YIT V;  2OIG A;  5LGN A;  2JEU A;  3T1Y O;  4H0L B;  2Y48 A;  3RYF A;  2PGG A;  4KHP O;  4FK5 C;  2QWR B;  1FFX B;  3HKC A;  4TV8 B;  4K0K O;  1P84 F;  4YIO A;  1MMM A;  3CD6 V;  2ARH A;  4LFA O;  4O2A B;  1XIL A;  3TXS A;  5FL7 G;  1YEW A;  2YIA A;  4JTC B;  1AP6 A;  1GM9 A;  2FML A;  1BS3 A;  2R9A A;  4L87 A;  3AG4 C;  3RN4 A;  2AGA A;  3CMA V;  1JMK C;  2YXH A;  1Q7Y W;  3WG7 B;  1HNZ O;  4JYA O;  4LBE C;  3CPW U;  4ZHQ B;  2IJK A;  2ZIM A;  1TGO A;  2X0L A;  5JH7 A;  4WBN B;  4Q20 A;  4DK1 A;  2JDI G;  4DUZ O;  4MW3 A;  1XUQ A;  2WLM A;  1W59 A;  1YDX A;  3ABT A;  3TXQ A;  4DV2 B;  1J95 A;  3CYO A;  3ASN B;  4N23 A;  1BSM A;  3OTO B;  1QLE C;  1F4N A;  3HPL C;  1SZX A;  4PA7 A;  4O4I B;  1WNS A;  3L70 H;  4DV4 B;  1Y4M A;  4O4L B;  4EFB A;  5LBQ A;  3QTC A;  2FTK A;  4F6R B;  3E86 A;  1H2M A;  1PD3 A;  5EYP A;  3QNE A;  1DF5 A;  1IX9 A;  1KBH A;  1NH2 B;  4GKK B;  1NBM G;  2W6I G;  4X62 B;  1GN6 A;  1QNM A;  2Q69 A;  5JWP A;  2WSS G;  2DYR C;  5KA5 A;  2BE3 A;  1COW G;  2AHZ A;  1RSO B;  1Y74 B;  2PYJ A;  4FZ0 A;  2RNB A;  1SQX H;  3B8N A;  3I55 V;  4JZG A;  4F6E A;  1H8H G;  2LQT A;  1VEW A;  1NVP D;  3OT7 A;  5KX5 A;  2B9Z A;  2HVK C;  2EIJ B;  3E8F A;  2A9H A;  2Z0A A;  3K9A A;  5B1O A;  4G2K A;  3CCR V;  5EBM C;  2ADP A;  2OTJ V;  3D3I A;  2OCC C;  2L6L A;  5IWA B;  3Q4H A;  2VWK A;  4RUE A;  5KHJ A;  1N0N A;  1I5Y A;  2HFE C;  2YDE A;  1XDC A;  3X2Q C;  3RYF B;  3AG1 C;  5L3B A;  5CBH A;  2QJ1 A;  3ZN1 A;  4U7N A;  1NR1 A;  1Y76 A;  3B77 A;  2KG7 A;  3ZN0 A;  3P3P A;  1XNQ B;  3CRR A;  1D5N A;  1NI8 A;  5LHG A;  5IYB O;  5D5P A;  3FB8 C;  4J7Z A;  2ZKO A;  2QWQ B;  1Q86 W;  3K58 A;  1VQ9 V;  1BZK A;  5JH7 B;  2Y0P A;  3CCJ V;  3H1I H;  1IBM O;  2FYU H;  1OZ0 A;  1KP3 A;  5IJ9 A;  2ZDI A;  4H44 B;  1DTO A;  4LF6 O;  1Y67 A;  1AI4 A;  4L8J A;  3SYA A;  4MVO A;  4OGQ B;  2BSK A;  2UXD B;  3FYE B;  2IU0 A;  4JYB A;  2EIM B;  1CP9 A;  4F4L A;  4UCO A;  1QVG U;  4HYO A;  1FJG O;  1P7B A;  5C8Y A;  2JS3 A;  1WPX A;  3BRC A;  5EYP B;  4BIO A;  5B66 Z;  1N33 B;  3ABU A;  4IL6 Z;  1IUR A;  3D8C A;  2CTW A;  2CH7 A;  5CA1 A;  1H2G A;  1M93 A;  2IJJ A;  4JF3 A;  1OJH A;  3IC9 A;  2XAG A;  2UXN A;  3OEH G;  3ZS8 C;  3E8G A;  3NXS A;  5KX5 B;  2OIE A;  2DYS B;  5DED A;  1VQK V;  2WA3 A;  4J7J A;  1QQC A;  4JI5 B;  