4FFLA

Pylc in complex with l-lysine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
363
structure length
353
Chain Sequence
MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYGLEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVLKERFGAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PylC
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase
total genus 117
structure length 353
sequence length 363
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4fflA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fflA01
4TRRA 4TWRA 1VC2A 1ZMOA 3D3WA 1E3LA 1TI7A 1DIKA 4G2NA 4PLPA 4NU5A 3ZWAA 3GF4A 1I3LA 3QVWA 4YT5A 4DBVO 4BKOA 2HAEA 1UAGA 3OH8A 2PVPA 1FDSA 4R51A 4I8XA 3WGZA 2IEBA 2PKRA 3PXXA 1U1IA 1T1SA 1U3VA 3RUEA 3W6ZA 5K6AC 1FDWA 3ORQA 4Y9DA 3K9QO 5L4NA 5DULA 3WFIA 3G3EA 4CLEA 5KJ6A 1HSZA 1EVIA 4C5CA 3PHLA 6LDHA 2DU8A 2FR0A 3RASA 4GL4A 4CQLA 1ZNQO 3Q9UA 2DM6A 1Y8RB 5A05A 2C07A 1Q0QA 2DPGA 3EVNA 3RUHA 2X86A 1Q0HA 1HEUA 5G0VA 2VOJA 4JCOA 3VPGA 1M2WA 3QWFA 4CM7A 1CDOA 3R6DA 1ISHA 5A06A 1LDYA 1X14A 1LLQA 3MWDB 4UVEA 5A9SA 3MTGA 4PLVA 5DBGA 3MZ0A 3IC5A 3TQTA 5EQFA 2W71A 4B7CA 3O26A 4L73A 3GG2A 1Y5RA 2V6BA 4LK3A 4Q3EA 4BNWA 4E2YA 1VM6A 4A10A 1YJQA 3GPIA 3HB5X 2EGHA 3K30A 5J2TF 1VBGA 4FJ1A 2GGSA 1ZXLA 3GAZA 1N7GA 3D3WB 4OGWA 3FPCA 3EDMA 1DJNA 1B8PA 2OBNA 1TB4A 1MXFA 4GMFA 4XA8A 3GC6A 3K92A 3O38A 4IDAA 4IS3A 4KDEA 5A04A 4O83A 1O8CA 3B1FA 1CQJA 2GLXA 2Z95A 5G0TA 1TT7A 2DBZA 3DBLB 2FWMX 1MC4A 2CNVA 5GZ3A 3C7DB 1I7NA 4AJ2A 4EGFA 1P0FA 4CQLB 2CMDA 1N8KA 3KTDA 4UULA 3JRWA 3PJGA 1XWFA 3JYOA 2PY6A 4HFJA 5JFOA 5A5EA 2GD1O 4BNIA 2HRBA 3WQRA 5FI5A 4TUYF 1R66A 4J7CA 5ENDA 3C7AA 3WLFA 3OMLA 1C1DA 4ND3A 4B3IA 5A9SB 2X5JO 4KUHA 2FMUA 1YS4A 4MVJI 4YR9A 1M6VA 1E0DA 5LXTF 1PL7A 4E21A 4ZD6A 2GUGA 1AE1A 3E03A 1OC2A 4CLHA 1C1XA 4BV9A 3WYEA 2JKVA 1CE8A 1QP8A 2JHFA 2J3JA 2DUUA 5JMWA 2AEJA 1JAYA 2Q2QA 2YY7A 1IB6A 3AUSA 3UW3A 4J4BA 1C0PA 1YL6A 4MV3A 1YGYA 3KEOA 3MTJA 2EG9A 3QE3A 5ER9A 4RLSA 4Z3KA 3BMCA 4JBGA 3RAJA 2PD6A 3LK7A 4BO0A 1V0JA 4KUEA 3B20A 4W6ZA 1I24A 4QUKA 3TW6A 1LRLA 1CQJB 3VH3A 3L0DA 4BNMA 1VL8A 4WKGA 3PHGA 2IZ1A 1AUXA 1N2SA 3K8ZA 1GDHA 4IS2A 3ULKA 4I5FA 1UAYA 1Q7BA 2O3TA 3ZV5A 4DREA 2Y0EA 5L95A 2IXBA 4FQ8A 2J9GA 1YE3A 3HB9A 4HNTA 2RH8A 4IDDA 3GMDA 1RYEA 3VMMA 4OKNA 3VVCA 4AJ4A 2YYYA 3U9LA 2AA3A 1DAOA 3HN2A 4RJTA 4B8WA 4PN3A 5KJEA 5BNTA 4EYEA 3ZWYA 1PGOA 5DBIA 1TXGA 1LQUA 2G82A 2XXBA 3INRA 3GN1A 1R4MA 2AQ8A 2DLNA 3IMFA 1T2CA 4Z3DA 3ADPA 1C1DB 1FDVA 3DMYA 1SMKA 4AJHA 4XCVA 2P5UA 3AM4A 2YZGA 5DCYA 3FF4A 3UFXA 1BNCA 2XPCA 3IS3A 4JJFA 4I4TF 2Z1MA 1C1XB 3ZNNA 4CMCA 2VHWA 2WM3A 2YZNA 4R3WA 2ZB8A 1X0VA 5IAAA 3H5NA 1EBUA 3KYDB 2YV2A 3ORFA 1HRDA 4MIEA 4ALNA 4D41A 4IQ8A 3I1JA 3I6QA 3GN2A 7ADHA 1PGQA 3BMCB 3VHRA 3VPCA 4YAGA 1Z2OX 3BYZA 4GX1A 4N54A 1GTMA 4NZ9A 3ZW8A 1NM5A 1V9LA 3FR7A 4PG5A 4MVJA 4EGJA 1DFHA 3R0IA 3ZWWA 5IJZA 1KJ9A 4AJJA 3B1JA 4M86A 1NVGA 4II3A 2GSDA 5JQGF 3BMNA 2IODA 3E1KA 3ETJA 1VBHA 4PG6A 2BI8A 3B6ZA 3SLGA 3GVPA 1YO6A 4KDFA 4NBRA 4UUPA 5TT0A 4BNXA 4YWJA 1GQYA 2NQ8A 5JH7F 1SOWA 2VWHA 2OORA 2R6JA 4YYZA 2I67A 3GMSA 3BTVA 3HDJA 3TOZA 2JCYA 4U0JA 3WIDA 4IXTA 1R4MB 4Q3BA 4EUEA 3U4CA 2JD2A 2GO1A 4YJDA 3OEYA 1KJ8A 4I5DA 1P3DA 4CM3A 4DPKA 1XIVA 3CIFA 3H3JA 4Q39A 4WGGA 3UAGA 3UFXB 2V6MA 1HE3A 3VC7A 1PQPA 5C7IO 4MV9A 5JCXA 3E6AA 5KWEA 1DSSG 5IDXA 2BMAA 1QYCA 1X7DA 2EHDA 1HYEA 3DMTA 4AJIA 2VPQA 4EJ6A 2DFDA 2Y1EA 3CUKA 1H6BA 3ON5A 2VHVA 1R0LA 1SPXA 4FFLA 4NMHA 4RF2A 5TS3A 1Q0LA 3KBOA 1WZIA 1TA4A 1DFIA 5KIAA 1GPDG 1OZAA 3I12A 5BMVF 3AI3A 3E9QA 1DLIA 4CMIA 3JQEA 5CP8A 5IF3A 3Q3CA 2QF7A 3PJDA 2BFMA 5JO0A 1MP0A 4TSKA 3BMNB 1I30A 4K26A 3ITDA 4E32A 2R00A 3TFOA 3W4JA 2Y1DA 3ADOA 3HN7A 5J2UF 2WD8A 1U9JA 2A35A 2VWPA 3GG9A 4Y6RA 1IY8A 5CG1A 3KB6A 3AU8A 4ZN6A 4TV9F 3F5QA 3R5XA 3RIHA 1GCOA 4Z9XA 1S7CA 1VJ1A 4HUJA 2JCXA 2ZTMA 2WD7A 5DT9A 4A7PA 2YL2A 2W2KA 4UAGA 4MV6A 4I9NA 4ND1A 1GL3A 1P45A 1TEHA 3ZHYA 3WR5A 5EZYF 3JQBC 4FOOA 2EIHA 4I5EA 1LBEA 2V58A 4YT8A 1W93A 4FFNA 2O3JA 3FTNA 3GRKA 3I4CA 5ITVA 3ROKA 4MV1A 1EZ4A 3QVTA 3RUFA 1LDEA 3LF1A 3P19A 3KRTA 1CWUA 2EP5A 3RC2A 4KQXA 3I4FA 1HE4A 3RKRA 3NDRA 3F1KA 3WSVA 4NFHA 2WMDA 3DFUA 4GMGA 1CIVA 4DXHA 1BWSA 1U3WA 4IQGA 1MX3A 1LQTA 2ZIZA 2O4CA 3CZMA 2XF8A 5KNLA 3KALA 5JSFA 4FGWA 2CNUA 4F45A 2E6UX 3L4BC 2GERA 4L9RA 2W90A 4KTTE 3MJVA 3DB2A 1U3TA 3WGTA 4CMIB 2NTJA 2IXAA 2Q1UA 4H7PA 1AXEA 3D4NA 2AQKA 3K5HA 1PJ2A 2VHYA 4QFCA 4UVHA 5U1PA 3HHPA 1XDWA 3OJFA 2EW2A 1ISMA 4DIFA 4IXWA 3HFSA 4BO1A 1WW8A 