4FFLA

Pylc in complex with l-lysine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
363
structure length
353
Chain Sequence
b'MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYGLEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVLKERFGAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PylC
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase
total genus 117
structure length 353
sequence length 363
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4fflA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fflA01
4AJIA 4QSMA 4ZRMA 3DTYA 1B14A 2CFCA 3JQ7A 3LSYA 3CZMA 5LOVF 2QRKA 5L53A 1JU9A 4FGWA 3JQAB 4L4RA 4D7AA 3K96A 2IXBA 4KTTE 2GERA 1QV7A 1XWFA 2X0RA 2NU9A 1ZK2A 2CD9A 2ZCUA 4RZHA 4CM1A 2R7MA 4FW8A 3RBVA 1GFSA 4OIMA 3JQEA 4W9NC 2WYUA 1Q0HA 3LLVA 3F4BA 4CQMB 2P9EA 4Q39A 4BNNA 1C14A 1VL0A 4HNHA 3LK7A 5TC4A 3F46A 4MP3A 3SC4A 4A26A 2BFPA 4MO2A 1I24A 2VRCA 4FSHA 1CE8A 4K26A 4Q3CA 4WEQA 5KVCA 4RVSA 1P1IA 1YBVA 3SJUA 1DC4A 3E9NA 1DIHA 4GMGA 2AE2A 3NTQA 2EHDA 2C07A 3M1LA 3H5RA 3T4EA 1EUCB 3JQGB 1YL6A 3HQ4O 2B4TO 1Q0LA 4BKUA 5IYZF 1ARZA 5JVLA 3TZCA 5JPIA 2YFHA 2I3GA 1CQJB 3DQPA 2GQRA 1EHIA 3AOEC 3WSWA 3WLFA 2V58A 3ZNQA 4DPKA 1VKNA 2IYOA 4I50F 2TMGA 2VNSA 3FI9A 1LRLA 1M0TA 1LJ8A 4CM5A 1J0XO 1FDVA 1B16A 1E92A 4EG0A 3WGZA 1LLCA 3M2PA 1HLPA 4IXWA 3E48A 3PXXA 4WPGA 1ZKMA 4R54A 2XXJA 3Q9UA 4D46A 1KY5A 2IP4A 2PVPA 4IZIA 2CY0A 2W6PA 5LP6F 2GASA 4CUJA 2GYYA 3KOUA 3KZVA 2VUSA 4XQCA 5JDCA 3D64A 5L7WA 2DTDA 3KLPX 3U3XA 2Y1FA 5ILGA 1DIAA 3PGXA 2BRUA 3LT0A 1ZMTA 4BNGA 4ALJA 2HMUA 1A27A 3GVHA 5TS3A 3WXBA 4A0SA 1XHLA 2NVUB 2PKRA 1PX2A 4LN1A 1HWYA 4XEHA 1ZZEA 1ADFA 3GAFA 1ML3A 6LDHA 5HRUA 5A05A 3EZLA 3LF2A 3I6IA 1T1SA 2JJYA 4HNVA 4L8VA 4OAQA 4DA9A 4TMFA 1IHYA 2R7NA 3E9MA 4B4WA 3FNFA 1I30A 1DBVO 3NX4A 4S3MA 5JMPA 5GZ1A 4YJGA 1M2WA 1WVGA 5I9LA 4YJDA 3X2EA 2R84A 2ZYDA 4OYRA 1E1KA 3A06A 4LW8A 4MKRA 2DPHA 1XKQA 2VZ0A 1Y7TA 1V8BA 4YJ3F 3OJLA 1DHTA 2GN8A 4L9RA 5D8DA 3S2FA 3FNEA 1KJQA 3ANLA 4Q9NA 4UVIA 4FJ1A 4BKQA 2PKQP 4DIOA 5KJFA 5C1OA 2CUKA 4CL3A 1LEHA 3BMOA 2B4RO 3BMCB 2AEJA 2HDHA 5A02A 4C5CA 3GR6A 3L9WA 4H3VA 4DVJA 1NPYA 1XCBA 3VPXA 3JYLA 3L6DA 5L9AA 3DAGA 3HO8A 3ETEA 2E48A 2Q49A 4P4NA 1BXZA 5T8KA 4GX2A 2ZDQA 1A71A 1IB6A 1NQOA 4MDHA 5ADHA 3BMQB 1C1DB 1DPGA 5CEJA 4J4HA 5H83A 5IN4A 3AOGA 1LLDA 3GG9A 4ZGWA 4MV3A 4OGWA 1S6YA 4QEDA 1FXSA 1TXGA 2ZTVA 3MJCA 1N9GB 3DHYA 4OH1A 5HBRA 4YXFA 3KVOA 3AFMA 4MA5A 3D0OA 4I9HA 4IM7A 5GMOA 4NMHA 4QECA 1EDOA 2CNVA 1BDMA 1PZGA 1V9LA 3W4JA 1BVRA 5LYJF 3VHRA 3ETHA 1EVYA 2PTGA 3DHNA 3ZWVA 2BGLA 4BGEA 1SO8A 3DXFA 4H16A 1GSOA 3GNTA 1UUFA 4KQWA 3FR8A 1VSUA 1F0YA 2VZ8A 4GMFA 1PS9A 2AW5A 2C0CA 2YV1A 1Z73A 4IINA 3T4XA 2E37A 1C1XB 4ND2A 9LDBA 3PJDA 2PGLA 4NI5A 4XYLA 3LVFO 9LDTA 4PLFA 3D3WA 3PWKA 3GY0A 4KUHA 3RC2A 5BSGA 5JXWA 3UW3A 5T5QA 3JYPA 5EN4A 1ZK1A 5JY1A 1D1TA 2O3UA 3DOJA 3L9XA 1NAHA 1QYVA 2B69A 1IHXA 2IEDA 2O48X 2YJZA 2H5LA 2FMUA 4O84A 2HJSA 4NJOA 1X1TA 3TQHA 5F1KA 2I99A 4YTEA 3AW8A 4RL6A 3JTMA 3RUDA 4CLRA 2Q1TA 5A9RA 4HNUA 1T4DA 5I7VA 4EGJA 2BMAA 2BD0A 3OP4A 4MVJI 3QSGA 2I67A 5LDGA 3TOZA 3F47A 5IFLA 1DSSG 3TIIA 4J1NA 4CM4A 1Z2OX 1HF3A 4Z3KA 1CWUA 3LC7O 4RDIA 3FCOA 2W90A 4PN3A 5CEEA 5F5NA 5L45A 2XXBA 3RC7A 1J49A 4RVGA 2O50A 3WO1A 4PZDA 2C59A 1DIBA 3MJVA 1AHIA 2Y1EA 1DC6A 3Q2IA 1XA0A 5BSEA 1X13A 2PBZA 1DOHA 1A7AA 3WGHA 1IULA 3P2YA 1NASA 4O4JF 4ID9A 1E3IA 4ZQEA 5KJ6A 2VTEA 1WR2A 1A4IA 3GEDA 1MXFA 4M49A 5JS6A 3IQDB 3KSDO 4JQCA 4WE3A 4NDNE 4CUZA 3BTOA 1HSZA 2NACA 2X22A 4ALNA 2ZK7A 1EUDA 1U8FO 1R4MA 3RFVA 3U9SA 3EDMA 5CA0F 1GUYA 1YGYA 2PZKA 3C1AA 1QR6A 4XQ9A 4CLOA 4BNIA 4EUEA 1MXHA 1ZVMA 1DLJA 4JBHA 2XAAA 3ZI0A 1EVJA 1E7SA 4WK6A 2SCUB 1H93A 5B37A 4CM8B 1A9XA 2DU8A 2JHGA 4UUNA 4IGEA 1YJ8A 5A06A 2DBVO 3PHIA 4WCFB 3LZ6A 2PFGA 1RM0A 1O8CA 3NYWA 2JL1A 4EZBA 4XQGA 2DPGA 3JQ7B 3WICA 2PKQO 3WNQA 3AI3A 3PHLA 1NVGA 3EC7A 4TZTA 4J49A 5K9ZA 1BHSA 1DJNA 3WNZA 1VJTA 4WBNF 3VH2A 1HEUA 2NU9B 3WS7A 5JLAA 1OI7A 3OJOA 2WD7A 2VCYA 4R1TA 4WLFA 5FWNA 5LCXA 4URFA 2FPGA 4KDEA 2CMDA 5BNIA 2VPQA 1ADBA 3K31A 1YE3A 4O7VA 3E1KA 3P2OA 1KUTA 3ADOA 4FU0A 4EJMA 2Z1NA 4C5BA 2OXIA 2YWVA 4O83A 4KDFA 2HJRA 4GWKA 3VDQA 4CM7A 3WGIA 3KYDA 1H6AA 4PLPA 4CODB 5TT0A 3GVCA 3TL3A 2QYTA 2FN7A 2NU8A 1YB4A 3TOXA 3HJAA 4ZVVA 4CMAA 4BIIA 5KJ1A 2HCTA 3Q1KA 2D8AA 1RPNA 3VH3A 4ND3A 1ULSA 5EIOA 1BSVA 2OUIA 3NT4A 3UXYA 1VSVA 1T2DA 1GCOA 4LMRA 4TQGA 1PGJA 1O0SA 3N7UA 1J4AA 3UUWA 4IQGA 3AU8A 4FB5A 1E7YA 2X9NA 4JBIA 2AQHA 1VRWA 3NGXA 3IAHA 1IOVA 3U55A 1KEUA 3GGGA 1U1IA 1KY4A 3JD3A 3UKOA 4WLUA 3VDRA 4E13A 1QMGA 4TKMA 1M6WA 2R00C 2I8CA 4O7ZA 4UULA 2X58A 1Q7BA 3ZU4A 2A94A 2W2KA 3C8MA 3WQQA 4WJZA 3BHJA 2BKAA 4B7XA 3GVIA 4CMEC 4R1SA 1UZMA 3ROMA 2UV8A 2DZDA 2IDZA 2O3QA 2PA3A 1JVBA 2HO5A 2VHYA 2VQ3A 1G0OA 1TB4A 3P19A 1GR0A 4IDDA 4W9NA 4O7WA 1HZZA 4YDRA 4NK4A 2I3AA 4BMVA 3ZWBA 1CS0A 1UXGA 5AXAA 4YJGB 4MVJG 3F1LA 4PLYA 1C3VA 2ZCVA 1XU7A 3CUKA 4KWHA 4CM3A 1KVQA 4IDAA 3N6RA 4J90A 3VOSA 2WDZA 4BKOA 1E7QA 1EFKA 3C3XA 4MVJM 1UXKA 4D0RA 1UXIA 2IZ0A 4WOJA 5JVDF 4EGQA 5IG2A 4DYDA 1WDLA 