3ZRS A;  4LF7 O;  3OD4 A;  1M1K W;  1E1R G;  2Q5Z A;  3ETE A;  1XNR O;  2YIB D;  1KYO F;  3U10 A;  3Q4H B;  2ILM A;  2QR4 A;  2Y69 B;  1QLN A;  1AR1 B;  5HFL A;  4TSF G;  3SJA C;  3AG3 C;  3K9S A;  3S3X A;  1RM1 B;  5KAF Z;  4UB6 Z;  1N36 O;  1V55 C;  3RGB A;  4PA6 A;  5LHI A;  1Y76 B;  2LW7 A;  2KG7 B;  5EBL C;  4K3A A;  1N4C A;  1OCC B;  1VMG A;  1M9N A;  3LDD A;  4IHJ A;  4J80 A;  5BY1 A;  3RYC A;  1UFI A;  3ETD A;  3RYI A;  2QSA A;  3J7A U;  3CS5 A;  5IJ9 B;  1XMQ B;  3LSQ A;  3TK1 A;  4OX9 O;  4YIP A;  1S5J A;  4GKJ O;  2F66 C;  1BHA A;  2BSK B;  4X1Y A;  3SYP A;  4LF4 O;  3G71 V;  3QVN A;  3B40 A;  1Q90 D;  3CRC A;  1VIB A;  2JK5 C;  1K5S A;  5KAI Z;  3L75 H;  1EN6 A;  1N34 O;  5C8Y B;  2WLJ A;  4X1I A;  1YF2 A;  2ITC C;  3G4S V;  1I94 B;  2Z5U A;  2IJH A;  2H8P C;  2ZR2 A;  2CH7 B;  5CA1 B;  1FOU A;  2LFR A;  1S0V A;  1L0L H;  3G6B A;  3QF7 A;  2UXC B;  2ZE6 A;  4LF6 B;  1B04 A;  3AK1 A;  3C90 A;  3TGU H;  5LP6 A;  3JD0 A;  1AP5 A;  5K1X A;  3BPZ A;  4X66 B;  5LMN B;  1HP8 A;  1NQT A;  3ICX A;  1D2D A;  1JVM A;  3U11 A;  3OMI B;  3T4D A;  1S5L Z;  2W0X A;  4D7S A;  4GUN A;  2AXT Z;  1IXM A;  2DQ3 A;  2QE7 G;  1AIL A;  1Q5O A;  1H2S B;  5KUK A;  1ORQ C;  1AVM A;  2E3C A;  4TV9 B;  5BZB A;  2LGW A;  2R9I A;  2UXX A;  4LFB B;  1KP2 A;  5H6R A;  4YHH B;  1KUQ A;  3K08 A;  1ZX3 A;  3ZMU A;  2YUA A;  2NR5 A;  1Q82 W;  1W0K G;  1TUB A;  4DV5 B;  4ABM A;  3CB2 A;  1BGY H;  4FZ1 A;  3G80 A;  4RQF A;  4X9Q A;  4LR3 A;  3E8H A;  2Q7E A;  4BWA A;  1HNW O;  3M7M X;  4IHJ B;  5LMU B;  4A5U B;  1DGS A;  2BCC H;  3SPI A;  3RYC B;  1ZAU A;  1YTF D;  1GRJ A;  3HB3 B;  3KCY A;  2RCV A;  3RYI B;  4JV5 B;  2X7R B;  5LA6 A;  1VQO V;  2GTS A;  5J2U A;  1ZSP A;  5A2Q N;  4X1Y B;  4LCU C;  2QM8 A;  5IYD O;  4QPK A;  1MSD A;  4FLX A;  2P67 A;  3GB7 C;  5LOV A;  3N2K A;  2FL4 A;  1N32 O;  1AI5 A;  2Q9L A;  1PNM A;  3CE2 A;  2MW2 B;  1SQP H;  2FB5 A;  2K9P A;  1VQN V;  4X1I B;  4B3M B;  1YHQ V;  4UCS A;  1FXH A;  3ABK B;  1NR7 A;  1K33 A;  4FMT A;  5L3D A;  3FAV A;  2YID A;  5IY5 B;  2M6Y A;  5B1B B;  1XI1 A;  2B5U A;  2JJ1 G;  1BT8 A;  1GH6 A;  4RO2 A;  5LP6 B;  2ZIN A;  3LDC A;  2NLJ C;  5GW7 A;  3IGA C;  4BW9 A;  4WFG A;  4B7K A;  4DV6 B;  1M57 C;  2XAQ A;  4JI2 O;  4JI6 B;  4YY3 B;  4JI7 B;  1B06 A;  2CDY A;  3D3Q A;  4DR3 O;  