4O86A 1V6AA 2IEDA 2I3AA 1Z7EA 2PD3A 3RSHA 5EERA 2QRKA 4CJXA 5AXCA 1YB4A 2VR1A 2WD7B 3GLQA 1ADCA 2W2KB 4FFPA 4C5AA 4IINA 3HO8A 4JP2A 3RCBA 1GUYA 2QYTA 1U4OA 2WSBA 4R5HA 3QW2A 3DTYA 4CM4A 4B7UA 2DKNA 2O3QA 4NJOA 4CMGA 5CPFA 1WNTA 4I55F 4CL3A 1TT5A 4FPXA 2YYAA 1RYDA 3D3EA 3OEWA 5HM8A 1YQGA 4RGBA 4EEXA 1VKZA 2R7NA 3JYPA 4GX5A 5ICMA 4BMVA 1DPGA 2WE8A 4TROA 1E7MA 3PVZA 1HE2A 3ZNPA 3QVSA 2ZCVA 1ID1A 4HXYA 4J2OA 2HUNA 2NV6A 3WXBA 4ALIA 2DZDA 2PH5A 2OMEA 4AVYA 1LDGA 1SCUA 1YB1A 3KYCB 3NGXA 4YAKA 4YTEA 2VZ9A 2HLPA 4Q3CA 4BNKA 1SNYA 3OIDA 4DWVA 4XRRA 1NASA 5IXYA 1T36A 1QG6A 1ZK3A 3VVBA 2P91A 3V1YA 5DOZA 3G0OA 2Q1WA 4IZOA 3ZWMA 1X13A 3S55A 3SC4A 1EFKA 3I83A 2EJVA 1GYRA 1P0CA 5FYDA 5C1OA 1EVYA 5BQFA 4N18A 2X9NA 1EZ1A 3DOOA 3E9MA 4LRSB 1BG6A 4CV0A 1PJLA 4XYEA 3SXPA 1IL0A 4MAMA 4J2HA 4J49A 1Z82A 4E4YA 4BKPA 4KWHA 4PLZA 5COBA 5AVOA 2X7HA 2DVMA 5LOVF 3ONFA 4PZEA 1LA2A 4K9DA 4YAEA 4Q9NA 2VNSA 3IP1A 1NXQA 1DIRA 2LDBA 5BPHA 3MEQA 4D3FA 3A9WA 2JFFA 4AJEA 4W7HA 2VT2A 4CM4B 2PWZA 1B8UA 1HSOA 3BMQA 5TX7A 4HADA 3RI3A 1ENZA 4DL9A 3CEAA 1JAXA 4PZDA 2ZDQA 3IQDB 3UCFA 4XIYA 4MVJF 5IXSA 4UEKA 2J5KA 1AGNA 1SC6A 2VTEA 4XYGA 1B2LA 2G1UA 2AMFA 4PIVA 2PA3A 4XB2A 4Z0PA 3UF0A 4O7TA 2BFAA 1IHYA 3EK2A 2I87A 4J0EA 4EUHA 3VZPA 1QSGA 4ZJUA 2NQTA 4BIIA 1PZGA 2C82A 4WNIA 1I0ZA 3GA0A 4CM9A 1SCUB 3KV3O 1E1NA 5JDIA 4YAKB 1DV2A 2EKLA 3KYBA 4XKJA 3OIFA 5CG2A 4PVDA 2B4QA 2LDXA 1UXHA 4GQAA 2JAPA 3VPBA 3GAFA 1T2DA 5ITWA 4IIVA 3PWSA 1P1KA 1PIWA 3NTQA 3V4SA 3WFJA 4B4VA 4YJ3F 1Y6JA 1QYVA 4A26A 1ZSVA 1A4UA 4S3MA 4S1VA 2AEMA 3C24A 4MVJE 1VJ0A 4IPTA 5LDHA 2VUTA 5CEFA 4WEQA 4UUNA 4HNUA 3COSA 4IJUA 1GYQA 3DHYA 3DZJA 3PHIA 3CSDA 3GY0A 1KIFA 4YA6A 5T57A 3STHA 2P9CA 4W9NC 2J5RA 3S2EA 4CUJA 3ZWCA 3HSKA 3OJLA 1HDGO 1X15A 3AUUA 3VPFA 3BMQB 5JS6A 3RKUA 1HZJA 4GGOA 4KWIA 1GLVA 2HK8A 4TRNA 1K6IA 3I9KA 3CTMA 4J1TA 2EW8A 4O0LA 5JC8A 2G76A 3JD0A 3MJEA 4O2BF 4I9UA 4EJ0A 1KVTA 1NVMB 2Y99A 3OIGA 2VNAA 4HY3A 2PK3A 4QSHA 1KJQA 5TJHA 1ZZEA 4UEOA 4Y98A 1FDTA 5ER6A 2YFHA 3H3FA 2G5CA 3OQ6A 3PP8A 4WOKA 4MKZA 2NLOA 4NBWA 3DZBA 2HSDA 4CLOA 1YKFA 1GQQA 1YB5A 3WGYA 1LEHA 4YDRA 1MLDA 3BHMA 2PFGA 3OJEA 1HDXA 1JKIA 4DQUA 1BRMA 5T5QA 3F5SA 3WMXA 4DTIA 3SBOA 4KOAA 3RC1A 1ZXBA 3JQGA 5JBIA 1YXMA 4X54A 4CMEA 4AJPA 4R54A 1QYDA 2HJRA 3UHAA 4DIOA 4LGVA 4XDZA 3PLNA 1Q2XA 1O9BA 3F46A 4JJIA 4MKRA 3RFTA 1JVBA 3BTUA 1E6WA 2H5LA 1U2DA 2PZKA 2Q2VA 5F1KA 1E7QA 3AW9A 1DOHA 1MC5A 3AJRA 2AW5A 1E6UA 1PQWA 2AHRA 4RPKA 1K6JA 1WLYA 4OSOA 3CMMA 1C30A 3H2SA 1M67A 1HL3A 3OUUA 4MV8A 1LSUA 5COAA 1GV1A 3WSWA 3ZWNA 1MGOA 2ZQZA 1T2AA 2ZKLA 4GBJA 4CLRA 2C00A 3BG5A 2NVWA 4BKUA 2ILTA 2Z02A 3SJ7A 1JU9A 1PU2A 3UICA 5T67A 3V2HA 1PGJA 3OJ0A 3IOYA 2IP4A 2O2SA 1EE2A 3F3SA 5L7YA 5EIOA 3ZWBA 3P2OA 4CMHA 4N5NA 5KCZA 4RQUA 5GONF 1ISJA 4YJGA 4QQRA 4NFSA 4CQMD 2QRLA 3ICCA 4WOJA 1L7EA 1ZJYA 3I5MA 5TC4A 1UUFA 2C29D 4CLOB 4XJTA 4XIJA 3TRIA 2ZYAA 4FGRA 1EQ2A 4L1KA 2I65A 2R7KA 4RORA 3HBLA 3QWAA 2R7MA 2ZTLA 3MJTA 4CUKA 1ONPA 3DBVO 2JCVA 4O63O 5JAIA 3U3XA 1YBVA 4RDHA 1H6DA 1ISGA 2YDXA 3QWHA 4D3DA 4W99A 2Y1CA 1YDWA 3E18A 1F14A 3JQGB 3ROQA 4E5PA 1OMOA 1ZEJA 3KLPX 1W6UA 2CF6A 4IZIA 1I01A 1P74A 4XYMA 1J6UA 5I7SA 4H16A 4QO7A 3ZV3A 4IBOA 3VZQA 1Y7TA 3RFXA 1N92A 2C0CA 4YAJA 3GR6A 1P33A 5L45A 4DRYA 4BVAA 2VQ3A 3RUCA 1ENPA 1B16A 2AXQA 2Y0CA 1K0UA 1NX6A 1NPDA 1HKUA 3B70A 2GPTA 5DCWA 1PZEA 4JIGA 4WLUA 3TINA 6ADHA 1A9YA 3KETA 2X9VA 4D46A 3T7EA 1VJTA 5IYZF 1DC6A 3WTCA 3QQPA 3NUGA 3WYBA 1E5LA 2NWQA 4MP8A 3ANLA 4FS3A 1ULUA 4YB8A 4BGIA 4U7WA 3SX2A 4MA0A 1VSVA 4FB5A 2PH3A 1Z2PX 2D5CA 4RF4A 4B8ZA 4YJGB 2NADA 3WGGA 3KAKA 1SB8A 1U8XX 2IYOA 4PRKA 1OFGA 1DJQA 2BRUA 2HRZA 4O2AF 4RV9A 1R16A 1DFGA 1BDMA 2B0JA 2Y1OA 5A4DA 3WGIA 2CVOA 2YZ7A 3INTA 1F17A 1ZK2A 4R1TA 3W4KA 1RWBA 1JN0A 2BLLA 2OXIA 1NYTA 3JTMA 3BIOA 4PG7A 3DHNA 2DC1A 3TQHA 3ZV6A 2RCYA 3C1AA 1L7DA 1V3VA 2Z5LA 2O2YA 4BO9A 4ALMA 2AE2A 3NGLA 2J5QA 4E0BA 5CDUA 4FW8A 2E48A 3PQFA 2V65A 4HFRA 5DDIP 4U6SA 3RBZA 4AL4A 3M6IA 4XYMB 2OZPA 2WJPA 4XYLA 3ROPA 1WR2A 4PLWA 4YAJB 1ZK0A 4FFMA 1W96A 3C7CB 2OOSA 3CXRA 3H7AA 1X7HA 1KUTA 1E7SA 5DN9A 4CMBA 4ZHSA 4CM9D 3AY6A 5FWNA 3TJRA 3U4HA 1QV7A 2HO5A 3WGQA 3ZN2A 3V8BA 3U09A 1KVSA 1UDAA 1BXKA 2VYVA 3GK3A 1WPQA 5IZCA 5K0ZA 2ZYGA 1XHLA 4D3SA 2IDZA 4HNGA 2HMTA 3E8XA 4J4HA 3L9XA 4NR0A 4WJZA 3ZGYA 4EITA 3NX4A 3QIVA 1QKIA 2O7QA 5I7EA 4IHJF 2A92A 3C1OA 4MVJM 1R37A 4YB8B 4MKXA 2W98A 1NR1A 1B15A 5L51A 1JDBB 2UDPA 4YRBA 1NWHA 1UXGA 4K1LA 1E7YA 1F0YA 4FSHA 3RJ5A 2AQIA 2HU2A 3PDJA 3OETA 5JYDA 2R82A 