2EKLA 5A5FA 1KJIA 2FRDA 1GPDG 4I5FA 4M8SA 3ZV3A 3BMOB 1IE3A 1P1FA 3AOEA 1WZIA 3D4OA 3RCBA 4E31A 3LQFA 1R15A 4CR6A 1AUXA 1UDCA 4BO4A 4EI2A 3HDQA 4F6CA 2JD2A 4AFNA 2QF7A 5DCUA 4YA6A 1VKOA 3JQGA 1Q1NA 4EJ0A 4BGIA 2QK4A 3OIFA 5IDYA 1IYZA 1I2ZA 1NM5A 1FDSA 1ZNQO 3OEWA 4YT5A 4GX5A 3SBOA 4CMHA 5TNXA 2I80A 2FZEA 2ILTA 4IIJF 1HE2A 2X7HA 4FC7A 4PIVA 5G4KA 1HDCA 4DIBA 1KEPA 1E5QA 3H5AA 5L7YA 1XQ6A 2W2LA 5JE8A 4F45A 4DLAA 5HBRB 3R0IA 5AXDA 4CV1A 2CVOA 4ND1A 4YJHA 1UXHA 5IN5A 4DC1A 5ER9A 4O82A 3RASA 2WSBA 4Y9DA 1D1SA 1HRDA 2VWPA 3DOOA 3F1KA 3WIEA 5DOVA 4D44A 4TRMA 3U9TA 4FFRA 4J1QA 1Y1PA 1G0NA 4FCCA 4IJKA 1BVUA 1SC6A 1FJHA 1HDOA 1MFZA 2X6TA 2YZ7A 3G8CA 2X0IA 3GHYA 4CLXA 4DYVA 2Y68A 3N74A 3VVCA 4IJUA 4XYLB 5H81A 3K73O 5CB4F 2DIKA 4LCEA 4I55F 2QQ5A 3ZZNA 2EP7A 1ONNA 3JQBC 2GZ3A 3H9JA 3KM0A 2FP4B 4IZHA 3VPFA 1WXDA 4FBGA 1ZH8A 1Y5RA 3TWOA 3KBOA 4RCVA 4K6CA 3PQEA 4TZKA 3NKLA 1UP7A 2OBYA 3GNSA 4JNKA 4TV9F 4DC0A 2PR2A 2WWRA 2OFPA 3SC6A 1F17A 2VYNA 3FTPA 4LSWA 5G4LA 4HXYA 1YB1A 4CLRB 2DAPA 5KVQA 2DVMA 3ZWAA 3HHPA 4XX0A 5IDQA 5F21A 2YYAA 4DQVA 3I52A 4O7SA 5TF4A 3ZNNA 4DBZA 4ALMA 1C3OA 1NWHA 2VYVA 2UUOA 3EMKA 4CM4B 2VWQA 2YFQA 3I5MA 4DPLA 2D4AA 1MUUA 4FOSA 2W2LD 3PWSA 1ZIDA 2NNLD 4PG8A 1N7GA 2ZB8A 1QYWA 2YW9A 1PJ3A 3G0OA 3SLKA 4UEKA 4AJOA 3BMCA 4PVCA 3UFXA 2XD4A 4E2XA 2PNFA 3H6KA 4MVJF 4OMUA 2YL2A 3B1KA 3HSKA 1U2DA 3RD5A 1WNTA 1WMBA 4RPKA 1H2BA 4Z0PA 4B8ZA 2GPTA 1YXMA 1DFGA 4W6ZA 4L1KA 3VPCA 4WLEA 4Z9YA 3HFGA 1WPQA 3AI2A 1BXGA 1LU9A 2AQKA 4OL9A 2C5EA 1I32A 5I7SA 1C1DA 3BHIA 2B5WA 1Z74A 4FFLA 4H7PA 1RM4A 3GEMA 2Y1GA 5IZ4A 2GLXA 4J6FA 1EUDB 3OETA 4YB8A 5ENVA 1E77A 4CLOB 5DOZA 4RLSA 4ZQFA 3LT4A 2HMTA 3NV9A 1B8PA 2CF6A 2C2XA 2VYND 3K2EA 3E5NA 1KEVA 1X0XA 1MLDA 1XGKA 3H5NA 3KB6A 1A72A 3OUUA 3I3OA 3ICPA 4WEOA 3MOGA 2A35A 5C37A 2B5VA 4Q3NA 5AVOA 2VYVD 1SZJG 1AXEA 4BO9A 1JTVA 1OC2A 4Q3BA 1ID1A 2OLSA 4HR7A 2R87A 2NVWA 2VOEA 1EE9A 2W6NA 1IL0A 3JCZA 4XD2A 4JJFA 5KWEA 1QG6A 1VJ0A 4IHJF 3HN7A 2FPGB 2QRLA 4P4LA 2Q1WA 4HFMA 4EJ6A 2JFHA 5FI3A 3EW7A 3AUAA 1PQPA 3T7CA 4BGVA 1NPDA 2X23A 5CA1F 2DBQA 1NR7A 1D8AA 1CRWG 5L40A 1FDWA 4AJ1A 2CVQA 5JCJA 3KRTA 5I7FA 2VT2A 3SJ7A 4RJTA 1LQUA 4MV8A 4M89A 4GSLA 4R5MA 4IIUA 3C24A 2HKIA 5ILOA 1HYHA 1HDRA 2VT3A 3TZQA 5K0ZA 2NU8B 5J2TF 1ZK0A 2Q1UA 1X1EA 5DBFA 3QFFA 3V4ZA 3CH6A 5T67A 3O26A 3JV7A 2XCLA 4U7WA 4RF3A 1P1KA 4XIJA 3AX6A 1XSEA 2X0JA 1B2LA 1Z7BA 3AJRA 4DMLA 2QZZA 4M1QA 5G0UA 8LDHA 2E49A 4GH5A 4L0QA 2A4KA 3PHJA 3RROA 5CAEA 2AG5A 4E4YA 5KX5F 6ADHA 1WLYA 3GLQA 1JAYA 1T2FA 2J3IA 4YRDA 1TI7A 4PG4A 3OIGA 1M6HA 3LP8A 2WE7A 3OIDA 3GF4A 4NK5A 4JN6B 4AJNA 1Z82A 4JCOA 2EGHA 1F12A 3Q2KA 1RYDA 4UAGA 4CV2A 3HADA 3QVWA 1N8KA 2C54A 3B1JA 4RVDA 4DQUA 1AUPA 1PSDA 3WO0A 2O3JA 5L4SA 5TSDA 4OQZA 5G0TA 3D4PA 2W2KB 3KXDA 3VH4A 4U8GA 5FEUA 3IP3A 4IDEA 3VTZA 4NJMB 5B4VA 3F9IA 2NTVA 3E5RA 3OSUA 5JCJD 1NR1A 4O7TA 3I83A 3I9MA 3TNLA 2DUUA 4XB2A 4N5LA 4D41A 1Y8RA 4WCFA 2DBZA 1U7TA 1H0KA 1WDMA 4RQTA 3PYXA 1T1RA 2GZ1A 3ZWPA 3UF0A 4BL5A 3CSDA 3AY7A 2BHLA 3QWFA 5KIAA 1QORA 4NFHA 3EY4A 4ROSA 2I5PO 4RO0A 1HE4A 1PIWA 4LRTB 4RPGA 4B7UA 1NPTO 4BO7A 3PFWO 3BG5A 4PG5A 5C7OO 3I6QA 1YQGA 3JQ8A 1ZFNA 4R9SA 1R37A 3ITDA 4LK3A 5ER6A 2OBNA 1VBHA 4ZD6A 4YYZA 5CG1A 1LDEA 2D5CA 1Q7CA 3TJRA 3GRPA 4MV4A 3DBLB 1U4SA 3I9LA 2Y66A 1G1AA 3IKVA 3KUXA 2HAEA 4TSKA 1P33A 2DT5A 3W8DA 4I08A 2WTBA 3JYQA 1TT5A 4FQ8A 5KTKA 1GCUA 1PX0A 3RUAA 1KYQA 2D5AA 1HL3A 2NQ8A 2IYPA 3ZW8A 5IXYA 4HX5A 3H2ZA 4W82A 1PJBA 2FR8A 3GN2A 3MJFA 3R5XA 1UDAA 4NQZA 3CINA 3U49A 4BNHA 3L4BA 1K5HA 3N8DA 4C7JA 4YBZA 2EV9A 4FIZA 4TRJA 3G79A 5G0WA 3GGPA 5EZYF 3QIVA 5U9CA 2G17A 1GGOA 4KUEA 3FN4A 2R86A 1ADCA 5G4KB 2X9VA 1LTHR 3EAGA 5JO9A 3V1UA 1FDUA 3W1VA 2HJWA 3KO8A 5AQ1A 1HSOA 4CMEA 4YJHB 1KVSA 3V1TC 2CNBA 4D79A 1SBYA 4O81A 3RC9A 1GUZA 4I9UA 1Q0QA 4E2ZA 3WGQA 4FE2A 3FHLA 2X1HA 2JFGA 3Q2OA 3I9JA 5EPOA 4BVAA 5IZCC 1GYPA 2B4QA 3HB5X 3K2BA 2Q4EA 5JCXA 3W8FA 5A3VA 3DEYX 5CEFA 1I3KA 1NQTA 3OEYA 4AVYA 1DC5A 4ZQHA 3U4CA 2YDXA 3HDJA 2VRCD 3GVPA 2ZDHA 3QJ5A 4QT0A 3WBFA 1D7OA 4J9VA 4YJFA 4YAJA 5C7IO 4YAEA 3JQFC 2ZJ0A 1PJ2A 3PP8A 4WLOA 3K9QO 3H65A 1N1GA 4N54A 1PQUA 3PYLA 3QW2A 3B70A 3AFNA 3WMXA 3CEAA 2NADA 1ENOA 3GZ4A 4PRKA 2PY6A 4J43A 1Y9AA 1ORRA 1Q2XA 5EQDA 5U4QA 1HT0A 4XJTA 2I6TA 3WFIA 4DQXA 1H5QA 2ZTMA 4U5QA 1LSSA 4FOOA 1VM6A 1Z6ZA 3HE3A 2NSDA 3RKRA 3ULKA 5KCZA 4LCJA 4XX0B 1JN0A 3RJ9A 5JSFA 2V65A 3FR7A 4NBRA 3VPBA 2PWZA 4I9NA 2BFMA 3QRWA 4GQAA 1RM3A 3O8QA 4HWKA 3LT1A 3DAFA 4HFNA 3K92A 3OJEA 2NM0A 1EK6A 4MP6A 1BMDA 3ICCA 2YYYA 2V59A 2JAHA 3AY3A 4F3YA 2P9GA 1E3SA 3BYZA 1NVTA 1T25A 4PLTA 4D43A 3UFXB 5EERA 3CMMA 4FDAA 4O5OA 2O7QA 1DV2A 4J3FA 4UEOA 3MJSA 4D3SA 1SB9A 2ZYGA 1MFPA 4JP3A 1ZEJA 3ANMA 2YZMA 1NQAO 2CDBA 4IPTA 3OJ0A 4QFCA 4BUCA 3TF5A 3SE7A 1U3UA 4XGKA 3ON5A 1T4BA 1IY8A 5CDUA 1N7HA 4WCDA 5DP2A 2W6ZA 4ZHQF 1BXGB 4QO7A 5GZ6A 1OFGA 2JD1A 4TWRA 2YUTA 4MKXA 3I4CA 3IOYA 4NFSA 3DZJA 4Y98A 1ISMA 3Q3CA 1YDEA 2Z95A 4B4OA 3ZV6A 4YB8B 2RH4A 5JAQA 2DFVA 4PRLA 3QVOA 2G5CA 4TRNA 2ZATA 4FFMA 5AOVA 4Z9XA 3SEFA 3RFTA 3W8EA 8ADHA 4BS9A 5EJ2A 