4GYC B;  3ZJZ A;  1FXK A;  3CEI A;  2QWP B;  4DV1 O;  4YJ3 A;  4O4H A;  3RBZ A;  4TWK A;  1AI6 A;  1V9P A;  4LF5 O;  4DUY B;  4JI1 B;  1OCO B;  5KMG A;  4J9Y B;  2WLK A;  4P9O A;  2RN9 A;  1NKD A;  3ASO B;  1OHH G;  1NS1 A;  1TUB B;  2AZ0 A;  4JI3 O;  4HNA A;  4G27 B;  2W6J G;  4JYC A;  1E79 G;  4J42 A;  3JD3 A;  3CME V;  3JSL A;  4MTO A;  3G6E V;  4FLT A;  4PEL A;  4DR1 B;  1N8R W;  3ETG A;  2BTQ B;  4MS2 A;  4RQE A;  1VQ8 V;  4J9Z B;  3FYI B;  4U3J A;  3ZMV A;  2A79 B;  5LA6 B;  1H8E G;  3B2E E;  4DV0 B;  5ITZ A;  2Q73 A;  2ZM6 O;  1K4D C;  4ZIB A;  5J2U B;  3CCV V;  4CBC A;  4Z1V A;  4UFZ A;  2A3Q A;  5CA3 A;  1BL8 A;  2PF4 E;  4MTF A;  1PL4 A;  3B8M A;  5LOV B;  3AG4 B;  3N2K B;  1WN7 A;  2UXB B;  2VQF B;  1VQP V;  4DR5 O;  5KLV H;  5TIS Z;  4LF8 O;  2PY5 A;  3I56 V;  3KG2 A;  1S76 D;  1QR9 A;  4UCV A;  3FAV B;  3CC2 V;  4FVM A;  3ZRW A;  1XL4 A;  2WA4 A;  1J5E B;  1MOF A;  3BCC H;  3VOU A;  2Q0O C;  5FPR A;  3J81 N;  3L72 H;  2B1I A;  3RVY A;  2EIN B;  2R9R B;  1NTZ H;  4GCZ A;  3OTF A;  2DOS A;  1QLE B;  5JJE B;  5JCO C;  4MVR A;  2JGD A;  3CHX A;  5KHK A;  4DV7 B;  3JSN A;  2PI4 A;  1RFY A;  3CX5 F;  5IYC O;  1KEC A;  4NTY A;  2PTM A;  1M56 C;  3AG7 A;  3DTU B;  2ODM A;  5KHI A;  3CC7 V;  1FXK B;  3FD9 A;  4YJ3 B;  3ZHT A;  4YXW G;  1OCR C;  4O4H B;  3TJT A;  1MZE A;  4BIZ A;  3PN1 A;  1V54 B;  3ZMZ A;  2MK3 A;  1SF9 A;  1U96 A;  1GN4 A;  3ZHQ A;  4FM1 A;  2DYR B;  3K5M A;  2JS5 A;  3E35 A;  5F2V O;  1XHX A;  5EIB D;  4O2B A;  4QIW F;  4DR6 B;  4HNA B;  2UUB O;  2F4V B;  1THZ A;  3O65 A;  4DK0 A;  2K1E A;  1G8M A;  5H9C A;  3GWO A;  4J11 A;  3W7X A;  1JOY A;  4PI0 A;  1QBZ A;  2M7W A;  2BOC C;  3AK2 A;  5CA0 A;  2VQE O;  5JJJ B;  5ITZ B;  1EBO A;  4DV3 B;  4NXM B;  2EZP A;  3AG1 B;  4PV1 B;  3ZRV A;  3UQ8 A;  2EIL C;  1VP7 A;  1PNL A;  4BAY A;  1HR0 B;  3OMN B;  3ASN C;  2LJ2 A;  2YI9 A;  1XOU A;  2F23 A;  3U0Z A;  1VAR A;  2LGQ A;  4E2L A;  4NVP A;  5B1N A;  1F23 A;  4DR7 O;  2HJD A;  2P4V A;  5EIB C;  2LFS A;  2E5L O;  2V4D A;  2DWE C;  1PM9 A;  2BOB C;  4DW0 A;  3OE7 G;  2XOK G;  3HKC B;  4CH3 A;  3JD2 A;  1XRE A;  2D2C B;  4QPJ A;  4LNU A;  1O9H A;  1BCC H;  4XDL A;  3ZRW B;  2GSM B;  4FPP A;  4IYH A;  3OGI B;  4I0X A;  4O4J A;  1ROP A;  2UUC B;  2YIB A;  5B3S C;  3DSQ A;  2GV9 A;  3SDL A;  2P5O A;  