4RVUA 5JY1A 3GOHA 1XELA 1LSJA 2HMSA 1NWCA 4WASA 1ZK1A 3IJRA 2GZ1A 1GADO 4JBHA 4ZRNA 4FN4A 1GSAA 4QO8A 1EMDA 1NP3A 2HMWA 3JQAD 1YOVA 4E4TA 1AHIA 3GRPA 3X2EA 1VRWA 3WX0A 3LYLA 3WBBA 4YT2A 1KEEA 5FI3A 3AY3A 5KKCA 4RCVA 3R5FA 4XYLB 3HZZA 2D59A 1O0SA 1WZEA 4ALKA 5EMHA 3RUPA 2FR8A 3EY4A 1I3KA 4O7LA 3TL2A 5KJFA 2WDZA 1JVSA 1PS8A 5IN5A 1E3JA 5ILGA 3C1TA 1JKFA 5C1PA 4WBNF 2W6ZA 4IIUA 3ANMA 1A9ZA 3U54A 1P1JA 4PRLA 4E5MA 4DLKA 3K2EA 5D8DA 2D3TA 4HKTA 4R4JA 4RZIA 4UUMA 9LDTA 3SVTA 1V3TA 2W6PA 3KSDO 3RC9A 4BMSA 1OBDA 2J3KA 3GDOA 2YV1A 1XCBA 3JQFA 1DC4A 2W2LD 3FNGA 1PJCA 3H9UA 4TRMA 4OHUA 4DQVA 3A28A 5A9TA 3F47A 4XRGA 2Z1NA 2EEZA 4R1UA 1R4NA 1MFPA 3W1VA 4DC0A 5L9AA 1XG5A 1UP6A 4RO0A 1A27A 1DB3A 1NQTA 4DGSA 2YQ4A 4EGQA 5JO9A 4CMAA 4G5HA 4R1SA 4O6VA 1XR3A 3ZWXA 1M76A 2E49A 2Y67A 3C8MA 2BI7A 3AUAA 4A27A 1YOVB 1PS0A 4O7NA 3WGHA 4N5LA 1JA9A 4O4JF 1F8FA 5L7TA 2X0IA 4UVIA 1EDOA 1H93A 3TNLA 1R0SA 4J90A 4ZQIA 4YBZA 3GZ4A 3DBHA 5CDYA 4MA5A 2EKQA 3N7UA 3U4IA 4J16A 4CM1A 4OSPA 4HP8A 3QRWA 1I36A 4KUGA 4P38A 3NT4A 3WG9A 2WEKA 4O5OA 3N6RA 4NPCA 1C3OA 1BGVA 3X2FA 4DLAA 1XQ1A 2I8CA 2R7LA 1LJ8A 4O82A 1N9GA 4GWGA 4TZTA 5G4LA 4GI2A 3QJ5A 4ND5A 4HV4A 1I33A 1IYZA 4RVSA 4J0FA 4NYEA 4P22A 5EPOA 2DUWA 3GDFA 4FD3A 3LLSA 3TDKA 1BHSA 3M2TA 4JGBA 4OOFA 3DTTA 1WWKA 3UXYA 4GLOA 1R4NB 3VPHA 1CJCA 3K3PA 1KY4A 1I2CA 4D7AA 3FNFA 4J6FA 2X1HA 1M75A 4QFDA 2C20A 3ZDFA 1PSDA 3F4BA 3RUDA 2ET6A 1E4EA 3ONDA 1K6XA 3VTZA 3NJ8A 1F8GA 5TLSA 3LT0A 2JFGA 3DFZA 1DIGA 3OA0A 4J9VA 4D0SA 5LA6F 4R9SA 4C4OA 5DBFA 1ZSNA 5LCXA 2NACA 5B4TA 2V5AA 1CRWG 4DC1A 4YBZB 1WXDA 1QYWA 3I52A 3DBHB 4XD2A 1Z73A 5T64A 4O7VA 1OBFO 4GSKA 2DLDA 1LDMA 3L6DA 2CVQA 1HWYA 2AG8A 1P1HA 5I8ZA 2R00C 1N5DA 1QORA 4J7XA 2EV9A 1UZNA 2PGJA 4ZQHA 1UH5A 4LSWA 2POQX 2YV3A 4A2CA 1ISFA 4Q3DA 3O9ZA 1ULZA 3NTRA 1I8TA 1N9GB 1Q7CA 3EAGA 3QV1A 4LVCA 3QLJA 3SE7A 1BXRA 2BELA 1ZEMA 1GFSA 2YZMA 1ZKMA 4R68A 3HJAA 1E7WA 1BXGA 5G0WA 4FR5A 2QQ5A 4B4UA 3BMOA 4BGVA 3VPSA 4E5KA 5JVLA 3IIEA 1CEQA 3G49A 2GN8A 1N1GA 2C59A 3IP3A 3NDIA 3R1IA 1YL5A 4IZHA 3I6IA 1KETA 2JD1A 3OFSA 3U49A 1FXSA 4OL9A 3ZCXA 2VYVD 5LYJF 3HDQA 3N8DA 1E4EB 1EFLA 4A5OA 2OL4A 1NPYA 1PL6A 3BAZA 1SZJG 4MVJH 2BFPA 4BO8A 4J1SA 2YZLA 1OOEA 4FU0A 4BQRA 4EI2A 5TRTA 4AJNA 4CV1A 5U9CA 1U7HA 4XQCA 2QG4A 2D8AA 2RH4A 3B1KA 5EN4A 3LSYA 3TIGA 1E1MA 1WDKA 5HWSA 1IOWA 2QZZA 1T2FA 2RIRA 4FBGA 3ZU2A 2FP4A 2DTDA 1A5ZA 1ULSA 2SCUA 1HDOA 5MGBA 1KY5A 3DAGA 3SJUA 2R84A 1IOVA 1ADGA 5JLAA 1GQ2A 3I23A 3L9WA 3H9GA 4ND4A 4BUCA 1YQDA 5GZ6A 1YBMA 2VN8A 2GYYA 3NTOA 3PTZA 4IJKA 4GVXA 4HFMA 2HJSA 3GHHA 5TIIA 3D1LA 5BPFA 4TKMA 4XR9A 3V1TC 1HDYA 2D4AA 2Q2WA 4GX2A 4CLXA 4H3VA 1SO8A 4R5MA 4CLDA 4O7RA 3P5SA 4XYBA 3OP4A 4XQEA 3VH2A 1BXGB 1EHIA 3ASVA 1ZO8A 3BMOB 4WLEA 3I9OA 2C7GA 1GEEA 3Q11A 2QZ9A 4WLFA 2ZJ0A 4CMJA 2AEFA 3A14A 3F6YA 2VWGA 1E92A 2X4GA 3LT4A 1U7TA 4J43A 1A7KA 3L4SO 3DO5A 2Y1GA 2AG5A 1E6EA 1P1RA 3SEFA 3FBTA 3D5TA 3LVFO 1NBOA 4MINA 5C7OO 3KLMX 1J5PA 3DF7A 1LU9A 4B7XA 2W6NA 2P9EA 2ZK7A 3GIDA 4L75A 1GPJA 3CMCO 1DIBA 1C3VA 3GNTA 5BT9A 1Y8QA 2OHXA 4MPDA 1D3AA 4I9HA 2FP4B 5G0SA 4BHTA 2CD9A 3G79A 2SCUB 3I9JA 4CQMA 1RM0A 1TVEA 2QW8A 1PJTA 2CDAA 5THQA 1U8FO 2PZLA 1UZMA 3AOGA 2FOIA 2CF5A 3R3SA 3WO1A 3E9NA 3PIIA 4R3NA 4C5BA 3GZNA 4NBVA 3TL3A 1VI2A 2GCGA 5IZ4A 3M1LA 4F46A 4R69A 4WLVA 4NDNE 4W82A 3TPCA 1A7AA 2W6QA 1MV8A 1QYXA 4XB1A 3F1LA 4AJKA 4U0KA 4JK3A 4OMUA 4G81A 4UREA 4D79A 4FE2A 1RKXA 1DLJA 3QFFA 1XU7A 2O3UA 2P4HX 3PEFA 2CY0A 4LSMA 4LW8A 4RVFA 1NQ5A 1JTVA 3H9EO 1HLPA 4RPJA 3ITKA 4XDYA 5TSDA 3ETEA 5EJ2A 2O3SA 1PGNA 3HDHA 2DAPA 2J3IA 4W4TA 1ZFNA 2IRWA 2BKAA 2NTNA 5CA1F 3VH4A 5FNVF 4CR8A 2EERA 1IPEA 3ZWPA 5ILOA 1IOLA 3ONEA 1A48A 3QSGA 3EUWA 3HWRA 4EBFA 3G8DA 3L07A 4P4NA 4O4LF 1NR7A 3JQ6A 4QXMA 4ZHQF 4E2ZA 3U5TA 1PJ3A 4DMMA 2NU9A 4KP7A 3WWYA 1LLCA 1W73A 3S8MA 1H2BA 1Y8QB 1YQXA 5JDIC 5CB4F 1FJHA 4YRDA 3GLKA 4XX0A 4NQZA 2IE0A 3S1LA 2RBEA 2FRDA 1CYDA 4BS9A 4CQMB 5A3JA 3TZCA 3M2PA 4UVDA 4Z0TA 2X0SA 1ZMTA 1DIHA 4DIMA 5JVDF 5HRUA 1HDZA 1T25A 1EQUA 3GDGA 3JQ9A 5ADHA 3ABIA 2EXXA 3V2UA 3UCXA 4RL6A 1B26A 1M6HA 3GZNB 3JCZA 4WCFA 5JAZA 4D43A 4OM8A 4RF5A 1VE9A 1VPDA 3U9TA 3D4PA 3FI9A 3TF5A 1SAYA 4M1QA 5AQ1A 4PLGA 3DHEA 3PYLA 1TT5B 2BGMA 4BKRA 2PKQO 3GNQA 4OOEA 4NI5A 1U3UA 3PIDA 5DP1A 4JLWA 1BSVA 1DC5A 3WNQA 2W70A 2TMGA 4Q3AA 1HYHA 3ZWVA 2CFCA 1T4DA 3GGOA 5JW6A 4WPGA 1PJ4A 4YVFA 1AN9A 3VA7A 4PLFA 1LRKA 2VRBA 2GN4A 1EK6A 1C0LA 1NHWA 2VYND 3EZLA 3ETHA 2UUPA 2P68A 3GEGA 3NDJA 5IDQA 5KVQA 4HX5A 1A72A 2XXJA 1I2ZA 3LU1A 