3RUIA 4NYEA 3OMLA 2X9GA 3WDSA 2DBRA 4I5EA 4NH4A 5ITWA 4AJ4A 1X7GA 2J5KA 3DOCA 3C7DB 1SNYA 3QE3A 2W98A 5H80A 4R3NA 4S1VA 1V3TA 4Q3EA 1V3UA 4F6LA 3E6AA 2C29D 1U28A 3G1UA 5DBIA 3WYCA 1YS4A 4PLWA 5JC8A 5I9NA 4FGSA 2C2YA 2RIRA 2X5KO 1I3NA 1OMOA 2W71A 3V4SA 2D59A 3DL2A 2WM3A 4MJLA 4Y8VA 4DLBA 5L4NA 3BHMA 2FP4A 3RBZA 3GAZA 2A92A 5KKCA 4BO6A 2ZQZA 1NX6A 4EBFA 1P77A 2UUPA 4ZQIA 3R5FA 1F06A 1F8GA 1GQYA 3IDSA 3Q9NA 4BV9A 3AWDA 4L74A 1Y8QA 4E5MA 1IPEA 1N2SA 3SXPA 1D3AA 1E6WA 1UAYA 1DV1A 3HWRA 4GVLA 3S2IA 4R41A 1IPFA 2CDAA 2GGSA 2V6MA 1ISGA 4XYEA 5LXTF 4OJNA 2NLOA 1HE3A 3PDUA 4BV8A 2YRWA 3M1AA 1AGNA 4IQ0A 3IKTA 4DLLA 5LA6F 1O5IA 4ZQBA 3LU1A 4KQXA 5T57A 3DWFA 3MCVA 4HY3A 2FWMX 3JQ9C 1NVMB 1ZJYA 3WIDA 1T2CA 4L76A 2YV2A 3R3JA 4II3A 5CAEB 1K89A 2GQSA 4BO5A 4J1SA 2JKVA 1KOLA 4O59O 5KVVA 2GCGA 3JRWA 3RQSA 1I10A 4P4GA 4Z3DA 1XIVA 2WEKA 4J2HA 4CM6A 4O6VA 5K6AA 3F3SA 2GRAA 2NTJA 4KUGA 4CMJA 4JXKA 3CKYA 4RV9A 1HZJA 3ROPA 1T2EA 2D0IA 4EUFA 2VHZA 4EITA 1UP4A 3HFSA 3GMSA 4RORA 1KEEA 1EVZA 2ZB3A 3VPSA 4UVGA 4OSPA 4PLHA 1CIVA 1BDBA 4FC6A 4FPXA 4YRAA 3LDHA 1QXSA 5COAA 1E3WA 1JA9A 3MEQA 2DC1A 1PZFA 4PLVA 2NQTA 4MV9A 3DBVO 3E9QA 3DMYA 1Y8RB 2I87A 4ZI7F 1I01A 4PFJA 4QSHA 2QIOA 3EZYA 1S7CA 4YEDA 4A7PA 3RUCA 3H8VA 1TEHA 2OP0A 1E3EA 1X7HA 1DRVA 4AICA 3C7CB 4Q3DA 1PWXA 5EESA 5BPHA 1VE9A 5GY7A 1P9LA 4EEZA 1N92A 3HB4X 3JD4A 4MVJH 3R23A 2ZYAA 4FGRA 3JQ8B 3Q6IA 4BKPA 1FMCA 2NV6A 3GT0A 3PJGA 1U7HA 2X0NA 3KV3O 2VHWA 4E21A 1GADO 5C8YF 3QA9A 4QO8A 3DZIA 1YRLA 2V7PA 4OOFA 4XB1A 2AQ8A 2X5JO 3RI3A 1A48A 1JAXA 1TT5B 1P1RA 2VUUA 3FD8A 4AJEA 3UGKA 1K2WA 3A9WA 1LBEA 2GN9A 5THQA 2R7KA 3D4NA 3MWDB 5HA5A 5FI5A 3ZGYA 4OHUA 1EVIA 2CVZA 3ZHYA 1YONA 2Y93A 4BB5A 1XG5A 5A1TA 5IXSA 2PH5A 2F00A 1Z75A 3PEFA 3QWBA 4IS2A 1O95A 3R3SA 1YOVA 3FNHA 5GZ3A 2V6GA 4YBZB 4IQ8A 4J1TA 1A5ZA 3KAKA 4DGSA 3WG9A 1PS8A 4YJ2F 4I4TF 1E1LA 4BNMA 5CFZA 3RUFA 1SEPA 5DMXA 4MKZA 4U0JA 1R4NB 4DXHA 5CDSA 4IDBA 4UREA 2O23A 1GPJA 4U6SA 1JVSA 1Y5MA 5G0VA 1MP0A 4BHTA 2DM6A 4M9UA 1YBMA 2AEFA 2HGSA 4UUPA 4GGPA 4WASA 3JD2A 3UHAA 3CTMA 2WMDA 4YAIA 3EGOA 3WTCA 1GV1A 1PEDA 3RUHA 5HWSA 1DJQA 4TV8F 1DHRA 1LDNA 2OZPA 4BMSA 2GDZA 5FFFA 5L51A 1I5RA 3VZRA 1I3LA 4JROA 4BO1A 4NJMA 1E0DA 2Q2VA 3L0DA 3NDIA 3PJFA 5DBGA 3ZHZA 3SVTA 2Q50A 2RCYA 2UAGA 3NJ8A 4BO8A 2FPIA 4C5AA 5TJ9A 2UDPA 2PZLA 4YJFB 4YAJB 5COBA 4BNZA 3ASVA 4Y6PA 3DF7A 1C30A 1KBZA 1U8XX 1FF9A 3LT2A 4E2WA 4GI2A 5C7LO 1U3TA 1AUVA 3DB2A 2VZ9A 3TZKA 5B12A 4IJWA 3NJ4A 1ZW1A 4L73A 5DN9A 4ZU3A 1ZMOA 2AA3A 2VRBA 3ROQA 1PGNA 3KLMX 4WUVA 4O2AF 3COSA 2WJPA 4O4IF 4R1NA 5DULA 3ZH2A 1K6IA 3FWZA 4NNJA 2HK7A 5BNFA 3H9EO 4BKRA 2XOXA 1VI2A 3DBLA 4OM8A 4XYGA 2W6OA 4AJHA 3QQPA 3O8QB 1NWCA 3T7EA 3INGA 5A5EA 2O3SA 4YR9A 3WLEA 2VNAA 3DBRA 4E5NA 1LSOA 3QVSA 4O7YA 4NHEA 4CLDA 3GIDA 4INAA 2G82A 5JDCC 4BGUA 1KBLA 1CERA 3QWAA 5CDGA 3GHHA 1BGVA 2QZ9A 1XU9A 1UP6A 1WW8A 1DEHA 3ETDA 3GEGA 1RM5A 3S8MA 2HMWA 3WQRA 3GN1A 1WZEA 1LRJA 5JMWA 3DONA 3WQSB 1PK8A 4KTVE 3ORQA 4DWVA 3VOTA 3IIEA 4GLLA 3U62A 5EQFA 3WSVA 3UH1A 1OAAA 1HTBA 2VHXA 1R0KA 2J3KA 4J4TA 2O2SA 3OFSA 3QWIA 4QQRA 4JP2A 4WECA 2I9PA 4R1UA 2I65A 1M75A 4A73A 5IZCA 1PWZA 4JGBA 1LDMA 1EQUA 4C7KA 5A4DA 1SEVA 2Z02A 4E5YA 1PGPA 5CDTA 1YB5A 3RFXA 4B4VA 2IRWA 1QLHA 4OOEA 2GZ2A 5KKNB 1D4FA 1OOEA 1P0CA 1QYDA 2DKNA 3PFFA 4LRSB 1L1FA 3HN2A 1GZ4A 1AXGA 2B83A 3JQFA 3ZU2A 3IP1A 4RZQA 3AY6A 4LSMA 3ZWYA 4HFRA 1K6JA 2GSDA 1NNUA 1RWBA 4IMPA 4TRRA 4BNKA 3TW6A 3NAQA 5J23A 1JKIA 2P4QA 1SOVA 5JQGF 2ZQYA 5IJZA 4NU5A 3RKUA 3UAGA 1SPXA 2RHCA 1X7DA 3FPLA 1KJ9A 4Y8VB 3HDHA 1NFQA 1P1JA 5T8KC 4OO3A 1KVTA 4B3JA 3VC7A 3WWZA 4CMBA 3Q1LA 2F1KA 3I23A 3GUYA 3LC1O 2Z1MA 3IJPA 2W6QA 4ALIA 1Y8QB 3S2EA 2HQ1A 4O63O 1H9BA 1KEWA 3ZNOA 3VZPA 4Y6SA 2Q4BA 1NFFA 4HP8A 3ONEA 4A5OA 4E6PA 4NPCA 4R01A 4PGFA 4A27A 3QLJA 4D3DA 4AJLA 4Y67A 1I0ZA 5I9MA 7MDHA 3KAJA 1IZ9A 2VR1A 5J2UF 3VPHA 4MV7A 2VUTA 4W99A 3EVNA 4XQEA 5HTOA 1EZ4A 2UYYA 1RYEA 5THKA 5C5IA 1DIGA 2QYSA 4K1LA 3TFOA 4NG5A 4AJPA 2QX7A 5L3ZA 3I9NA 3M6IA 4BNWA 1NFRA 1W73A 4E32A 1ZBQA 2YV3A 4WLVA 3WB9A 4O86A 1YDWA 5KNLA 1PGQA 4K9DA 3G17A 3U4DA 4JJIA 3HDYA 4RVUA 1NHWA 3RUEA 2G76A 2YRXA 2R82A 4UEJA 2QW8A 3ZV4A 1GSAA 3PHHA 4Z0TA 1DDOA 3BA1A 5IF3A 1ENPA 2W4QA 2TMDA 3FWNA 1LXCA 2IXAA 4GKBA 4ZHSA 3QWHA 3WGOA 4LMPA 2V6BA 3RSHA 1E4EA 4L4SA 3ZWOA 3GZNA 2OHXA 4OSOA 1MG5A 4OXYA 5DP1A 4TUYF 2QG4A 1HXHA 2CZCA 5JAIA 5I8ZA 1WAMA 2LDXA 3TIGA 4KWIA 5A03A 4DPMA 1E3WB 3NUAA 3HG7A 2QHXA 2PN1A 1EMDA 3OECA 3W4IA 4P8RA 5BPFA 1CQIA 1FDTA 1HDGO 1PJ4A 3U5TA 1LA2A 1LLQA 3AM3A 1E1MA 4NBWA 2IZ1A 3DFUA 4XYMA 1GEEA 4CMKA 4IBOA 5EL0A 4CM9A 3D5QA 1ENZA 3ABIA 1EBUA 1C0PA 1B6RA 3DDNA 3E82A 4BNLA 4HQ6A 5A9TA 1ULZA 4OQYA 4MIYA 1VBGA 2NWQA 4QX6A 2YDYA 5L7TA 2IODA 3GPDG 4E5PA 5B4UA 1PL6A 4J7UA 3GDFA 4JK3A 4CPDA 4UVEA 2BH9A 1T24A 2PGJA 1ZEMA 3TN7A 1MGOA 5JAZA 1E5LA 2ZB7A 2C7VA 4UVHA 5AXBA 1DXYA 1XLTA 4FN4A 3UCFA 5JYEA 1B8VA 1SAYA 3C1TA 3HBLA 5JAMA 2WE8A 4NBTA 5DF1A 2C7GA 1M76A 3PTZA 1YOVB 4RF4A 4YQZA 1DLIA 1JDBB 1OC4A 4JIGA 3DO5A 1I7NA 3LWBA 4C4OA 1ONOA 5ITVA 4M55A 2POQX 1H6CA 4J16A 1O9BA 