1NJI W;  1BMF G;  2HVJ C;  1S77 D;  1IJG A;  2XAJ A;  1QHT A;  3R65 A;  1IVS A;  4KL1 A;  3W7U A;  4WFF A;  3K59 A;  3FB7 C;  3G67 A;  4FJC C;  3T1Y B;  4KHP B;  1SC5 B;  3JAR A;  5H2F Z;  1K4C C;  3DC5 A;  4CC6 A;  4K0K B;  4AQY O;  4NXN O;  1FXV A;  4LFA B;  4DW1 A;  1U97 A;  3SYQ A;  2ZT9 B;  1GMG A;  2KSD A;  4FFB A;  3K5N A;  3HKE A;  1B6Q A;  3BHP A;  2ZIO A;  3GVM A;  1IBK O;  4O2B B;  4QE7 A;  5LYJ A;  1HNZ B;  4JYA B;  2Q7G A;  1KQS U;  1HDJ A;  3ZMS A;  4CC5 A;  4X20 A;  1Z5W A;  1H5W A;  2CK3 G;  1GN3 A;  4FLZ A;  4DO2 A;  4JAS A;  1GKF A;  4DUZ B;  2QM4 A;  4H37 A;  5CA0 B;  4DR2 O;  2KQX A;  5GON A;  1GM7 A;  3ZRX A;  3N2G A;  4Z2W A;  1MG1 A;  4D7T A;  1AJQ A;  2IBZ H;  1ZL8 A;  2QM7 A;  4RWU A;  3K79 A;  3P3N A;  4W4K A;  1E1Q G;  4JI8 O;  1TAE A;  2WLI A;  1EZJ A;  1HNX O;  3CCE V;  1W0J G;  3BAA A;  1Y6X A;  2EIM C;  1R6T A;  4MSW C;  4MVS A;  5D5Q A;  4B3T O;  2JVD A;  3ABL C;  1BQ0 A;  4EEQ A;  1LUW A;  5LGT A;  3HKD A;  1MSW D;  2ZCE A;  1TUE B;  1XMO O;  2N74 A;  2QGN A;  4LF9 O;  2HKO A;  4LNU B;  1SQB H;  1MNG A;  3UKM A;  4CS2 A;  4I0X B;  4O4J B;  4WFB V;  4EB6 A;  2IH3 C;  3QG5 A;  1Q8I A;  2X6B A;  4I9Q A;  3JCZ A;  2YIC A;  4EKW A;  4B3S O;  3ZX6 A;  3CCS V;  2KB1 A;  3LSU A;  3CCM V;  5JJN B;  2E74 B;  2DE0 X;  1NTK H;  4PA9 A;  4UUJ C;  2EIK C;  2UU9 O;  4B3R O;  1QU7 A;  5KUM A;  3SYC A;  2X6C A;  2XHB A;  2XUM A;  4MTG A;  3BA8 A;  5EZY A;  2HEP A;  1M5I A;  5IJ0 A;  2UUA O;  3JAR B;  4IT5 A;  2Y69 C;  4LFC O;  2B1G A;  3W7W A;  2HG5 C;  4X64 O;  4FFB B;  2Y4U A;  3HKE B;  1F51 A;  3UO3 A;  1S72 V;  3L74 H;  4MVZ A;  4ZKI A;  1SQF A;  3FX7 A;  5LYJ B;  1T5E A;  3D36 A;  2YEV A;  1M90 W;  1GTO A;  4KP4 A;  1OCC C;  4I7Z B;  4CS4 A;  1XEQ A;  1WP8 A;  4X20 B;  2XAF A;  1F7Y A;  1IBM B;  3IJ4 A;  5L3F A;  3SGI A;  4MTX A;  1FFT B;  1GK9 A;  2L35 A;  1DLB A;  1AR4 A;  1XL6 A;  2GHY A;  4IYI A;  5GON B;  3N2G B;  1L8D A;  2ZDI C;  1OCZ C;  2H3O A;  3T4Z A;  1ZLZ A;  4NKG B;  1Q43 A;  1ZL8 B;  1AB3 A;  1QCE A;  2ZQM A;  4ZOL A;  3K0D A;  2VWJ A;  1Z2G A;  3E22 A;  4XDJ A;  4JAA A;  2WLI B;  3BFR A;  2QTS A;  1OV9 A;  4GX5 A;  1KKC A;  1PNK A;  3SJC C;  1FJG B;  1X59 A;  1GM8 A;  2HHH O;  1IBL O;  1L0N H;  1LNQ A;  3AG2 B;  1XBL A;  1R3L C;  1SES A;  3HKD B;  1VQ5 V;  4XDK A;  1YI2 V;  