3D0OA 3PJEA 2NTVA 3PQEA 3E48A 5CHEA 1WVGA 1GR0A 4Z0HO 3VH1A 1XA0A 3GGPA 2Y1FA 2NU9B 4ZRMA 3RWBA 2YHUA 2Q4BA 2BGLA 4PFJA 3T7CA 4ZU3A 2O3RA 4XX0B 1PZFA 3VDQA 1IHXA 3P7MA 3GPDG 5JY6A 4JROA 4PG8A 1NTOA 4CUZA 2GQRA 3DR3A 3DAFA 2VZ8A 3UH1A 4RF3A 2NNLD 3RQSA 2GR9A 5LDGA 3I9LA 5L53A 1PS9A 4WCFB 4D45A 1K3TA 1N7HA 4BNZA 5C3MA 2FN7A 3FCOA 2DIKA 2C54A 3JQAA 5BSEA 2PLAA 3K2BA 4Y6PA 3EW7A 4RVHA 4MP3A 2DTXA 4FC6A 4DQXA 3FHLA 3WS7A 1LTHR 1I3NA 4IIJF 2QYSA 4BMNA 5BR7A 1Z45A 3NT5A 4MV4A 1G0OA 4GKBA 3RVDA 1ZUD1 1NHGA 1NFFA 1KC3A 4JXKA 3ZV4A 3ZHBA 4BNNA 4M8SA 1XGKA 3G1UA 3MCVA 1I7LA 1ORRA 3MJCA 1ZK4A 3DWFA 4NHEA 4GKVA 4O7SA 2XCLA 4YJ2F 1J0XO 1CERA 1DO8A 4QSMA 1DXYA 2ZQYA 1LSOA 2B69A 4QECA 2I3GA 1D4FA 4E2WA 4JN6B 2PZMA 4MIOA 2PNFA 1TLTA 3LF2A 4ID9A 3OA2A 2NM0A 2R86A 1GAEO 3PRJA 1U5CA 1DHRA 2W2LA 4AJ1A 4BGUA 4QT0A 3Q1KA 4YT4A 3K5IA 5KKNB 3PYMA 4AG3A 4DPMA 1JWAB 1PJQA 3HNPA 4DA9A 4O7YA 3BTOA 2VHXA 1KVRA 2YJZA 3KSUA 2Q99A 3O8QA 3BHIA 3HUDA 2VCYA 3GHYA 3AU9A 1U5AA 2OO5A 3JYLA 4W9NA 3DOCA 3EMKA 4PGFA 1HZZA 1ISIA 4HNHA 2RHRA 4RZQA 3ZNQA 4BNJA 1KVUA 2YWVA 2VT3A 2I66A 3JQAB 8ADHA 3DZIA 1EUZA 3TIIA 4ZQEA 4ZICA 3LLVA 1AUPA 1U4SA 3NT2A 3PFWO 3QWBA 5FEUA 2PV7A 3T4EA 4LN1A 4PCVA 3QP9A 4CL8A 2YRXA 4YQYA 2DPHA 4TV8F 5IFLA 5GZ1A 3FR8A 1VKNA 3H6KA 4YPOA 4K6FA 1LRJA 4BB5A 3K6JA 3WYCA 3ZW9A 1T4BA 5DCUA 1GZ6A 3WGOA 5B4UA 4B3HA 4M89A 1IPFA 4DVJA 1EK5A 2V59A 1B8VA 4MDHA 2DBVO 1G1AA 1H2HA 2PD4A 3EGOA 2ZCUA 5J23A 3JYQA 5CPBA 1NQOA 4TRJA 3I9MA 4E5NA 3GVXA 1DEHA 5L7WA 3EYWA 3PFFA 3KXDA 4XGKA 1LI4A 3NJ4A 5HS4A 1DBVO 4OAQA 2H63A 3RUAA 4J4TA 4RLHA 4NG5A 3INGA 3OUZA 3RFVA 1XSEA 1O95A 1ENYA 2WYWA 3I9NA 5IG2A 5TGDA 1AUVA 4IGFA 4P8RA 4XWYA 2QK4A 5AXAA 1NVTA 1P77A 4MVJG 2JHGA 1RM4A 2OLSA 3JD4A 1XLTA 1MFZA 4IGEA 5L40A 1KEVA 4RZHA 1FDUA 5A02A 1ZH8A 3N74A 1HDCA 1JWBB 1UDBA 1VL0A 3ZU3A 3DAPA 4DLLA 1SB9A 4EJMA 1KEWA 5JYEA 2HMVA 4CM5A 2VQDA 1FF9A 1I32A 3JQ8A 3TZKA 4CLRB 2R85A 1D1TA 1ADBA 3DC2A 4EZBA 2G17A 4LCEA 4HBGA 4FGSA 3V4ZA 3Q9NA 3ROMA 1UR5A 3NUAA 5L4SA 5H80A 2FPPA 3EHEA 4RVGA 4DPLA 1IUKA 3AOEA 3LC1O 1XEAA 4PVCA 3AK4A 2R87A 4Z9YA 1LC0A 1G6KA 5IZCC 3WOHA 2D1YA 1EUDA 4ESOA 1ENOA 4GSLA 1O89A 4IJVA 2GQSA 2X5KO 1B6RA 1GYPA 3ENNA 3IKVA 3PJFA 5A3VA 4KMSA 4DYVA 3D7LA 2I76A 3WJAA 1T1RA 5I9MA 1OAAA 4ND2A 1BMDA 5HS6A 4BO5A 4O4HF 5ENVA 3GUCA 1DRWA 3AI1A 1PZHA 2JL1A 3JZIA 2ZB4A 5KX5F 4AFNA 4BGEA 3FN4A 4DYDA 5BSGA 1HE5A 2F00A 2J8ZA 2B4RO 5LP6F 3ZWOA 1MG0A 4OKIA 1AXGA 4BB6A 2BF7A 4BO7A 3AWDA 4O7WA 1R12A 1GCUA 5IN4A 4YXFA 3ZNOA 4E3ZA 3AFNA 3C85A 5CEJA 4D42A 2I6TA 1GY8A 4HWKA 3DBLA 4GPD1 4L4SA 3U0BA 1DAPA 3A4VA 1VLLA 1ML3A 4JNKA 3EC7A 4A0SA 5A5FA 1DRUA 1GEGA 2O23A 3Q0EA 2FSSA 4ZI7F 3LT2A 4IDBA 1GU7A 3MOGA 1QR6A 5T8KA 4G65A 4N7RA 3JQ8B 2W6OA 1YVEI 2DTEA 1Z7BA 3FRJA 5MDHA 4YJFA 2C7VA 3NYWA 5G4KA 3FNEA 1LUAA 5K9ZA 2EJWA 5IDYA 3P2YA 5F5NA 1C14A 2FPPB 1YDEA 3V2GA 4IMRA 4O84A 4CV2A 3SLKA 4Y67A 3TN7A 2WYOA 4E30A 5KJCA 1R15A 2HK7A 3AFMA 4GWKA 4M87A 4BL5A 1EUDB 3U4DA 2X23A 3FSRA 1UXIA 3LWBA 1M6WA 4EG0A 4DIBA 1YRLA 5JDCA 4BNFA 4RPLA 5K6AA 3OM9A 3PDUA 1P1FA 3DXFA 4CV3A 4YAIA 3V1UA 1M0TA 3KUXA 3CPSA 3JQFC 2CSUA 1XQ6A 4OQYA 1SOVA 3KREA 2NU6A 2ZTVA 4XGIA 2HJWA 5AYVA 4O81A 1ZSYA 3ZHZA 1ARZA 4MIYA 1CF2O 1IULA 3UOGA 2HK9A 2I5PO 2O4UX 1H6AA 5HBRA 4IM7A 1T2EA 3PGXA 1R6DA 4DLBA 2JD0A 4OIMA 4CPDA 4GVLA 1HDRA 2PTGA 2ZATA 4H15A 4MO2A 3WNZA 2EGGA 4ITUA 4Z9FA 1EUCA 1H5QA 3G8CA 3DZKA 4PG4A 4UEJA 4LMRA 3MJ4A 4LISA 4Y6SA 5H83A 4BNLA 4XGNA 3BA1A 1UP7A 4HFNA 4MP6A 3K73O 2GRAA 2YUTA 3ETDA 1PX0A 4OYRA 1ONOA 4CR7A 2HMUA 3LT1A 4R41A 1VKOA 2P4QA 3L77A 3DBRA 5BNIA 1HETA 2CDBA 4QX6A 3D5QA 2PKQP 1GUFA 2GLTA 1T24A 1ZIDA 1V35A 4YJFB 3A1NA 4B3JA 5G4KB 4L0QA 4U5QA 1LXCA 2FY8A 1DC3A 3OF2A 1J49A 1J4AA 4I08A 2WWRA 3RBVA 3JSAA 3DOJA 4BNYA 3AI2A 1GZ3A 2NSDA 3OECA 3KO8A 4Y8VA 3VZRA 4XEHA 4PLCA 2YRWA 1KERA 4OXYA 5B4VA 2PN1A 2NVBA 3F4LA 1LLDA 2Q45A 4YACA 1H6CA 2J3HA 3DEYX 2VUUA 3IDSA 4O4IF 2EP7A 3VDRA 1SBYA 2X0JA 4IY1A 3U55A 3KYDA 2E37A 3WBFA 5TNXA 2YDYA 2OFPA 3HQ4O 3CZRA 2NU6B 4PLTA 2Q3EA 2XD4A 2CUKA 1RJWA 4KZPA 3W6UA 3WTBA 5GMOA 5IDWA 2W6MA 1QRRA 2Q1TA 3E5NA 2I99A 4ZOLF 4E33A 5HBRB 3U62A 3KHUA 3VZSA 5T6BA 2HGSA 1NAIA 3N58A 5C37A 2P0AA 1Y5MA 3Q2OA 2AQHA 1EUCB 3M1AA 3OSUA 4I1IA 3UCEA 5BNFA 2O50A 4E13A 1I2BA 3PWZA 2EF1A 3GNSA 5F5LA 4UUOA 2CZGA 5F3RA 2FB9A 3GUYA 2FPIA 3DBRB 2FZEA 5C8YF 3GVHA 1LC3A 3MJSA 3Q2KA 4WLOA 4F3YA 2C2YA 1Q1NA 4PLHA 3PYXA 4CM8A 1M66A 4YQZA 5JXWA 5G0UA 1YBAA 5I9LA 4BNTA 1OC4A 2PGDA 2FR1A 1KC7A 2ZYDA 4E31A 4Y8VB 1LSSA 