1NQ5A 1MX3A 1LC0A 4M86A 1U5AA 1ZSYA 2Q2WA 3L07A 3OJFA 3PWZA 4PZEA 4EEXA 1QYCA 4XIYA 1EQ2A 1LLUA 4AJKA 4XGIA 5JYDA 5KJEA 1I33A 2VN8A 2OO5A 4DBVO 4JX8A 1PR9A 2P2SA 2GUGA 2VWGA 2J3HA 1HDZA 1K0UA 3MJTA 3HB9A 1I8TA 4M54A 1EFLA 4ILKA 5KOIA 1ISHA 2AQIA 3MOIA 2FPIB 1IUKA 3INTA 1E6UA 3DZKA 3RFCA 4U0KA 3ZWNA 3LYLA 4W7HA 4CR8A 1PQWA 1M0WA 4MOWA 1B8UA 2Q1SA 4G65A 3ITKA 3WR5A 1Z7EA 5L4LA 4ZN6A 2GN6A 3W4KA 1N1EA 1PS0A 2NU7A 2RBEA 5HS6A 4K28A 2Y67A 4GAEA 4GPD1 3E5MA 3ZWMA 2EJVA 3JQCA 3RU9A 1C0KA 3L4SO 5ES3A 1HLDA 1DAOA 5ENDA 1KJJA 2E82A 3DZHA 2J5RA 4OKIA 3U54A 4O7NA 3V2HA 3KHUA 1GYRA 3PK0A 5LDHA 3DZGA 3B1FA 3OF2A 1GTMA 4DTIA 1T26A 4YCAA 2YZGA 3K5PA 1A9ZA 3DBRB 3N58A 1BW9A 4XWYA 5IDXA 3QVTA 4E12A 2VTDA 1HYEA 1XQ1A 2GD1O 4FJ2A 4ZRNA 4XRRA 3MWDA 1NTOA 1LDGA 2PZMA 4BNFA 1F8FA 3DBHA 1R0LA 2PV7A 3ASUA 4Q3AA 4L4XA 4R3WA 1R66A 4A03A 3S55A 4I1IA 3KYCB 3BIOA 1Y81A 1JLLA 4KOAA 4GWGA 3ENKA 2VWHA 4GX0A 2PD6A 3DAPA 2R2GA 3RV3A 5AYVA 2YS7A 1GZ3A 4J0FA 1FK8A 3RWBA 2YHUA 4UUMA 3NTRA 3V5NA 2BGMA 1IOLA 3GG2A 3L6EA 3FTNA 2R00A 1T2AA 2C82A 4XRGA 1LX6A 1R4NA 3F6YA 2OOSA 3DC2A 3FSRA 1A7KA 3OH8A 3O4RA 5DCWA 3EHEA 4D45A 3NUGA 1MC4A 2Y99A 1HDXA 5COQA 2PD4A 1EZ1A 1LUAA 2HLPA 4ZICA 3ORRA 5CDYA 3HNPA 3WNVA 2EKQA 4DIMA 1LI4A 2Y0DA 4JLWA 2BF7A 4MIEA 2Y1DA 3PPIA 5TJHA 1KC1A 1XELA 1L7DA 4IY1A 5CPBA 3NT5A 1PJTA 3RJ5A 4W4TA 4NR0A 2DWCA 2P9CA 1LC3A 1WP4A 1YL5A 2B35A 2O7SA 4BO3A 1YKFA 2YW2A 3MJ4A 1Q7GA 3JZIA 1A4UA 2GN4A 1IZ0A 1I36A 3RVDA 4DREA 3V8BA 1JW9B 1R0SA 1ZXBA 2NU6A 2WYOA 5JQWA 4O1MA 3GUCA 4XKJA 2HK8A 2BI8A 5A3JA 4RPLA 1KVUA 4FFNA 1JKJA 4BOYA 4CQLA 4CV3A 4PLZA 4XR4A 4BQRA 3PLNA 4BNXA 3KSZO 1PJSA 4H15A 1QKIA 3TL2A 3IUSA 2Q3EA 3R6DA 1OBDA 4XGNA 4LISA 5TGDA 4J2OA 4JJGA 5AXCA 3AK4A 3JYNA 3UN1A 2C20A 2YZLA 3AU9A 3ETJA 3H9QA 3BZUA 3D7LA 4EUHA 3S1LA 4R9RA 3K8ZA 4MVJP 2AEMA 2PLAA 3QP9A 2CZGA 1PGOA 2AE1A 2WYVA 4IUYA 2CNUA 4YACA 1KIFA 1WWKA 3JQDA 4E3ZA 2NUAA 1ULUA 2QRJA 2O3RA 1LRKA 2I76A 1EK5A 5DCYA 1E7MA 4QTZA 1I2CA 3AUSA 3GDOA 4RPHA 3OA2A 2GNAA 1PZEA 3RBXA 3H4VA 3PYMA 2ZIZA 3KSUA 1EUZA 3NTOA 1BG6A 4G2NA 4PZCA 2YHIB 1E4EB 1ZK3A 2YQ5A 4YAKA 5B4TA 1O6ZA 3GZNB 2B36A 3OHSX 2RAFA 1O94A 3WOHA 4FJ0A 1B7GO 1XDWA 5T6BA 3KEOA 3X2FA 2EIHA 4N5MA 4CMGA 1QV6A 1VL6A 3ZHBA 1AHHA 1HKUA 1JQBA 4O7RA 3PHGA 3RC1A 4YT2A 1Z45A 3GOHA 4GSKA 3Q11A 2P0AA 3JQBA 3DFZA 3VKVA 1CQIB 4Y6RA 3VH1A 2H1SA 1CEQA 4B3IA 3QV1A 3GC6A 3A14A 5ICSA 1ZXLA 3FBTA 4R16A 3KEQA 1DFHA 3VKUA 4NIMA 3VZQA 5G0SA 1NBOA 4HFJA 1DRWA 4XYMB 4J0EA 3GH3A 1J6UA 3NT2A 3GPIA 3VMMA 3GMDA 2ET6A 3NDRA 4IMRA 4MP8A 5I8WA 4Z0HO 1Y6JA 3TDKA 1WDKA 1ZCJA 2EG9A 4PVDA 3V2UA 5B1YA 3VVBA 2ZTUA 4XR9A 5DDIP 1RKXA 2GLTA 3Q0EA 2DLNA 4B7CA 3TQTA 1GEGA 2B0JA 3TPCA 3K5IA 2PGDA 1P74A 4QUKA 1N5DA 3AW9A 1F14A 4OXKA 4O4LF 1P31A 1LDBA 2Y05A 4LVUA 4QFDA 4HBGA 4ITUA 1V35A 2EW2A 3TFQA 3MWEB 1U2GA 2X5OA 3KALA 4XA8A 3NDJA 3E18A 4EW6A 1EE2A 3H3FA 3GA0A 3SLGA 4BNUA 1YJQA 3ZCXA 2JCVA 2H9IA 3M2TA 1GLVA 3OICA 1SCUA 2JHFA 3G3EA 5JO0A 2AG8A 3R9RA 3FRJA 3ZWWA 4NFYA 4KP7A 5FYDA 5FNVF 3ZNPA 2E6UX 3AUUA 3ZDFA 1PL7A 1E3JA 3K6JA 3W6ZA 1GY8A 5EINA 3H2SA 2Q46A 2W8ZA 3S2GA 5IDWA 4E2YA 1YBAA 5TIIA 3GLKA 1UZNA 3STHA 2AMFA 1E7RA 3RIHA 1E7WA 5DT9A 3WGGA 1GUFA 3WWYA 4BQPA 5HV6A 5ICMA 3LLSA 4G81A 4BO2A 5A9SB 3BTUA 1H2HA 4GLOA 5KVSA 4WNCA 5JH7F 1LSUA 2XF8A 1HETA 3ZHXA 2FSVA 3KREA 2Y0CA 3A1NA 4CL8A 4CJXA 4AL4A 4YRBA 5JFOA 3GRKA 1EYZA 2O4UX 3EUWA 2X86A 1PJQA 2ZJ1A 1QSGA 3LF1A 4WOKA 5IAAA 3INRA 2WYWA 5T64A 4B8WA 1M66A 1E1NA 1U3VA 4YT8A 2H6EA 5JDIC 3PZBA 4X54A 4EYEA 3BMNA 2PD3A 3P5SA 2FZWA 1JDEA 2CF5A 1KVRA 2HRBA 3H7AA 3LC2O 1ZUD1 2EF1A 2FHSA 3TRIA 2BELA 2HMSA 2FY8A 4HNGA 1Y9EA 1AE1A 2NU7B 1EBFA 5BMVF 2V5AA 2EEZA 5TLSA 4MINA 1T36A 5C1PA 1JKFA 2RH8A 3QVXA 1ISFA 2HUNA 4FD3A 1IOWA 2IE0A 5CP8A 3F4LA 2HSDA 2DTXA 4XDYA 3HZZA 4P38A 4F46A 3ST7A 3EVTA 4O4HF 2NVBA 3OQ1A 3AM4A 1W93A 5JNLA 4YQYA 3I4FA 2CNQA 4XZ3A 2J3JA 4PLCA 3WMWA 1BW9B 5BT9A 3DMTC 1H9AA 4BO0A 1V6AA 4IDCA 1X15A 3WYEA 4I8XA 2AXQA 1H6BA 3U4HA 3DBHB 4DLKA 3UCXA 4I5GA 1A9YA 2LDBA 4WCFC 3OA0A 1CJCA 4PLGA 4RGBA 4BNJA 4EDFA 3NRCA 2P91A 5BQFA 5H82A 2PK3A 1JLLB 4GKVA 1VKZA 3I12A 2YQ4A 3MTJA 3TINA 3TSCA 3DTTA 5BR7A 3DR3A 3E8XA 4CMIA 3K5HA 3B6ZA 4IGFA 4M87A 2Y1CA 4HUJA 3DZFA 3PIIA 3PQDA 1YO6A 1EDZA 3WFJA 2J6IA 4RVFA 4BNTA 3ZW9A 1Z2NX 4O2BF 3MTGA 3UOGA 1MG0A 1MV8A 5FF9A 5JC1A 4B4UA 1R6DA 4ZOLF 4AG3A 1W4ZA 2B37A 1NHGA 5A04A 3ORFA 3JYOA 3PQFA 1CYDA 3CMCO 3CPSA 1DO8A 4PCVA 1NP3A 1BWSA 4KZPA 4OKNA 2D1YA 2P5YA 4PG6A 4GBJA 4R51A 5F5LA 2Z04A 2IZZA 4QXMA 1QRRA 2YZNA 4BNVA 1HYGA 1R12A 2EKPA 1ZSNA 3WX0A 4MVJA 1XYGA 4ME6A 5JBIA 2Y1OA 4DRYA 3IL2A 2OL4A 2R7LA 3L4BC 5I7EA 3D5TA 1AN9A 1BTOA 4RDHA 1GZ6A 2C5AA 3O38A 3D1LA 4TVBA 2NU6B 4ZA2A 1SOWA 4K6FA 3WTBA 2BFAA 1EEHA 2A9FA 2P4HX 4RF2A 3IJRA 3AI1A 4RZIA 1JKJB 1UZLA 5BSHA 5CPFA 2DFDA 4GL4A 1OZAA 4CQLB 2WD8A 4ESOA 1GSHA 2FPPA 3VA7A 4NU6A 3FPCA 1I7LA 4DL9A 3WGTA 3PZRA 2O3TA 2Q45A 2G1UA 4DUPA 3NGLA 1P45A 4YT4A 3ENNA 3OUZA 2EWMA 3JD0A 5MGBA 3GGOA 3PRJA 3JQAA 1I3MA 3ANNA 2P5UA 4L75A 2BLLA 4Z9FA 5U1PA 4J91A 4BMNA 1X14A 1ZK4A 4E0BA 