4UVB A;  4WF9 V;  3AK3 A;  1YIJ V;  3S3W A;  1X4T A;  3LDE A;  1NU1 H;  4QJF B;  2ATK C;  3JD1 A;  3KKY A;  4JI4 O;  1JJ2 U;  1XQ8 A;  1D5A A;  5BR8 O;  3CCL V;  4EB6 B;  3KCX A;  1TA8 A;  4X65 O;  4JAU A;  1WLE A;  3N27 A;  3ZHR A;  2XND G;  3A2F A;  1VF6 A;  3VQW A;  5J9P C;  2DJV A;  3TCU A;  2N04 A;  1YJW V;  1URF A;  5IYZ A;  3ZIA G;  4CH5 A;  4LF7 B;  4JPR A;  1GN2 A;  1P49 A;  3EFF K;  1VQ4 V;  4DYL A;  4NR1 A;  1XNR B;  4DR4 O;  2QTO A;  4LWS A;  1SRY A;  2QKS A;  5EZY B;  1K8A W;  2ZR3 A;  4E4E A;  3K03 A;  5IJ0 B;  2QKA A;  2E76 B;  4X1K A;  4FLY A;  2LO1 A;  1SS3 A;  4GX1 A;  4K35 A;  3E89 A;  2Q4P A;  1N36 B;  2BTO A;  2GUZ A;  2PUS A;  4JAV A;  1QVF U;  2A7W A;  3HKB A;  3KZI Z;  5CBF A;  5JCO A;  2YEV B;  1M57 B;  3CP1 A;  1K97 A;  5B1A B;  2F93 B;  2JEX A;  4H33 A;  3ABM C;  4OX9 B;  1YXB A;  4GKJ B;  2P4K A;  1US6 A;  2DN9 A;  3L73 H;  3WB2 A;  4LP8 A;  2YXL A;  3GWK C;  4LF4 B;  1A32 A;  1K5Q A;  2WAM A;  4I55 A;  5EC1 C;  3E22 B;  2EJR A;  4UVC A;  3VQY A;  2EZO A;  5H6Q A;  3OTO O;  2ZXW B;  2IJI A;  1GO3 F;  1QR8 A;  1N34 B;  3K5L A;  2V7Q G;  4CH4 A;  4ZI7 A;  4CH6 A;  4JTA B;  1K7D A;  4PI2 A;  1FPO A;  3ABK C;  4GKK O;  4UV8 A;  4X62 O;  2A0L A;  2CTP A;  5E1A C;  5LHH A;  4NB5 A;  1FYJ A;  4QE9 A;  2QEX V;  4NTX A;  4MW8 A;  3O9O A; 
#chains in the Genus database with same CATH homology
 3AK2 A;  2ADP A;  4YIO A;  1MMM A;  4BR6 A;  4JZ2 A;  1XIL A;  1PL4 A;  3AK1 A;  4E4E A;  1N0N A;  1AP5 A;  1GN3 A;  1P7G A;  1XDC A;  2QKA A;  3DC6 A;  1AP6 A;  2QKC A;  1BS3 A;  3RN4 A;  1ZTE A;  2CE4 A;  4C7U A;  1BT8 A;  5A9G A;  1EM1 A;  1EN5 A;  1VAR A;  1D5N A;  3K9S A;  2AW9 A;  3KDR A;  1AR4 A;  1JA8 A;  4GUN A;  1AR5 A;  1XUQ A;  1B06 A;  1PM9 A;  1EN4 A;  1ZLZ A;  2CDY A;  1AVM A;  1XRE A;  3CEI A;  1BSM A;  1WB8 A;  2P4K A;  1Y67 A;  2GDS A;  1SZX A;  1LUW A;  3BFR A;  1KKC A;  3C3T A;  4X9Q A;  3MDS A;  3EVK A;  1MNG A;  1N0J A;  1ZUQ A;  4YIP A;  1I0H A;  1IXB A;  3TJT A;  1IX9 A;  1MA1 A;  1WB7 A;  1I08 A;  1LUV A;  1GN4 A;  2RCV A;  1QNM A;  3AK3 A;  1GN6 A;  3KKY A;  3QVN A;  3LSU A;  2ADQ B;  1EN6 A;  1ZSP A;  3DC5 A;  4JZG A;  4F6E A;  3C3S A;  1VEW A;  1JR9 A;  3OT7 A;  3IC9 A;  5AG2 A;  1MSD A;  1GN2 A;  1IDS A;  4JYY A;  4FFK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...