3I3OA 1JDEA 3FNHA 3O03A 3PGJA 4C7KA 4NJMA 2J6IA 4J1QA 1KEPA 1P1IA 1VL6A 1Y81A 2HKIA 4DUPA 1E3SA 4ALJA 5AXBA 1AHHA 2C2XA 1B6SA 2VRCA 5U4QA 2Z04A 3DMTC 2DBRA 3RU7A 1C0IA 3HE3A 4E6PA 5CEEA 9LDBA 1BXZA 1E1LA 3GFGA 1DIAA 2GZ2A 3UVEA 2CNBA 4M49A 1Y1PA 1E77A 2YS7A 1KEUA 5HTOA 4ILKA 4BO6A 1GGOA 3ZH2A 4IDFA 1GD1O 3H9JA 5H82A 4B4WA 3LC2O 1X0XA 3GVCA 4URFA 4XQGA 3KVOA 2B35A 2WTBA 4WLNA 4XQ9A 2DQ4A 1NAHA 2VYNA 3R9RA 4J3FA 1B3RA 1SEPA 3H4VA 5DF1A 3VKUA 1HXHA 4OXKA 2FPIB 1HF3A 3PZRA 1IE3A 1HT0A 5AOVA 5JAQA 4AICA 1GUZA 4FJ2A 4OO3A 4R9RA 4WECA 4ZQGA 4WK6A 2WE7A 2YHIA 4CM8B 5B1YA 4UVGA 2JAHA 4TZKA 4WE3A 3OJOA 1I3MA 3WMWA 3RUIA 5BSFA 5B12A 2P9GA 3GEMA 4P4LA 1ONNA 1YH3A 1W8DA 3WJ7A 1WMBA 5H81A 4L74A 3RU9A 3ZU5A 1BW9A 4NJMB 3PHHA 2DT5A 3AX6A 4P4GA 4CMKA 1PX2A 1EVJA 1UXJA 3T4XA 2PZJA 4GH5A 1C0KA 3PQDA 4DBZA 2H1SA 3AUTA 1R0KA 4R16A 4IUYA 5KVCA 1HLDA 4RPGA 2ZJ1A 3DQPA 3F9IA 4YRAA 3FWZA 3IAHA 4FCCA 1KC1A 4KTVE 1Z2NX 5JC1A 3DZHA 1D8AA 1EDZA 1HYGA 3ZHXA 1XU9A 3MWEA 2GN9A 3AY7A 3LZ6A 2W8ZA 3SC6A 5JNLA 4BV8A 3FD8A 1B0AA 1PQUA 3UGKA 1X1EA 3LDHA 3R5HA 5CDSA 5I8WA 1LNQA 1H9AA 2X6TA 3BZUA 3DONA 4YCAA 1OBGA 2V6FA 3MJFA 2FPGA 4LMPA 4ZVVA 1CETA 5TJ9A 3IKTA 2GN6A 1KBLA 4A03A 3OBBA 4C7JA 2P5YA 1I5RA 2X22A 3OHSX 1GSOA 4PZCA 3WNVA 4J7UA 2VHZA 2B36A 2PGLA 1X1TA 4JJGA 1O94A 2NU7A 2YHIB 1VSUA 1YL7A 3HB4X 4M55A 4EUFA 1PJBA 1K2WA 3TSCA 2WYVA 3KZVA 4TQGA 5KVVA 4NH4A 2F1KA 1PR9A 2A94A 4LCJA 1JQBA 2XAAA 3ENKA 4DMLA 5I7FA 2OBYA 4L8VA 4AJLA 4IMPA 4FOSA 4HNVA 4IDGA 4RPHA 2Q1SA 5EQDA 3WWZA 1BW9B 3U9SA 2CVZA 1FMCA 1NNUA 1PR3A 1WAMA 3D64A 2IZ0A 3TZ6A 5C7LO 4FFOA 1ZBQA 4IQ0A 1RM5A 2GPSA 2DFVA 1MXHA 3UKOA 3UN1A 1Y9AA 3JD1A 1PGPA 3OICA 3VTFA 4BO3A 4FDAA 2E4AA 4B79A 5F21A 3FWNA 4R01A 4ZQBA 1K89A 4U6QA 1E3WA 1PEDA 5KOIA 1DRVA 3MWEB 3KYCA 3JRXA 3Q2IA 3ETGA 4WEOA 4M54A 1N1EA 5AXDA 3GEDA 1YWGO 2A9FA 4INAA 4II2A 4MOWA 3H9QA 4HR7A 1BVRA 1XYGA 3AM3A 2FPGB 1PTJA 4NFYA 4BO2A 3K31A 3JQBA 4B4OA 2TMDA 3EZYA 3W8EA 2I9PA 4BNHA 1ZW1A 4JBIA 3VKVA 4L4RA 4CM6A 1H94A 4OQZA 4NBTA 5THKA 2NU7B 4LVUA 3E82A 1QXSA 4GLLA 1GZ4A 3JQ9C 3O4RA 3PHJA 5JE8A 1P31A 2QRJA 3ORRA 2YW2A 4XR4A 4WCFC 3S2GA 3W8FA 1E5QA 2B4TO 1WDMA 3Q6IA 5JCJA 1JLLA 3L4BA 3A06A 4TVBA 4NK5A 5LC1A 1M0WA 2CNQA 2EWMA 2YFQA 4YEDA 7MDHA 1EEHA 3QVOA 5A03A 2X0RA 4BOYA 3NRCA 2QHXA 3H5AA 3QVXA 2VWQA 4BO4A 1QLHA 3W4IA 1MG5A 1UP4A 3JYNA 4BKQA 4AJOA 3RC7A 2IYPA 3TZHA 3UUWA 2W4QA 4FIZA 3DZGA 3HFGA 1NQAO 4MJLA 3HG7A 1OI7A 1ZVMA 1E3WB 3FBGA 5CAEA 2WYUA 2BHLA 3ASUA 3EVTA 2ZB3A 4I5GA 1NFRA 1QLJA 1YJ8A 2FSVA 3JD2A 4OH1A 4O7ZA 5DNAA 2H6EA 1JKJA 2GPWA 1LDNA 2G0TA 1KOLA 2Y93A 2NU8A 1X7GA 4K6CA 3DDNA 4NNJA 3OQBA 1V3UA 2VRCD 2OUIA 1EE9A 3GGGA 5G2OA 3IJPA 1NFQA 1E3IA 3NEPX 2H9IA 3CE6A 2HCTA 2QX7A 1LX6A 3PI7A 1IZ0A 1KVQA 2UV8A 4WNCA 5L4LA 1RM3A 4J91A 1EYZA 1JDJA 3GT0A 3LQFA 4MVJD 3NV9A 1KJIA 5EESA 1WMAA 3G17A 2ZDHA 5F1OA 1ADFA 3QY9A 4BNGA 5CDTA 1G0NA 8LDHA 1JLLB 1SEVA 3C3XA 2Q50A 3ZU4A 4L76A 4TKLA 2X0NA 1B14A 2BFOA 4EW6A 2A4KA 3GQVA 4HQ6A 1P9LA 4WCDA 5DP2A 2NVUA 1LLUA 2OGUA 3H2ZA 3IUPA 4NBUA 2CDCA 2D0IA 3KSZO 1KJJA 3ICPA 1Z74A 3PWKA 1MUUA 3FPLA 4IDEA 5KTKA 2GZ3A 2UVDA 2GF2A 2X9GA 4OXNA 1PK8A 5DMXA 4NIMA 5BSHA 5JAMA 1F12A 4ALLA 3VPXA 1LDBA 5CAEB 3RJ9A 2D5AA 4J9UE 2Q4EA 3JD3A 4QTZA 1UDCA 2DBQA 1NPTO 3IUSA 5HV6A 5DOVA 5EINA 3JV7A 4E2XA 3GFBA 2Q46A 1Z6ZA 3K96A 3RFCA 5A9RA 5EL0A 2BGKA 1PWZA 4CODB 1JKJB 2ZDGA 1RPNA 4ZA2A 4GAEA 2NU8B 1U28A 2B83A 3WLEA 2O7SA 2XOXA 3ANNA 4D44A 3RBXA 4CMEC 1DDOA 1E3EA 5FF9A 4BNUA 5CA0F 2ZB7A 5KJ1A 3JQDA 2NUAA 4EEZA 5JDCC 2V6GA 1E1KA 2VTDA 4JQCA 2O48X 1I10A 3WIEA 1P44A 4JX8A 2HQ1A 5CFZA 3WQQA 2BD0A 1H9BA 4L4XA 1A4IA 2B5VA 3BXXA 3JQ7A 4Q3NA 2UUOA 3MOIA 4CR6A 1DV1A 1S6YA 2DWCA 3H5RA 2RAFA 5TQVA 4E5YA 4LRTB 5ES3A 1WDLA 4R1NA 5F1PA 4MVJP 3VOSA 4YJHA 1B7GO 1PWXA 3S2FA 1FK8A 1CS0A 2P2SA 4FC7A 3NAQA 1YONA 5TF4A 4Z6KA 4TVOA 5TT1A 2X8LA 3AW8A 3HADA 4IJWA 2C5AA 1EBFA 4FFRA 2NVUB 4U8GA 1KS9A 1O5IA 1DHTA 2YW9A 1W4ZA 1ZJZA 4BQPA 1A71A 1H0KA 2JJYA 5A1TA 1V8BA 2VZ0A 3KAJA 1T26A 3GVIA 5JMPA 4KQWA 1K5HA 5CDGA 1Y9EA 5C5IA 1W0CA 2YQ5A 4N5MA 4ZQFA 2QIOA 2EKPA 3TZQA 4BNVA 2B37A 3LP8A 4I50F 1Q7GA 4E12A 5GY7A 1E7RA 3BTSA 4ONEA 3WDSA 5I7VA 2R2GA 4IDCA 4XJSA 2RHCA 3CH6A 1GV0A 3PK0A 3R3JA 3V5NA 2OP1A 1D7OA 4ME6A 2VOEA 3VAZA 1UZLA 4EDFA 2GASA 4NU6A 1F06A 1PL8A 1B3BA 2NUAB 3JQCA 1L1FA 3ZI0A 2UAGA 3RV4A 2Y68A 1XKQA 1A9XA 2E82A 3TWOA 3WQSB 3BHJA 3AM5A 3OQ1A 2BH9A 3PLRA 2IZZA 5DZSA 2HDHA 1QV6A 3JQ7B 4TMFA 3RROA 4OJNA 2UYYA 3VOTA 2OP0A 4PLYA 4XZ3A 1IZ9A 5COQA 