1GQ2A 3U9LA 1ISJA 3RUPA 4ZQGA 1VC2A 2ZDGA 3KYCA 3JZFA 2NUAB 4J9UE 4IIVA 4N7RA 2W70A 4TKLA 1ONPA 2D2IA 3G1TA 3KTDA 5F3RA 3PLRA 1LQTA 2X8LA 4MVJD 3CXRA 4CQMA 5TX7A 1G6KA 4LGVA 1M67A 3U4IA 4R68A 2ZKLA 5CHEA 2EW8A 1ENYA 4YAKB 4EGFA 2H63A 1GL3A 4YPOA 1JDJA 1C0LA 3P7MA 3GFGA 1UAGA 3WJ7A 2ZB4A 2R85A 2G0TA 3K30A 1GDHA 4DIFA 1E6EA 1YQDA 2C00A 2JFFA 5F1OA 3OQBA 2VHVA 3H3JA 4IDGA 2DQ4A 5KJCA 1EUCA 1W0CA 3H9GA 1MA0A 1P0FA 5DNAA 1M6VA 2GR9A 3C7AA 1DC3A 4RVHA 5LC1A 1K6XA 1U5CA 2EGGA 1CQJA 3IUPA 4UVDA 3VAZA 1XR3A 3WGYA 2E4AA 2PZJA 1DFIA 2CDCA 3IMFA 4NZ9A 2O2YA 4I5DA 1GU7A 3JQAD 3KYBA 3ONFA 2CSUA 3ZWXA 4ALKA 4HV4A 3WYBA 3GVXA 2J8ZA 4DMMA 5JW6A 3GFBA 1B0AA 3TZ6A 4YVFA 1KC3A 1BXKA 1P3DA 1BRMA 1X0VA 4MPDA 4NBUA 4TVOA 3DZBA 4ZJUA 1ZJZA 2AHRA 1YL7A 2O4CA 3IS3A 4E33A 4RPJA 4HADA 1DRUA 4WKGA 1KS9A 4AJJA 2JD0A 4LVCA 4CQMD 1WMAA 4GX1A 3GNQA 4J7XA 3W6UA 3PDJA 3MZ0A 4A2CA 3D3WB 4P22A 5KKAA 3QY9A 3PI7A 1SMKA 4D42A 2GF2A 2NVUA 5TQVA 4E30A 1GD1O 3CIFA 1TVEA 1CF2O 1PU2A 2D3TA 1R16A 5G2OA 4HNTA 3A4VA 3C1OA 3CE6A 1SCUB 1TT7A 3GDGA 1PZHA 3OBBA 4N5NA 3BXXA 4B3HA 1BNCA 3ROKA 3K3PA 1UH5A 2JCXA 1K3TA 2GO1A 2JCYA 4UUOA 3EK2A 3RAJA 3DHEA 5F1PA 3PGJA 4U6QA 1NYTA 2EP5A 5JY6A 1MB4A 4IXTA 4W7IA 3NEPX 1VJ1A 5MDHA 4WNIA 3RU7A 1HE5A 1J5PA 4ONEA 2FOIA 2IEBA 5BNTA 2FR1A 1YQXA 4WGGA 1QYXA 3UICA 4R4JA 2FSSA 1V3VA 1DIKA 3JQ6A 4CR7A 2Q2QA 2YHIA 1B3RA 1B3BA 3FF4A 4J4BA 3L6OO 3TZHA 1UR5A 3PIDA 4ND4A 3E03A 4CV0A 3FNGA 1GQQA 2OORA 3I9KA 1HDYA 3FBGA 5HS4A 4MVJE 3H9UA 4MV6A 4KMSA 5L95A 3ETGA 1DAPA 4J7CA 1YH3A 1UXJA 4XJSA 4RLHA 2FR0A 2X4GA 3PJEA 3F5SA 1U9JA 4IDFA 1B6SA 2Z5LA 1LNQA 1O89A 3BMNB 3MJEA 1ZSVA 3OM9A 2P68A 1SB8A 1W8DA 1C0IA 2J5QA 3D3EA 2DUWA 3L77A 4YAGA 2PH3A 5EMHA 3BMQA 3F5QA 2GPWA 1W6UA 4R69A 3BTSA 1PTJA 1R4MB 1U4OA 3V1YA 4BNYA 3VTFA 3C85A 4II2A 4RQUA 2VOJA 1PJCA 4FS3A 4ND5A 5C3MA 1N9GA 1H94A 2Y0EA 2DTEA 5K6AC 1L7EA 4N18A 1MC5A 1Z2PX 1E3LA 3A28A 2GPSA 5TT1A 1LDYA 1YWGO 4RF5A 1I2BA 4E4TA 2EXXA 4D0SA 4IS3A 4XZ3B 2OGUA 4TROA 4AJ2A 1DB3A 4O7LA 4IJVA 1ISIA 3JQ9A 4XDZA 2X0SA 1C1XA 1JWAB 1KETA 3UCEA 1UDBA 3JSAA 4CMCA 4Z6KA 2BGKA 2HRZA 3MWEA 2WD7B 1KC7A 1B15A 4MIOA 2YY7A 1UJMA 3AUTA 3JD1A 3ZV5A 1PL8A 4GGOA 3CZRA 2J9GA 3I9OA 1VLLA 3EYWA 4PG7A 5CG2A 1B26A 2EJWA 4CLEA 3U0BA 4R5HA 2V6FA 1U3WA 4CMIB 2EERA 3G49A 4O0LA 1VPDA 3R1IA 3GQVA 3SX2A 4ALLA 5BSFA 3ZU5A 3KETA 2NTNA 1TLTA 2BI7A 1QP8A 7ADHA 1P1HA 1GYQA 1TA4A 3KYDB 4XCVA 2XPCA 1BXRA 4CM9D 1OBGA 4FR5A 3GK3A 3I1JA 1H6DA 1NXQA 4IZOA 3ZN2A 4D3FA 4OXNA 5A9SA 3ZWCA 2FB9A 2VQDA 5JDIA 3ONDA 2HU2A 2I66A 1JWBB 3V2GA 3WBBA 3HUDA 4NBVA 1V0JA 5TRTA 2W6MA 1ADGA 1QLJA 3UVEA 3WJAA 1PJLA 3JRXA 4HKTA 3R5HA 4MAMA 1PR3A 2HMVA 2YS6A 1DIRA 4FFOA 3OQ6A 3VPGA 1VL8A 2Q99A 4BB6A 2DLDA 2BFOA 2RHRA 3AM5A 3B20A 1NAIA 4FFPA 1YVEI 1LSJA 3PVZA 4G5HA 3RV4A 1CDOA 4CUKA 2OP1A 4XYBA 1W96A 3ADPA 1KERA 1RJWA 2UVDA 3BTVA 4GVXA 3ZU3A 4WLNA 1ZO8A 2R6JA 4JBGA 1XEAA 4A10A 3DMTA 5DZSA 1P44A 2HK9A 1KJ8A 3G8DA 3U09A 3O03A 3BAZA 5GONF 3VZSA 2SCUA 4MA0A 4MV1A 3IC5A 3QHAA 1CETA 4YWJA 2FPPB 1GV0A 1OBFO 4B79A 2ZTLA 4CM8A 2JAPA 4CLHA 2OMEA 4E5KA 5HM8A 1GAEO 3O9ZA
chains in the Genus database with same CATH superfamily
1Z5VA 2GESA 5DO9A 1UBGA 1SFRA 2G4CA 3LY5A 4OLAA 3B3AA 4LHSA 4ZRMA 3WYGA 1P80A 3DTYA 3DOIA 2CFCA 4YO8A 5L3RA 3C3AA 4BVGA 3AUYA 4A36A 5LOVF 3EQZA 4WT7A 1YR3A 4JJZA 2QVGA 2C96A 4FGWA 1SY7A 1QHSA 2XKAA 3ED1A 3F7NA 4EJ2A 3NBUA 1I2LA 5P21A 1BA2A 2DBYA 5DRTA 4KTTE 3Q7IA 1N8SA 2JGDB 3CNHA 1QV7A 2X0RA 2NU9A 2CD9A 2D1SA 2HI0A 3L46A 3K6KA 2CLSA 2ZR0A 3VMFA 4LGMA 4LXXA 4Q24A 3IAM1 3A1FA 1GFSA 3TEKA 1A9PA 4OIMA 1ODKA 4IILA 1NVBA 2AOUA 3EA5A 1DAMA 1ZONA 5DU2A 2I2XB 3R74A 1NVKA 4PWZA 4ZMSA 1W46A 4Q39A 4XAQA 1U2QA 3IRUA 2OGWA 3D2BA 1C14A 1VI6A 3KQWA 3O82A 3ZNPA 1OU4A 1RKBA 3KTFA 4NC9A 4TYQA 5TC4A 3F46A 3PRHA 1RC0A 4KACA 2NO9A 4MP3A 4EO9A 1FBNA 1QGZA 2V6JA 5B58C 1Y9ZA 4WEQA 4Q3CA 1JSXA 1OYYA 4EB0A 5KOHA 1NLMA 5D87A 3L0IB 5F51A 3E7DA 3E9NA 1UXOA 1Y3DE 4G4SP 4HRYA 2FZ4A 2AE2A 2VHEA 3BJMA 2JIMA 4WY8A 5ALDA 3AETB 2G67A 3H5RA 4DQ0A 4ND7A 4BVJA 4M60A 4XWTA 1YUBA 2B4TO 2AC2A 3E70C 3FAKA 2OZEA 3HMKA 4R2HA 1Q0SA 1ARZA 2XGMA 4YREA 3WIBA 4DLPA 5JPIA 4QATA 3S2YA 1CQJB 4ETMA 4WNYA 1RHJA 3WIVA 3ZNQA 3CEJA 1PUJA 4J75A 2IYOA 4I50F 2TMGA 3FI9A 3EPRA 3TSYA 1M0TA 2EZ8A 3INNA 5HOEA 1J0XO 3P45A 2ZPUA 3EMVA 4P53A 1MMFB 3U7QA 1YZLA 1LLCA 1IQPA 5G1NA 3M2PA 2C9BA 2RHMA 4JS0A 2YJ3A 3WZ2A 1ZD9A 2G1KA 3UZOA 2WTAA 3LRPA 4WPGA 1DAEA 4R54A 4TWBA 4Y2UA 5FPQA 3ZTYA 3A3PA 4ZDIA 4RKQA 2GJAA 3MCZA 1L5GB 5EWJB 3X1ZA 2C7QA 1TLFA 1JIJA 2YQZA 4L57A 2IP4A 1NM5C 1A2QA 2PVPA 2PIAA 3QBTA 3OE5A 1YVUA 2FW1A 3PUZA 1KU0A 3T99A 1H66A 1Y1TA 5DHPA 1TDJA 4TYNA 4KVFA 3L7AA 4UU0A 3LZCA 1ZD8A 1IN7A 5E4YA 2HF2A 2B1RA 2I8AA 3KLPX 1XJCA 1UBOS 2Y1FA 3FMGA 3U3XA 4RZ3A 3PRKE 5CLIA 2XGGA 3LT0A 2PMWB 4QREA 4ALJA 1TJ5A 4Y6LA 1YCFA 1YZHA 4L08A 3WADA 1XHLA 1Z4PX 2QLMA 2NG1A 3NJRA 4FR0A 4IKOA 4LN1A 4YRCA 1X1DA 3A6JA 3QU7A 4HXGA 4N3BA 1ADFA 2Q7OE 3GAFA 3BWXA 3OM0A 1J0CA 1YCGA 4WZ6A 4A0HA 5CW1A 6LDHA 4DXDA 4KQJA 1P62B 1AUOA 4HNVA 1T1SA 2JBHA 2JJYA 3D8UA 