2I80A 1Z75A 3G1TA 3NKLA 2B5WA 4YJHB 3R23A 4K28A 4O59O 5FFFA 3ZZNA 1MB4A 5L3ZA 2C5EA 1CQIA 1ZCJA 3CINA 5JQWA 4WUVA 3D4OA 2FHSA 2VUSA 3GH3A 1EVZA 2Q49A 1MA0A 1KYQA 3HDYA 2Y0DA 1WP4A 1JW9B 4W7IA 3AOEC 3W8DA 1UXKA 4F6CA 2FZWA 1GSHA 5JPIA 3WICA 4D0RA 3L6EA 3E5MA 3CKYA 5I9NA 3FTPA 1HTBA 4A73A 3QWIA 5ICSA 3O8QB 1BTOA 1O6ZA 4GX0A 3RD5A 3WO0A 2Y05A 5B37A 5JCJD 3KEQA 4M9UA 1QMGA 3KM0A 4F6LA 3H65A 4JP3A 1BVUA 1U2GA 2D2IA 4J1NA 4O1MA 1UJMA 3DZFA 3ST7A 4ZGWA 2PBZA 1Y8RA 3IL2A 5KKAA 3H8VA 2YS6A 3E5RA 4RVDA 3K5PA 3WB9A 2GNAA 3RV3A 4QEDA 1BDBA 3TOXA 3KOUA 3DL2A 1KBZA 2PR2A 2X58A 2ZTUA 3MWDA 1D1SA 2GDZA 3QA9A 3Q1LA 3L6OO 4XZ3B 5HA5A 2AE1A 4RDIA 1PJSA 3LC7O 4MV7A 2V7PA 4FJ0A 4GGPA 3PZBA 4RQTA 3PPIA 5T8KC 2JFHA 3JZFA 4NK4A 1CQIB 5KVSA 2CZCA 3S2IA 2Y66A 2X5OA 4ROSA 3QHAA 3TFQA
chains in the Genus database with same CATH superfamily
4TRRA 1XZ8A 1A8PA 3D7RA 2VF4X 3IT0A 1GKKA 4R8MA 5KZMB 4ZT5A 4RHXA 5DTQA 5CB8A 5CFQA 1TI7A 4JQYA 2QS9A 3PITA 3M4XA 4PLPA 3ZWAA 1I7DA 3GF4A 3WVNA 4UHDA 3V33A 3EN0A 4FCVA 5YASA 1OCEA 3QOXA 4YT5A 5LNK6 3PEWA 1NJSA 1GAXA 3U6KA 1E62A 3GLTA 1RBMA 4I4TB 4DANA 2EFHB 1UAGA 2J46A 4M3NA 3OH8A 2PVPA 3UJCA 4R51A 2W2QA 5EOVA 4FFBA 1UPUA 4FS8A 3W5VA 2HN9A 5IJWA 1U1IA 1T1SA 4TS4A 5K6AC 1PVVA 4Y9DA 3WDKA 2OFXA 5CUQA 1P0QA 2BDUA 4CLEA 3OQHA 4B43A 5DYNA 3JPWA 5DNCA 2DU8A 2Q0SA 4GYJA 1VMDA 2HHCA 3WMRA 4DDWA 4CQLA 3COYA 4G01B 4KX5A 5IJ0A 4G41A 3P8ZA 2WZCA 3DEFA 3II6X 3IP5A 3Q9UA 4HS9A 5A05A 4HDKB 4G24A 2DPGA 3LLMA 4D9MA 3FPJA 5AKHA 1HEUA 2ZI9A 2VOJA 4X6UA 5HCIA 3RDPA 1P29A 1JEOA 1D2RA 3K0AB 1Q7TA 2XB8A 3N0VA 1ISHA 1ETUA 4MUGA 1W6RA 1X14A 1LLQA 3HI4A 3MWDB 4N41A 1YBFA 5J1TB 2C99A 3NBYB 1C8VB 821PA 5AVTA 1FFWA 1QUFA 4B7CA 4Q3EA 3KZOA 3G9ZA 5K0GA 5AUOB 1TTHA 1XYYA 1YJQA 4DQ0A 1E3TA 4OXQA 1SG0A 4FE4A 1B1CA 1QFYA 4W5RA 1VBGA 2JH8A 1GUDA 2FLKA 4PC3A 1X1QA 3GAZA 2XDYA 5A7HA 3G2JA 2JRCA 5JNUA 4KBGA 1A5BB 1UIMA 4W5TA 2BGUA 5EG5A 3I2KA 4KQ9A 2CLMB 4NYMR 1MXFA 1ABFA 1ZIXA 3SZOA 3GC6A 3O38A 1OXVA 3OC0A 4RL4A 1PK7A 2GNOA 4A6EA 4E70A 4O83A 3QLVA 4FFBB 1TZ2A 1DTWB 1BVYF 2GAOA 2HO4A 2WIJA 2ZUUA 1X77A 4WXYB 1UOPA 2GXAA 5MFZA 1KOJA 3GW8A 1Y63A 2XYRA 4C7OA 4QPJC 2XMBA 3TCXB 2DY0A 1N57A 4K03A 4YNBA 2IS1A 1UKZA 1ZOIA 5KPDA 2QVZX 3O4GA 4PPGA 2QL7A 4FLFA 2HPAA 4CQLB 5LJLA 1R9MA 1SUDA 4MUKA 1RXSA 4UULA 5IJ0B 3E3MA 3QPDA 4LDNA 1NV8A 4Y7CA 4X9XA 2HU8A 1NUQA 2FCAA 4G4SO 3RNLA 3E35A 4NPAA 3WWJA 1HV8A 1QDEA 1R66A 2EFJA 4J7CA 3SFVA 4GWLA 4KMOA 1LVHA 3OMLA 2A78A 4ND3A 4ID3A 2PLWA 4NP6A 4BJ5A 4B3IA 2FMUA 5G3YA 1E3DA 4F06A 1ZAYA 1EFRD 5LMZA 1M6VA 4KU4A 5CLQA 3ERCA 3N8KA 4J0DA 1X19A 3BBLA 1JG3A 1AE1A 1QQ7A 1S9DA 3E03A 2FI1A 1OC2A 3A9CA 2FK7A 1RW4A 2GPBA 3PC8A 4Y2HA 4AYTA 4C2AA 4FWTA 1CE8A 1Y3HA 3O4FA 2C9MA 3WLSA 3U7IA 5KOYA 3ET4A 1JAYA 2I2XB 2Q2QA 3WWOA 4K3VA 1D2HA 3DD5A 5HGJA 5ICCA 3RTCA 4RTNA 2C9DA 4MV3A 4J8PA 3VR6D 3BRCA 2B99A 2PHZA 5ER9A 5BO5A 3UMCA 4Z3KA 3PCTA 3RAJA 4CTKA 2PD6A 4I1UA 1V0JA 5HJ2A 3RRZA 1IMJA 4HQRA 3TW6A 1DCFA 1IIBA 1XDNA 1T9HA 3L0DA 4X90A 3LXRA 1XOIA 3B6JA 1ZD1A 2PZ8A 2JI4A 1N2SA 3ADDA 1GDHA 4C7OB 2RG7A 3U3KA 2C5LA 2FJUA 3ULKA 3LS2A 4I5FA 4B9EA 5LZ5A 5DTIA 3UG6A 3V8RA 5L95A 3H2KA 3O94A 3QE4A 3HLKA 2IYXA 3HB9A 1JIJA 4K86A 3FOEC 4GS5A 3GMDA 3NHPA 2C3MA 2AZMA 4OKNA 4TT3D 3RU2A 3TAHA 3VVCA 2A5YB 5FUBA 4AJ4A 2QPLA 1F2UA 1G20A 1XTJA 4RS4A 2I2WA 3R7BA 3PA8A 4EYEA 1PGOA 1PV1A 5DBIA 2QQEA 3AJAA 5KWIA 5TPZD 3S6JA 1PBNA 5K8CA 3PHBE 3GN1A 4KCGA 2AQ8A 2DLNA 1GZ7A 2XNDD 2Y76A 3ADPA 4XPZA 3THOA 1M2GA 3DMYA 4FK8A 4AJHA 3M4YA 5KSYA 1M6VB 3NW9A 1JI0A 1F2DA 4KACA 4GP6A 2QZPA 4KAAA 1SBIA 4LXYA 2LCQA 5INTA 1IN7A 4OAOA 1BNCA 2XPCA 1JJ7A 3HMQA 1RMQA 3EUFA 3IS3A 4OPMA 1KJNA 1EJ6A 4CKCA 2ZSBA 1TIPA 1CE8B 2GPNA 2E21A 2X14A 4P3KA 2ZB8A 1X0VA 3IBSA 1XMOB 2JIRA 2XUJA 2GDJA 3E9DA 3RH0A 1QTQA 5EFOA 2FLVA 1UMKA 2GBIA 2NPIA 3UO8B 4MIEA 1OH5A 3L8YA 3FJ1A 4ZO7A 2H2WA 4LOAA 4D41A 5CVTA 4K9SA 1JLRA 1N4DA 2OENG 2YTZA 1QO7A 4P0PB 2ZG6A 2ODQA 4K87A 1NIPA 2IUUA 4RA9A 3NORA 3KTAA 1AKUA 1XTKA 1RMYA 4JU8A 4KSBA 1VIDA 3R0IA 5K09A 4C2TA 3T5AA 3N2YA 4II3A 2GSDA 1NY5A 5JQGF 2ZRKA 3TAUA 1OB5A 5I4CA 2IODA 1VBHA 1RYMA 1VGRA 1OLSA 4KDFA 4UUPA 4BNDA 2ONYA 2OCPA 4G0YA 4YWJA 2JRLA 4JUBA 2IS4A 1YK1A 2D00A 1SOWA 1THTA 3K32A 3PSAA 5LYYA 1GG8A 1G20B 3RBAA 4RDXA 3AB7A 3FAKA 5TGZA 3ZE6A 3IUEA 4FMBB 5EHQA 5AVZA 3TOZA 3N5CA 5K0JA 4JU9A 3D6UA 3OTHA 3WIDA 2Z4SA 1L5VA 3E8SA 3INYA 3CURA 3DMDA 4Q3BA 3EGVA 5BNZA 1ZN7A 4E08A 2DFPA 3AGQA 3OEYA 4UOQA 2WUGA 3L7OA 3A70A 1Q12A 3TCNA 1XIVA 3QK7A 1INLA 4PONA 