3PEUA 2F3PA 1CR0A 4TMFA 4ANFA 3GT7A 5FTKA 4L02A 4H7KA 1DBVO 4B4WA 4ZI2A 1P9OA 4YJGA 1M2WA 1TAQA 2YIVX 1W36D 1W59A 4FYIA 4NCNA 4M0DA 4UNRA 1IBKB 3ESAA 4JOCA 2ZTHA 2G71A 1J25A 1QHHA 3QIAA 4D0LB 4LW8A 3S3TA 1KSJA 4LRUA 3HU5A 5KMGA 5KQGA 1XKQA 1Y7TA 3CH7A 3DKVA 3OJLA 1DHTA 1GRVA 1RYHA 3AEQB 1DC8A 4O4HA 5D8DA 2WNIA 3S2FA 4CC5A 1FX0B 1T5BA 1CIPA 1V9SA 2AN5A 2H00A 2PMCA 3QXCA 4V2UA 3V4PB 3FPEA 1DWOA 3VO9A 1KIMA 2CUKA 3GELA 5KAMA 1KFJB 3P4XA 4HLCA 4AECA 2J07A 4HS4A 1XMJA 4AYTA 2Y71A 3BS4A 4LNAA 3WZMA 1E2DA 4C5CA 3GR6A 3DMGA 1QO9A 4YCMA 5ISMA 2H18A 3AIOA 4DVJA 4EMTA 3OZRA 4ZT4A 4LDPA 5IUKC 4R9UC 4GMXA 4H3HB 2ZRCA 2E48A 2P79A 2QPOA 2E89A 3SM9A 4P4NA 9GPBA 4OXXA 5T8KA 3RM3A 5I7RA 1A71A 2JARA 4KC0A 5TMDA 3UQZA 2A4MA 1A4XA 3KR0A 4FTWA 4OHKA 3MTAA 4B5LA 2QTGA 1C1DB 3GQBA 2WJHA 1DQPA 2XGOA 3QI7A 4J4HA 5HKOA 4LH6A 5I5VA 1TF2A 2IYVA 3PC4A 1FNSA 1EK1A 3PA8A 4BJ3A 4OGWA 3F5MA 5CX4A 3U3OA 5L8VA 4HLNA 5KOJA 1IDN1 2ZTVA 3MJCA 1N9GB 2HA7A 3ILSA 1U8EA 1X7WB 3GT4A 2PX2A 3KVOA 4MA5A 1Z3IX 2WJZB 3JQPA 1WD5A 3EDOA 2H1FA 3TEFA 1EDOA 3W4JA 1PZGA 4WXYB 1BVRA 1O96A 3VR1A 1U0FA 3EFOA 3GRFA 1EM8A 1QKJA 4I3FA 2IUTA 3F8WA 5FIUA 4H16A 4AY5A 1IG3A 1PNVA 3I6BA 4YS6A 421PA 3T4XA 5GP1A 4KE7A 2C0CA 1NJ5A 2AWOA 3W7BA 2E37A 4S2UA 4CBVA 9LDTA 9LDBA 4N5IX 1WMDA 1RBZA 4PLFA 1DARA 4TOIA 3PWKA 5FJJA 3RC2A 4B6OA 5K3EA 3FTDA 1USGA 3EG9A 4AF6A 2FW0A 4DW8A 5JXWA 4IO0A 4QC2A 1I7QB 1Y1LA 2VDVE 1A82A 4IO1A 4I3GA 1ZK1A 1XXHA 2O3UA 2P67A 2J4FA 3CLTC 1VYHA 2O48X 3K09A 1IHXA 1V11A 2IEDA 4MEAA 4RUKA 3ZXUB 2FMUA 3LKDA 2HJSA 1X1TA 4DV1B 2ZWPA 3AXSA 3TQHA 5B3LA 1GN9A 1N7IA 4Y2JA 4O8CA 4YTEA 3M6WA 4ODIA 4CNQA 2OFFA 3RSZA 1XZKA 3G2OA 5JT1A 1FLDA 2P6PA 1F7UA 4EGJA 2BD0A 2XQGA 3OP4A 2RFLA 1PTKA 3EDRA 3CZ5A 1WVIA 3TOZA 4KI0A 1DSSG 4J1NA 4CM4A 4C05A 3PE6A 3Q98A 4IUBS 3RVSA 1AT1A 1CWUA 3LUJA 2GA9A 4ARBA 3INYA 3AYXB 5BORA 4G4IA 1CUEA 1ZJJA 5F5NA 5CEEA 1XF9A 4LF7B 1JIQA 3FYUB 3HCWA 1MB2A 1J49A 2V4UA 3SIXA 1OB5A 2O50A 1JQEA 3GJ6A 3NOQA 4W9MC 4HQOA 3EX7C 1QFSA 3MJVA 3NHJA 3MB8A 1AHIA 4URVR 1XPOA 1NQVA 3B2NA 3Q2IA 1MQAA 2ZIEA 3L8FA 3WB2A 1FYDA 2GM4A 4TKZA 3T3MB 2QBYA 2Y9MB 3B3GA 3GLGA 2IH2A 2VP6A 3SJAA 3VNBA 4QLAA 1PNOA 4O4JF 1U8YA 1XEWY 3IQXA 4XUCA 3GL9A 3IOMA 1L5VA 1SHTX 3H19A 1WR2A 1UM9A 3GEDA 4OUDB 2PS1A 4NE2A 3UMGA 3IQDB 5JS6A 4DUGA 3RH0A 4I4LA 3RVRA 2JEZA 4C0KA 5DX1A 1MH9A 3NNDA 1PQYA 3V4OA 2IBMA 2NACA 2IYAA 3B7WA 2E5WA 1EUDA 2G5PA 2JGEA 3PUVA 2HLDD 1CUIA 4M1OA 3RFVA 3V8PA 4ZEVA 4CLOA 2PZKA 4HGZA 4XQ9A 5JNWA 4HDNA 2B4KA 2FMTA 3FOAA 3L7DA 1Q1BA 1S01A 2A9PA 1B93A 3BCSA 5B37A 1T1JA 5FYQA 2DU8A 3WHLA 2YXNA 5A4AA 1JXQA 2NUPB 3MHTA 3PEEA 4MS1B 1NT4A 5HQTA 2C4UA 4E5VA 3BREA 1S2MA 1RM0A 4Z49A 1JDZA 4AMYA 5KWIA 3SSOA 4XQGA 5AI0A 4LJAA 1IZZA 1G3IA 1CUHA 5AKZA 4Z4IA 3PHLA 1ZIOA 4KVZA 3L4JA 2GS9A 3FOFC 4TZTA 4J49A 1OLXA 3I2FA 3LGAA 4U7FA 4AROA 3UHPA 5EIAA 5FTLA 5AKJA 5KI6A 3DVLA 1PR1A 1A9OA 4Q37A 1OI7A 3OJOA 3ZTWA 2VCYA 4WLFA 3TXXA 5JQGA 4Q7LA 1H8HD 4YDHB 1UBJS 5CM2Z 3R4VA 1GTZA 1ZH0A 2O14A 1QRSA 2IEIA 2RK4A 1MKYA 2AYYA 1QVAA 3G0GA 5TY0A 4PSDA 2XMGA 3K31A 2XCIA 4U2DA 1TZ2A 4JQYA 3MPOA 4JB2A 3TSWA 1FTSA 4KKXB 3RBAA 5I7UA 3E1KA 1IHPA 3P2OA 4RZSA 1W85A 3ADOA 4O2LA 4JELA 5BQ5A 1EDBA 2OV8A 2RGDA 3K70B 3TOSA 4CM7A 3VDQA 4BV3A 3IT3A 3NP9A 3ZY5A 1CRLA 1GAXA 1SKYB 4KG7A 3LBFA 3IAAA 3GVCA 3H7IA 2QYTA 2HF9A 4CW7A 2ZYSA 4CMAA 3KZKA 5IT4A 1SOMA 3ASZA 3FSGD 3OCZA 4ZMRA 5BV0A 5FWAA 1M1ZA 1RPNA 4QUBA 3S2UA 4P58A 4H1TA 4G24A 1GM5A 4KE9A 1SQFA 5ICFA 5E9WA 2OUIA 3ZHCA 3H5WA 2B8WA 4QU8A 2GAIA 4UCWA 5DTRA 1A04A 2CUNA 1GCOA 1WU7A 4LMRA 4TQGA 4CFYA 3DV0A 1RZUA 3RTXA 1QR2A 2CLFB 3AJ9A 4QFMA 4XGRA 5JTUA 3AU8A 3C3MA 2VDQB 4YO7A 3ZXIA 4FB5A 5FNVB 1E9AA 1FQWA 1VRWA 3AEXA 5FOTA 3KXPA 3SYNA 3VSDA 2P9JA 3N8NA 3WRYC 4N39A 3HA5A 1EWQA 2O0JA 3UXHA 4AW9A 5CVDA 4MUJA 3UKOA 1U1IA 1KY4A 1M8KA 1QMGA 1L4MA 4C78A 4HXFB 1JFTA 2PUJA 4KJZA 2XSZD 2L42A 4LRXA 4DEVA 3H17A 3ZHUA 4E5DA 4RFLA 4UULA 3HU1A 4X6LA 2P62A 1IMJA 4BP3A 2VJBA 3M9XA 1P1CA 1G38A 3C8MA 3LXUX 4CGYA 4FEYA 3BHJA 2ZM5A 2FG6C 1G8HA 2PCJA 4ZTUB 2GJKA 2O3QA 4I1RA 2AKYA 4XIFA 2BP7A 1G0OA 1TB4A 2IDJA 3DLPX 4LQDA 4HQFA 1NT2A 3U1BA 2HQSA 2DQKA 4W9NA 5AFSA 4NK4A 3KUDA 2FZ5A 2MR6A 4P6VF 2Q5FA 4LF6B 3MGAA 3SGIA 3TCNA 2O6HA 4MUBA 2I3AA 1NULA 2PLRA 3FPHA 3NALA 2I03A 3NB0A 3WC4A 5GQSA 2LW7A 3GYBA 3MS2A 4YAFA 5BMVB 1XU7A 4KWHA 3R77A 4LRWA 3SNOA 3BB3A 1KVQA 2M32A 2R6CA 1IM5A 4HH3C 4J90A 1A5SB 2WDZA 2I9KA 3OD5A 1EFKA 2J3DA 3AIIA 3QPAA 4BLPA 1BQ4A 2JZCA 3AESA 1JHYA 3BUSA 4V0SA 3HYRA 5JVDF 1IJEA 2OSVA 5ICGA 3TS1A 3DOUA 2EKLA 4K0RA 1XZ8A 4LTNA 3T5DA 1ND6A 1RLOA 2JFNA 1H0HA 4LSGA 5HXAA 4MRSA 2JA2A 1IE3A 1P1FA 3AOEA 2AN4A 1KJZA 3D2CA 3N2YA 4CR6A 1PT8A 5EHIA 4HX9A 1JLRA 1CZNA 3O93A 4HDKA 3VR4H 1SVOA 3MINB 1SC4A 4EY4A 4IV8A 1Z22A 1RR6A 3NIDB 3OO1A 4KYTA 4QRIA 4AFNA 3FF1A 3O1HB 1X1AA 4RAOA 4RVOA 3LFHA 4TL7A 4BDTA 4KQKA 4EJ0A 2VDLB 4S1WA 3KS9A 3C43A 4D97A 1IYZA 4ZCSA 1I2ZA 3G2NA 4DABA 1JH8A 5KYWB 1ZNQO 2WICA 3EOAI 3DE4X 4YT5A 4A15A 2QTBA 5EHNA 3DFFA 2BR5A 5HP4A 2FZEA 2ILTA 4PIVA 5G4KA 4C0AC 2BISA 1NUHA 2IPXA 5F7XA 3VX4A 1C7EA 3ZQKA 1NBMD 4EFEA 3H42B 3OKAA 2JAOA 5KYXB 1DRKA 1Y98A 2B34A 4WNAA 4TMZA 3WMEA 4DLAA 5A0VA 4UCTA 4ND1A 3OTIA 5ALHA 2BGTA 4DC1A 3G2JA 5HX7A 1PEYA 1Z5UA 1FRVA 4GBED 1D1SA 2WT9A 4IUDS 3LBNA 3WLRA 1SCIA 4OTZA 5EHZA 3GCXA 3QF4A 1Y4ZA 3H83A 4QWMA 3B6JA 1MQ9A 1SC6A 2X4IA 3BK2A 1MFZA 2FQWA 2YZ7A 2NAFA 2ZANA 4IJKA 4DEYA 3TIVA 5BT8A 5FRDA 4DRXA 3E53A 5GWXA 2R8OA 1H2XA 3N9IA 1GPH1 4RTOA 1ZRMA 2NT3A 5CB4F 1SD1A 2DMRA 4NZNA 2A5DA 2GPBA 2QQ5A 4KGXA 4UW9A 5AVUA 3KQNA 1CYEA 1QAQA 2ANBA 2WVAA 4N6GA 1ONNA 1Q0TA 4IZHA 2VSFA 3H9JA 2O8VA 4KAJA 4Q1EA 3QUAA 5D3QA 4FBGA 2BBSA 3TWOA 3PQEA 5AT1A 1ZN7A 3DP9A 3L1IA 1RWMA 4HB3A 2WI8A 1RXSA 3FTPA 4DCMA 4B85A 4HXYA 1G19A 1P0PA 5AI5A 5M34A 3ZVRA 4QWWA 1W75A 4TT3D 3VR2D 4Y1RB 4XX0A 3ZWAA 5SV2A 1IMOA 5HKLA 4N8SA 3ZNNA 1PT6A 1C3XA 2A8YA 1Q0UA 1C3OA 2VUHB 1BWPA 2VYVA 3OQIA 4O4IB 4ALMA 1KF0A 2VWQA 3KJHA 1IRXA 4CMIA 4URHA 4ILEA 3CRW1 4FOSA 3PWSA 4YYEA 2NNLD 1OTHA 1SG9A 5C80A 5CNMA 3KSMA 1J8VA 4I19A 4KLZA 5CLQA 1U1GA 3TI9A 3IA7A 3F6PA 2DRIA 3UY4A 4AJOA 3CKKA 3QBDA 4LTDA 3PC7A 4R98A 4FWBA 4NOKA 4E2XA 1ZVVA 1F0PA 3B1KA 3U4QA 1CUCA 3W3ZB 4I6EA 4BRWA 4ZVLA 3W0LB 4R71A 4K3VA 1XEWX 2H8GA 1DELA 2PT5A 3W9SA 4B8ZA 5KSZA 3RIMA 3T3NA 2WJ3A 1DFGA 4W6ZA 4WLEA 3UMJA 1TFUA 4K86A 2CV0A 2I29A 2GVZC 4ER5A 1CUXA 1Y4SA 3MMPA 3G9TA 3KPWA 3PDCA 2EF0A 4H7PA 4ZT3A 4OLBA 2RHBA 2GETA 4YBRA 2H52A 2QP4A 2QTRA 1IBSA 4KLCA 5ENVA 1NNI1 4F06A 1E1QA 2VJYA 3K9WA 3PKIA 4ITVA 1PJZA 2NT4A 3BFJA 4RLSA 2GQ0A 2HMTA 1YRHA 1LS6A 3D7RA 5IC4A 1GL7A 4FYVA 2VYND 4NV3A 2A0XA 3RVKA 3E5NA 2IPMA 1X0XA 3H5NA 4JAVC 3KB6A 3V6MA 2RGYA 3OQMA 4E14A 1EFRA 4O02B 4DDVA 1XP5A 4E07A 1BE0A 2DFTA 1CKNA 5E1MA 3VBCA 1RLIA 2YHSA 4GNRA 3GLFB 5AVOA 4LRQA 1NG1A 4YUWA 4P5PA 3U7FB 2ZAGA 3FFAA 1DTEA 2IS2A 3ER6A 2KBFA 2JIRA 3CPJB 1ID1A 1UPBA 1YVRA 3OX1A 3BXGA 1JR4A 2C4NA 3N0TA 2ZUWA 1EE9A 4OHZA 2Z3WA 4NQRA 2R8ZA 3R3WA 1CHNA 2VDPB 1PF7E 3KQLA 3JCZA 4QOHA 5GVRA 4HQRA 5KWEA 4GI7A 2Z2JA 2HWXA 4EFDA 2VFAA 3ANSA 4EJ6A 1X3SA 1HT1E 3DLTA 2B8TA 3LY8A 1VE3A 4JVOA 4RHXA 1E9VA 4RD3A 5L40A 5KQSA 4Q3LA 1IJKA 3G2QA 3X0DA 1UDWA 5LP6A 2XMSA 5EWLB 4Q9JA 2YX1A 1MW9X 1U8AA 3BIFA 4B44A 2H2IA 2PYIA 4GSLA 4M89A 3C24A 2RHOA 4WESB 2HKIA 1Q19A 1JQAA 4KBYA 1QPZA 1MZPA 1HYHA 4Y2RA 3C8DA 2H8KA 2PKYX 3TZQA 1ZK0A 3TYXA 2Q1UA 3GRUA 2JI9A 3T9FA 2VDUE 4YWHA 1WXHA 3Q6NA 3OE7D 5T67A 1MOSA 2XCLA 4U7WA 4RF3A 1CUWA 3BIXA 4S0ZA 3FMFA 5TPWB 1VYTA 3A9TA 1M2OA 1X92A 1Z7BA 4M1QA 4C0XA 1I14A 8LDHA 2O8BB 1MBZA 3T0FA 2RHLA 3PHJA 3RROA 3HI4A 2J0UA 4HQ0A 4CT5A 5KX5F 3MRXA 4MS4B 2J3IA 4MS3B 4YRDA 2VJOA 2H08A 3RAEC 4PG4A 3OIGA 2WE7A 3LBYA 3QPDA 5DGDA 5TEWA 3SDZA 4NK5A 1O95C 1U90A 3U13A 1HQKA 2EGHA 3Q2KA 3LUCA 1RYDA 1QK3A 4P32A 3FDZA 3HADA 1N8KA 2PGAA 3NCHA 4MV5A 3IPAA 2RGAA 3UAZA 1AUPA 1PSDA 1NC1A 4C76A 4DQUA 5JU6A 3WO0A 4F12A 4K46A 2BZ0A 2F1OA 1GA4A 3BRCA 3PNQA 2XUHA 4YMSA 2Z2ZA 5KHAA 3PXGA 1KMNA 1ORTA 5AJTA 5G0TA 4M0EA 4GP9A 3JAKB 4J0GA 1V4BA 3IP3A 4IDEA 1C4XA 4NJMB 4XW2A 5JCJD 4YCNA 3MD9A 3MOSA 1ANKA 1GUBA 1GTVA 3LLUA 3H5LA 2DUUA 2XA9A 4OI4A 1S1MA 4XB2A 2JGIA 3TNLA 2YOFA 2BFWA 3KJEA 3TRFA 1U7TA 1H0KA 2PEZA 3DGFC 3PYXA 4PQEA 1L8OA 4J3JA 2IHKA 1Z15A 1SIWA 1KKUA 3MLAA 1XLWA 1O9GA 5KIAA 2I71A 1GRNA 1HQYE 2A7XA 2PUAA 3M6VA 3AZQA 2I5PO 3TQRA 1WHTB 2I7TA 2XNDD 2JK1A 3F6EX 1N1MA 4RO0A 4EA9A 4QUAA 1HE4A 3W7VA 4RPGA 4YUXA 1U02A 1JIUA 4BO7A 3PFWO 3K0CA 2A1HA 5ALOA 3L1UA 2DB3A 4WW0A 4Q4HB 4G5SA 1ZNXA 2OBNA 4YYZA 1C50A 4IEFB 1Q7CA 3GRPA 4DR7B 4MV4A 5CNJA 3CRVA 1U4SA 1VJRA 1XTQA 1DXOA 5ALVA 3DTGA 2Y66A 5AHKA 2HAEA 3KXKA 1TJPB 5HZKA 3D1VA 1EA7A 1HMPA 3A04A 1L3CA 4Q34A 3QUBA 2E5LB 2OCDA 4P2BA 4UM9D 4B3SB 1NBWB 3BWDD 1OA0A 2ETVA 1KYQA 2D5AA 1Z37A 3FUVA 3BA8A 4UNIA 2JFYA 3DZDA 2QTVA 3OEEA 3J81A 4OQQA 5C4MA 2JGKA 1B1CA 2C0PA 3C3KA 3H2ZA 2LRHA 2XYQA 3VKFA 4YCLA 4C07A 2PL1A 3MJFA 2IOFK 2QYHA 1YRYE 2G72A 5KNDA 4K9OA 1QHYA 3GJRA 5ERXA 5KYGA 1BA3A 1UK9A 1BOFA 1JUDA 3D4IA 3QH4A 4IG4A 5IK2D 2TRSB 3L0YA 2R8RA 4H31A 5EUCA 3WKAA 4QTYA 1X9IA 3D6NB 3KSRA 4TRJA 2ZSHA 3GGPA 2VTBA 5U9CA 2AFHB 2WG1A 3V55A 2FZGA 5HIAA 1ZI8A 4LJKA 4E1BA 1ADCA 4HGPA 4ENUA 5KNBD 1X8JA 3MHPA 4BTEA 4ABYA 1LTHR 2GI4A 3EAGA 5CUQA 4NYJQ 3V1UA 1SK9A 3ZVMA 3RG8A 5ESDA 1B41A 1GKYA 1MHTA 4V02A 1L5KA 1HSOA 2NQ2C 4YJHB 2NAPA 4CMEA 2QV7A 3QE4A 1BU5A 2CNBA 3GLHE 4KPYA 2WFLA 4Y0NA 5DN6D 2VAPA 4OQXA 3UJ8A 1EJ6A 1AY0A 2X1HA 2CWWA 3Q2OA 3FB1A 2B8NA 3OZFA 5IMBA 3S5JA 5KSPA 1PNTA 4EJSA 5IZCC 2GAFA 3ZXXA 2J9ZB 3T8YA 3ZLUA 2Q4EA 4UPEA 5JCXA 1DJOA 4DHWA 4P0QB 1JEQB 5A3VA 2Q3CA 3ZHTA 1PV1A 3N05A 3PD1A 1OT3A 1SKAA 2BGNA 4PY2A 4R0VA 4AVYA 2DYKA 2ZI7A 1C7QA 1DC5A 4FM9A 4BYGA 1HT2E 5FHRA 4BX3A 1A69A 3H2JA 4AD8A 3GVPA 2YIMA 4H1VA 4QT0A 2F62A 4C88A 3T9CA 1D7OA 1ZWKA 2CVFA 1N2ZA 5C7IO 3JQFC 4KFCA 5FXMA 3K9QO 1PJAA 4ZI5A 1K4YA 2B6NA 3B70A 3FNRA 1QPBA 1M2VB 4H9GA 4IUCS 1W5AA 1Y1QA 1L5HB 1ENOA 3BKXA 3GZ4A 2J3LA 2PY6A 3FKSD 3IAS6 3MCWA 4MR7B 5EIHA 3SPXA 1XP8A 4RH0A 5E6SB 2G7MC 3HTXA 3KK0A 5EIBC 3GRZA 2NYAA 4GR5A 5GVSA 3PA6A 1RW4A 4FFWA 1JG6A 2ZBGA 3AC0A 2HX1A 3ULKA 3CZ9A 5KCZA 1WUYA 1JN0A 1QJ4A 3EGCA 3UJ7A 4HQLA 