2ZJFA 3H3JA 2Y4OA 1G55A 5ALOA 4WGGA 3UAGA 2JZNA 4BQNA 4DDUA 3SJBA 1VXRA 1ZITA 4RCNA 1VIYA 4LAFA 5LD2C 1J8DA 2ABWA 4ESHA 1HE3A 5BWOA 3D6HA 4G23A 4CKCB 3QFRA 1KK2A 3DJFA 3L1KA 1QVWA 1AZWA 5JCXA 3E6AA 5DX8A 1SG6A 3A1EA 1GR1A 5JNVA 1ML4A 10MHA 2EHDA 4DR2B 1HYEA 3DMNA 3DMTA 1EGHA 1YB6A 3QVUA 4XASA 2COUA 4EJ6A 1DAFA 2GEUA 5EYPA 3O8CA 3CUKA 1H6BA 5KYGA 1SPXA 4RA9B 3KTAB 2IY8A 2BFCA 3EXG2 1SKMA 4FB4A 1OZAA 1TYAE 4ARCA 1ZUIA 2JAXA 1JFFA 3VGJA 3WKAA 1IY9A 1ZC4A 1XZMA 4C4SA 4CMIA 1HT1E 4QTUB 3CZPA 3Q3CA 1Q2UA 1B0PA 1HDEA 5B7NA 5JO0A 4TYYA 3MBKA 5AM0A 2WF8A 1WRVA 3ETLA 4K26A 3HWX1 1W46A 2Y71A 4I7EA 4F3RA 8MHTA 4X24A 1IG3A 1OLSB 3W4JA 4BNDB 1H2XA 2Y1DA 2FPOA 1ZOOA 1OUMA 1QTNA 3HN7A 4IO1A 3HT5A 5J2UF 1NIJA 3NDBB 2WD8A 3SZMA 1U9JA 2YWEA 2WLTA 3MB5A 3R8XA 1IY8A 1NNI1 4I50A 3KB6A 3QKSA 3F5QA 5EJGA 3RIHA 1W2HA 4BVFA 4L8GA 3QEMA 3H1PA 3EIEA 2WD7A 2IHVA 1YJXA 5DT9A 4UAGA 4F9TA 4FE3A 1S3SA 1M34A 1P45A 2QTAA 2YWCA 3OUTA 3S2ZA 1ONBA 4S35A 3WIUA 3ZHYA 2X41A 3ROXA 1Q44A 2EIHA 3HNOA 2TSYB 3CPHA 3KJNA 3T7AA 2V58A 4JLBA 4U9UA 3V46A 4JUFA 2EGUA 3RS4A 1XAGA 3QVTA 2J6CA 4DLNA 5FAKA 2X8AA 5B57C 1EJ2A 5L3SA 1N0VC 2PL1A 1E4YA 3I4FA 4L22A 2F3RA 5ALDA 4RD4A 4DLYA 3G88A 1GGMA 3KWFA 2WMDA 1CIVA 4GHWA 1U3WA 1MX3A 1LQTA 2ZIZA 1HORA 1D0SA 5JSFA 3MGBA 4MNTA 1NF3A 2BFCB 1Y3DE 1B2RA 1OVMA 3MK31 4L9RA 5B6PA 3J7TA 4KTTE 4PBSA 1ZN8A 1JFFB 1NQVA 4HB0A 4CMIB 2NZXA 2NTJA 2Q1UA 2XH8A 4RKQA 4D9IA 4GMDA 2PTHA 2ZBGA 4MGYR 3GAMA 3K5HA 2GVZC 3C6MA 2XSZA 4HAVA 1ZH0A 1D0IA 4CU5A 3M9WA 2F67A 5HJ5A 3OJFA 2AOVA 4DSZA 3UENA 3ICQB 4TMXA 3HCEA 4FX2A 1WW8A 2Q6KA 4X5OA 3IE1A 2BZGA 5DM60 1YC2A 1RVDA 2IH4A 5DRYA 3OLVA 4ICIA 1Z7EA 2RHHA 1V37A 4I50B 3AF0A 3UGQA 5JWOA 2BJWA 1G98A 1QZXA 3PFGA 3QKSB 4GPTA 5AXCA 1YB4A 3WHPA 2ZVQX 4BVLA 2Q9CA 1K4YA 1SOMA 1VG8A 3AKDA 3QEMB 3EUAA 4OA5A 1QCDA 2VR1A 2WD7B 2BEUA 1ADCA 1TU0A 1U0NA 3HO8A 1M34B 4G37A 4B2YA 2RJ3A 3CH7A 3K7EA 1GUYA 1JRLA 2JFVA 2QYTA 3FSEA 3K9FC 4K7JA 1CUGA 1A7UA 3RO7A 3DTYA 1XHFA 3TLMA 2D1RA 2QAIA 3MHPA 5LKRA 4B3TB 1J06A 1G18A 4NJOA 1O7JA 3IELA 5KNBA 3VYVA 1WNTA 1NJ8A 1TT5A 1L7RA 1ZQ1A 4LF5B 2WHEA 1RYDA 2ZE7A 3D3EA 3LG2A 1QIDA 1R5BA 4B5LA 4LH6A 3AEKB 5HM8A 5L3SB 1OPRA 4GX5A 5ICMA 1DKQA 5CW2A 1ZHOA 4C78A 3PVZA 2VATA 2JHCA 4Z9AA 2E4WA 1FFXB 4PAOA 2G63A 4PR3A 1P62B 4MWZA 4V0QA 5IAKA 1T43A 1LDGA 1ZD9A 2JZOA 2NQ2C 1SCUA 3HRKA 3KYCB 2HB6A 3NGXA 4QHYA 4YTEA 2VZ9A 5E1MA 4EHJA 3OJXA 2HT1A 1NASA 4Q9HA 4EKIA 2JASA 1ORHA 1O0CA 2Q1WA 4QFBA 1QGDA 3EWSA 4KR6A 4B33A 1GYRA 3AVPA 3N1UA 5DVZA 5FYDA 3HDVA 5FLEX 3V8MA 4F60A 3E9MA 1EZ1A 4LRSB 1BG6A 5LZ9A 1KZ1A 3BGOS 5FUQA 1E1DA 4G4SP 1HDIA 4HAXA 4DDTA 1IL0A 4JSTA 2BR4A 5E9AA 4HZGA 4O2AA 1KGDA 1Z82A 4E4YA 4Q3KA 5COBA 4C0AC 2DVMA 5LOVF 1R5NA 2ZKIA 1ABEA 3KDPA 2A5GA 1LA2A 4K9DA 4OHKA 4QFMA 1XD9A 5ARBA 4HAUA 1GCAA 3D0KA 2BEUB 3C5WP 2LDBA 5BPHA 1BCSB 1KORA 3MEQA 1FUYB 3BL8A 2DY1A 2JPDA 1T3HA 1RYYA 4PWZA 5HIJA 4AJEA 4W7HA 2XGMA 1D2NA 1GNQA 1M8GA 2BHRA 1HSOA 5I5SA 1UJ6A 3WOVA 4PM4A 3B12A 3EB9A 1CQWA 3KQYA 5FHRA 4C7VA 4ZO6A 2HGWA 5AMXA 3C87A 4TX1A 4DL9A 4PZDA 3IQDB 1NMZA 3D6VA 3UCFA 4MVJF 1AGNA 1P9RA 1SC6A 1W30A 1B2LA 1QCZA 2HC9A 3HSSA 4QJ4A 4B47A 5HXAA 3NBMA 1SHJA 4PIVA 2PA3A 3EGDA 2BY4A 2PFSA 3WWHA 2MYUA 4HX2A 1GNTA 3A1UA 2PUAA 5J58A 3I9V1 2I87A 4J0CA 3VZPA 4ZJUA 2FSIA 2R60A 2BR3A 4Q03A 1XVIA 4BIIA 1MT0A 4ZCSA 2C82A 3Q3HA 3F9CA 1PT7A 4M7RA 1A9PA 4WNIA 1Z4OA 3GA0A 4NBNA 3K71B 1SCUB 3KV3O 1E1NA 3KB8A 2LXNA 1ZM9A 5EP4A 2FWBA 4IHJA 4WXEA 3VHLB 5BWNA 1Z2AA 2QX9A 4DG8A 5C9ZA 1A50B 3T5GA 2QLNA 4KVZA 1K63A 1Q7EA 3QENA 1P1KA 3NTQA 5DW0A 3HBNA 4MULA 3KOZA 1A4UA 3ZHQA 5L8VA 4OJQA 4S1VA 2Y6UA 5LDHA 1I0IA 1QJCA 3BF7A 3IURA 1OWLA 5CNKA 2ZROA 1R0BA 2YN2A 1TU4A 1C2TA 3COSA 1J39A 3CW9A 3REGA 3GLGE 2ZBDA 4HQLA 4MDFA 1N9KA 3MELA 5A4KA 5KNCH 4FGJA 1FNBA 1US8B 3K4HA 4YA6A 2QJFA 3H5OA 1CUHA 2Q5HA 3U60B 3W2EA 3ZWCA 3O75A 4EFKA 1X15A 3AUUA 3EULA 4H6VA 3VPFA 4G5FA 1XTVA 2O1XA 4P1ZA 1LTKA 1U63A 2XUHA 2XWBF 3HCDA 5JS6A 2QXTA 5DMHA 3RKUA 1HZJA 4MGZR 2HK8A 3N8HA 3I9KA 1PR5A 3C0KA 3CTMA 3R20A 4WACA 3G5MA 3GBVA 2XE7A 4RPCA 5M04A 3H04A 2EAUA 3EOAI 2R8EA 2EQBA 1XAJA 1KVTA 2G9ZA 1T5HX 1U7DA 2VNAA 2Y99A 3A4YA 3EGDB 2FQWA 4U2CA 1KJQA 4OJMX 3SKYA 3QY0A 2FFBA 3V4FA 4UEOA 4Y98A 1CJMA 3H87A 4LF9B 3U7QA 2YFHA 4FOPA 3PEYA 1Z7WA 3EQ6A 5LQRA 2G5CA 4UQPA 3PP8A 3STUA 4WOKA 2WB2A 3VPAA 3M0EA 2HY7A 3UMSA 1JXAA 3I42A 4YCDA 1RBQA 4IHJB 3FSGD 1YTLA 1LEHA 2HHLA 1W5BA 4P86A 1SQGA 3BHMA 3BH7A 3OJEA 5KOHA 2RBGA 3QLEA 1DWQA 3MM4A 1BRMA 2JLSA 4DQUA 4MGHA 3WMXA 4RENA 