4QYWA 3FR7A 3VPBA 2PWZA 2BFMA 2R11A 2QUAA 2FYTA 4JDUA 1ZD5A 1NXOA 4L16A 2QRNA 5CHYA 3O8QA 1TKCA 1QTRA 2QL9A 3LT1A 4GHWA 3Q8MA 1X7YB 4HFNA 3K92A 1KQPA 3KQHA 2NM0A 3IE2A 4MP6A 3L0SA 1WQ1R 2YYYA 3A2NA 3A1CA 3ICCA 4UBNA 4EYOA 4Z5XA 4YUZA 5LOVB 1V8ZA 2PU5A 4M1KA 4URWR 4U00A 4UC0A 3WK8A 3U7HB 1TMYA 4J3FA 4UEOA 4D3SA 4NCAA 3SEAA 2ZYGA 3BCHA 4JP3A 1ZEJA 1GILA 3ANMA 5EHQA 4YHHB 1PK7A 1A5AB 2OFOA 4DIDA 4G26A 4ZT7A 4Z4GA 4WN9A 5K20A 2AOXA 1EFDN 1U3UA 3BAAA 5CDUA 1SXHA 3MTEA 5JJBA 2CE2X 4LWZA 5GZ6A 2GBGA 2G9VA 3AL3A 4XXHA 3J81k 1OFGA 2JD1A 5LSAA 4G8JA 4MKXA 1OH8A 2IYSA 3Q7QA 4ENTA 3BACA 1MAVA 1EA5A 3Q3CA 4B4OA 2VXYA 1NY6A 1Z0FA 3ZV6A 3QVLA 3SD7A 3VNQA 4YB8B 2RH4A 3GJXC 5H7XA 1I2AA 2DFVA 4AJ2A 2UZ4A 1KR2A 4RY2A 3W8EA 2BEWA 1DKLA 1KP2A 1WQ3A 2YWHA 1DNPA 4KPEC 3RUIA 3WBKA 1FNNA 3GUZA 1JLKA 1FB5A 3CBGA 4WFIA 4F85A 5AVZA 3ZVLA 4PX5A 1DQSA 4I5EA 3DWIA 5ITWA 4AJ4A 1B00A 4B17A 3TNDA 2HJVA 2WK1A 2J5KA 3FM9A 4I0WB 3DOCA 4LYFA 5BW5A 5D00A 3DCYA 2XADA 3KVVA 2XB6A 4J0CA 5H80A 3FWKA 3IVMA 1G55A 1NRJB 1V3UA 2L19A 2X8BA 1KOFA 1U28A 3EF3A 3G1UA 5DBIA 3HGQA 4ZPXA 3ZHRA 4PLWA 3U7IA 5E1OA 4PSCA 4I99A 2R6GA 2XXAB 4JB8A 6PFKA 2C4VA 2X5KO 5C7LO 2W71A 3V4SA 1BAPA 4NCJA 4PTYA 5A7FA 3BHMA 4PU0A 4WOCA 4CKBA 4GOKA 3VR5H 3RBZA 1LV8A 5KKCA 1QX3A 1JDTA 2R6R1 4BO6A 1XCPA 1Y48E 3PNSA 5LBTA 4DFDA 1D2AA 1E9BA 2UUPA 3H0CA 3N86A 3R5FA 1Y3FE 3IDSA 3EC2A 3T0IA 1PTJC 2VSOA 4RL4A 2PSSA 3SXPA 1D3AA 1E6WA 4PCLA 2GCNA 1U0HC 1ZUNA 3EW9A 3LCVB 4RAQA 1E98A 1H3NA 2O2HA 2WFZA 2XZDA 2UYCA 4X7PA 2LR0A 5AI4A 3UIEA 2GEJA 3P0HA 8ABPA 1P2BA 2HLHA 2QLLA 2V6MA 3SQLA 3F7MA 1PYOA 1A7UA 3PDUA 4UKDA 1KDZA 1D2GA 2YRWA 1YJXA 1OXTA 4D9HA 1H05A 2AMYA 3M5WA 2PRKA 2IKSA 5B5SA 5LA6F 4PYJA 3LU1A 5T57A 2IY9A 4UTXA 2LWIA 2FWMX 1NVMB 2OZLA 2AOTB 5D51S 5K0LA 1T2CA 1X39A 3REQA 3WIDA 5KREA 1QGED 5CAEB 2D4HA 3KUUA 4BO5A 2PJZA 1TTHA 4H7FA 5J1TB 1KOLA 1EX1A 4O59O 2GCOB 3DYBA 1I10A 3QSYA 1XIVA 2R97A 3ND7A 4EM6A 2GVNA 5K6AA 5FKJA 2J6CA 4JLPA 1SXGA 2NTJA 3HR7A 4TWJA 4XWAA 1ODJA 2ECOA 3ZS9A 1J39A 2ZJ7A 3ROPA 1T2EA 2FVXA 4F3NA 1G63A 3PFBA 3ABZA 3B9RA 3HFSA 2NYVA 2IF2A 3R3UA 3GMSA 4OMCA 2VIIA 3CN7A 1KI4A 4MGHA 3ZGNA 4F4UA 2VRWA 6REQB 3WL7A 3VPSA 3OC6A 4A8JC 3NHUA 4BQSA 4J16C 4I2VA 4FC6A 1BDBA 1E2KA 4S2EA 4CI9A 4ZC8A 1JEDA 1QXSA 2AMVA 4YRAA 4NEQA 3AFHA 1NF8A 3MEQA 2YJ6A 1PZFA 1N2EA 3BH7A 3AIKA 4HMQA 4B6SA 1SQ5A 4D9NA 4AZ0A 2SNIE 1Y8RB 3E4CA 1SQ0A 3O1JC 3CY6A 3T4PA 3COWA 3EZYA 3G7NA 4ROTA 1L5LA 1I6MA 3RHZA 1J20A 3LQ1A 2ETXA 3U40A 3H8VA 3VPAA 1H4SA 2OP0A 1E3EA 3AL0C 1DRVA 4AICA 4IH1A 2XMCA 4AP5A 2WJ4A 4D9EA 1PWXA 3N5KA 2HEIA 3CJTA 3HB4X 4NAHA 3LUHA 3R23A 3HY3A 4UPVA 3T9EA 4IL5A 3JQ8B 2C2MA 4BKPA 4GICA 1CRPA 3GW8A 1ZJ6A 4PHCA 1J1IA 3C5HA 3U3DA 4GBMA 1YAHA 2IYXA 4WIAA 2WVGA 4E21A 3KC2A 1V1JA 3HFRA 4KXMA 1Q95A 4XB1A 5FUWA 3IR6A 2JFVA 3GZTB 3G68A 4P7BA 3QBEA 3V97A 4YLEA 3DS8A 1K2WA 1IEXA 1LBEA 3L01A 1X8LA 3W5HA 2R7KA 3RIYA 4EPVA 3DUWA 2B2XA 4A16A 1Y6RA 1BQ3A 4J8PA 1YONA 3TUIC 4BB5A 3WK4A 4BFSA 4H4EA 2E9SA 5AI8A 4II7A 4D5GA 3DD1A 5FOSA 5HK8A 5ALPA 5C1BA 3G2LA 3TR0A 3ZUPA 3ZY6A 1CZKA 2CMFA 3FNHA 2O2XA 2YC4C 3O4HA 3RR2A 4IDHA 2UUBB 3HVRA 2HRQA 4YJ2F 2XZPA 3HJNA 3L3BA 4KH0A 2OWDA 4DXHA 3E7WA 1R4NB 4U0JA 1N5IA 4GEGA 4AX8A 3HM9A 1K1EA 4U6SA 4PX2A 5G0VA 1ZGAA 2HA3A 2PH7A 1RCTE 2Z3VA 3LI2A 5C32A 2C2KA 2VDRB 2HGSA 1FDRA 4JP8A 4U7PB 3ESXA 3HJBA 4HWSA 2DSNA 5D7BA 1LNSA 4O2RA 1M2EA 4ML3A 3FH0A 3OMWA 3EGOA 3EIQA 5CYFA 3WTCA 1F3OA 3B78A 3RUHA 2W00A 2J09A 3CZ4A 4XD7A 3AKEA 1UJBA 2UXBB 4JEHA 5AOBA 3EEYA 4KO8A 4B6JA 4JROA 1P8AA 2WRZA 1K9VF 4HUQA 1FFXA 1T0BA 1J8MF 3WK7A 3PJFA 1GNTA 3ITNA 2Q50A 2RCYA 3QFSA 3JS5A 3NJ8A 4EKIA 1TAHA 3B52X 1EVKA 1JALA 2QMUA 5TJ9A 3U37A 2QP9X 1CFJA 2QLJA 2WJJA 3ASVA 3FPBA 3MAGA 4O4JB 3PL1A 4QA9A 4ZO7A 3W2TA 4G97A 1W36C 3DF7A 1C30A 1IY0A 5IS2A 3R9WA 2GARA 3OPNA 4HDOB 4QTXA 5DAAA 5B12A 4W5HA 4OVKA 1ZW1A 4L73A 1CDZA 1ZMOA 4FVTA 4WUVA 1RXIA 4G5QA 2EHJA 2LV8A 2WJPA 3HXMA 1SKQA 1T8SA 1S2NA 4ZKEA 4X9XA 2HK7A 5BNFA 4LHZA 3SR3A 1VI2A 4XYGA 4UTPA 1MVOA 3VO2A 4E09A 4ZDWA 2VTKA 4GFDA 2V0NA 2Z0MA 3WLEA 4YR9A 4CETA 4E5NA 1Y3IA 4O7YA 2GEBA 2R6DA 4NHEA 4YP7A 4ZYVA 2A1IA 2GN0A 5JDCC 2B78A 2ZFUA 4C4AA 5IXJA 2LCQA 2NTYC 1T6BY 1G5QA 2ZBUA 3WHPA 4WAUA 1BGVA 3KQMA 2A9QA 3GUUA 1XU9A 3KPYA 3LOQA 3CW8X 4D98A 4QM7A 3ETDA 3QITA 2H7CA 2BRUC 3Q87B 1ICEA 3O4JA 4M1SA 4OMDA 3Q85A 1WZEA 1GXSA 3W7AA 4DLNA 3DONA 1RRPA 3ORQA 4BMYA 4DWVA 2I6QA 3B7PA 3BPSA 3RRMA 5KTOA 3AHJA 3T9DA 1TC1A 3WSVA 5EZ5A 3CZCA 5HW0A 3KD3A 2ZZMA 4MQ5A 3U1VA 3T7IA 2VJMA 5JNUA 4GXTA 3HNRA 2O5RA 5DSTA 4EQ6B 5KPDA 4RX1A 4QQRA 4ZVPA 2G1PA 2XCSB 2AUNA 2FAXA 2OECA 2FPRA 2IVFA 3EFEA 5BSRA 4A73A 5K0BA 5B7NA 3UJ6A 4JGBA 1GDDA 2J46A 3C87A 2Q6TA 3H86A 1LDMA 1EQUA 3ELYA 2P1RA 3TRJA 3NEAA 1SEVA 2NXJA 1BD3A 1GFZA 1E32A 1SUIA 1GQRA 3N76A 1XRJA 4TWAA 1VJGA 2IRWA 1KI6A 2C4HA 2NW6A 3IILA 1CJSA 5JAUA 5ERGB 4LKOA 2DKNA 2A9KA 5TXGA 1AXGA 2B83A 2PSDA 1M2NA 2ZSDA 2W5UA 3IP1A 1KDTA 1S8AA 3ZU2A 5BV1A 5L3QB 2IZOA 3PXBA 2CYAA 1NW5A 4YY3B 5CIQA 4NAUA 2H2GA 3M5PA 2P4QA 3M6UA 1SOVA 1EFTA 3NYQA 1Z3CA 2VLBA 4WK0B