3UYYA 2FZVA 4KOAA 3RC1A 4BVJA 1OFHA 2RHLA 2NXNA 4P3NA 3IQHX 3HRHA 4X54A 3QEOA 4O1IA 1JT2A 4CMEA 5ED4A 3U4MA 5KSPA 3RT7A 4ENQA 4DIOA 3H2BA 1J9GA 1E2BA 3QYFA 5BV2P 2R8PA 4LGVA 4FYHA 2IOYA 3VNQA 4BC1A 4CEIA 4EM6A 2ZJBA 1P72A 2C1XA 1QRAA 3LL4A 4JJIA 4MKRA 4W5JA 3RFTA 1JVBA 1F38A 4GPBA 3K70B 5A0VA 1YHZA 1BX1A 3RNOA 1VLMA 2OAQ1 3LGAA 4AZ0A 1IZZA 1XNGA 3OCXA 4ZVUA 3AW9A 3KV1A 2J0UA 4X7MA 1ZRSA 1PQWA 2EFYA 1GZDA 2GARA 2QQ0A 2Z08A 5FL7D 3UJ7A 1DWOA 2FWJA 5D1PA 5DX1A 5JYCA 4G25A 1M1YE 3W78A 3L8FA 1C30A 2CMGA 3RVJA 1IEVA 1XHEA 1M67A 2J9FA 4MV8A 1RAIA 2XADA 3WSWA 3ZWNA 1QOQB 2ZQZA 3L1JA 4ZZ0A 4BPRA 2E5FA 721PA 2NVWA 4CLRA 2QDXA 4BKUA 2R8OA 2ILTA 1F0KA 1PU2A 3Q98A 3SJ7A 4Q37A 3DM9B 2VP5A 1AY0A 5JATA 4TT3A 1QOZA 3A4TA 3NFYA 1WOYA 1AV6A 1NI4A 2ZAIA 4UCSA 2O2SA 3BF8A 3F3SA 3IT3A 5EIOA 4F3KA 5IKMA 5KCZA 4RQUA 3OT5A 1ISJA 1P2FA 5ENZA 1DP4A 4YJGA 3U7QB 1YR7A 4FVTA 1YRYE 5TPZA 1XZLA 1KAMA 3AKEA 3PRKE 1AKVA 2ZGVA 3I6BA 3D6FA 3ICCA 2HA3A 1Q1GA 4OHVA 5AUQA 3KT6A 4LRWA 3N9IA 3ZHCA 3HYRA 4KB5A 2Q41A 2ZYAA 4XB6B 2G6TA 4WN3A 4PGMA 4L1KA 2IKSA 4H27A 3EF1A 2R7KA 4RORA 3HBLA 1E79D 2JFBA 3AP2A 3MJTA 4YCBA 4CUKA 4EG5A 4OFXA 2WZQA 3BWCA 3DBVO 5FWXA 5C8XA 5K4GA 5KOHB 1A7JA 4R6WA 3HS3A 4XOUA 1P17A 1ZX1A 5FTJA 4OGKA 2YDXA 1XTIA 1UC9A 1F14A 1MQAA 1LFDB 1Q16A 4IQ4A 4E5PA 5IKPA 1ZEJA 5SZIA 5F7OA 3C5CA 4CT0A 3K1JA 1L7AA 2WF5A 3OY2A 4HDSA 5ALWA 1XROA 2ZBQA 3F7MA 1J6UA 4H9GA 4FKBA 4H16A 4QBFA 4QO7A 3E23A 4EMBA 4CEIB 3HA7A 3VZQA 1A4XA 5GM1A 1N92A 1VS0A 1ZIOA 3IDZA 1ZBDA 1L2TA 1KYVA 4AZ0B 4RD2A 1CBUA 2Y0CA 4UCFA 2C7RA 2J0UB 1HKUA 2ZWIA 3B70A 3P26A 1L1RA 4D8YA 4LRUA 4WLUA 4JOQA 6ADHA 2CXPA 2I4NA 2P4SA 5AKGA 4EQ6A 5KAPA 1C30B 5JS1A 3KETA 1NJ2A 1EINA 2J9FB 2WV9A 4NENA 4D46A 2HA4A 3UT6A 3WTCA 3LKDA 1NXOA 1I7PA 4V0OA 1E5LA 2ZJ7A 3JPYA 5FO1A 4MP8A 3ANLA 4TPKA 1ZCZA 2WPNA 4YB8A 1NI4B 1VCOA 1XF1A 4MA0A 5K8VA 5AIBA 3HV0A 2JLWA 2PH3A 1U0RA 3ZZTA 4RF4A 1R8QA 4C7MA 1FMJA 1JSXA 3WK4A 4YJGB 3NVKI 4YMGA 1T35A 1OSNA 4HAYA 1SB8A 4DEYA 4PRKA 4RVOA 1E1YA 2AYXA 2HRZA 4YR7A 4RV9A 4GGMX 1DFGA 4OHXA 3A8TA 3CT6A 2HQSA 3PEEA 2CVOA 2WTXA 4R1TA 3CEMA 1NUAA 1RWBA 3COJA 4R05A 2OO7A 1H22A 5FWXB 3BIOA 3DHNA 5DXFA 3TMAA 1V4BA 2B7CA 2RCYA 5AKIA 4P4SA 4HPXB 1JT9A 2OD7A 4D8UA 2G04A 3UXHA 4JQZA 4F97A 5ALRA 1MQ8B 1EZZA 2V65A 5DDIP 5FORA 4G0VA 3M6IA 4MHTA 1MC8A 1B0UA 2CDNA 4HDSB 2OZPA 4K05A 2WJPA 1MF7A 3QFTA 1QF9A 1G66A 1PD0A 5D3KA 5LYJA 5AVWA 4Y2PA 4FFMA 4IOJA 3FFAA 3C7CB 4G09A 1KUTA 1LPMA 4LBZA 4CM9D 3ML1A 4E5UA 5L6LB 2QRVA 3VHQA 4LIPD 5FWNA 3NOQA 1IHOA 5F78A 2J0EA 3RVQA 1KVSA 1PR6A 3K09A 3QW4B 1BXKA 4RJLA 3THYA 2JHPA 2CYCA 3GK3A 4H60A 5IZCA 4L5JA 1J2YA 5KTSA 1IQPA 4NENB 4D3SA 2IDZA 1RHMA 4NZOA 4TV9A 4WJZA 2V1UA 3MBIA 4NR0A 4JYBA 3RJTA 3QIVA 2GYUA 3MMZA 2O7QA 4AN4A 4R0VA 3E2IA 3D59A 2D5IA 4MVJM 1MX5A 1WXFA 3I5XA 4YB8B 3P2JA 4QGHA 2HHFA 4DCGA 3IR5A 2CLLB 1L5NA 1B15A 2J3QA 4EKNB 1P2UA 2DFKB 1E7YA 1BE0A 3O4IA 4XLZA 1SXJE 5GJBA 4F9GA 2VJLA 3N3BC 1C81A 3LKZA 1X9HA 2VLIA 3PDJA 4ESEA 4Z3OA 1SCKA 1EQAA 2FPSA 2VCHA 1OI2A 1X7ZA 2VBGA 3LX4A 3R5JA 1QFXA 3C8UA 1ZU5A 1I2DA 2HMSA 1NWCA 2L42A 4PU0A 3IJRA 3LCVB 3LZCA 3WRWA 4BBPA 4FN4A 3JQAD 1NJ5A 3OG9A 4HL6A 1N9ZA 2C5GA 2ZVDA 4P4SB 4E4TA 3OHMA 4WFKA 4I66A 5CVUA 2GNPA 2C3UA 3LYLA 2C98A 3RSCA 3WBBA 1CLUA 3EAQA 3EIWA 4YT2A 5FI3A 1D8TA 4D3YA 1WW3A 2IBTA 2XMCA 1SY7A 1N0WA 3RRXA 3R77A 4GXNA 4D9EA 4XIFA 4WTOA 1CNFA 5DGDA 3RUPA 2FR8A 5EMHA 7MHTA 4DC9A 1FLDA 4O7LA 5BUCA 1TAGA 2AK3A 2D1FA 4M1TA 5LU9A 2AKEA 2P9JA 1TZCA 2BE9A 4UAVA 2QRVB 3RVBA 1W4AA 2D2FA 3RABA 1X1AA 4MW4A 1SIBE 4WBNF 2Z9DA 4DR5B 1QE3A 4NU8X 5K0CA 4NL4H 2XZLA 1UT8A 3THYB 2O7NA 4PRLA 1UK7A 4DLKA 3M6UA 4UBOA 4UUMA 2ZYTX 4TV9B 1JA1A 1V3TA 3C8HA 3VJKA 4EW3A 1JHUA 3RIEA 4OXRA 4RK4A 4HXFB 5JCZA 2KYRA 3GFTA 3W90A 1NLYA 2XUPA 3GDOA 4XSGA 1DCTA 3H16A 1YZFA 1MPXA 2YV1A 2QRGA 1XCBA 2HHFB 3IUQA 3JZDA 1G8SA 2FG7C 3H9UA 5HIMA 4J3JA 2IIPA 4JCCA 4TRMA 1NV9A 2VXOA 4HT3B 2EEZA 4R1UA 1R4NA 3MIIA 1BFUA 1UP6A 1XG5A 3DO8A 4W5WA 3A26A 4LG1A 4OQMA 1RFLA 1YR3A 2ZREA 5KTMA 1X7ZB 3MMSA 4AUNA 4R1SA 3KB2A 1XR3A 1WW2A 2Y67A 2OXFA 3C8MA 2GS9A 3KSMA 2YCLA 4Q7EA 4A27A 1PS0A 3BIXA 3WGHA 3ZXUB 3PUZA 2R68A 2ZZNA 4MRSA 3OBIA 4N5LA 4KKXB 5KYXA 1DE0A 4EVSA 1PZMA 3RRMA 5DFAA 4ETIA 4UVIA 3E61A 1ESZA 1EDOA 2JFWA 1JR3D 1R0SA 1FC0A 2VCEA 3AR9A 5KWVA 5E3IA 5E6UA 2O8CA 1USGA 2WDPA 2Z3ZA 3PQ8A 5LD2B 1QGUA 2ZU6A 3RSGA 4ERXA 4B3BA 4DNPA 1J07A 2V0CA 3QRWA 3Q5GA 3OZIA 4INZA 4KQHA 4I5IA 4P38A 4AJ9A 2DBYA 2PWYA 4S1WA 3DDOA 3O74A 2GZMA 4ZHQA 3NT4A 4DUGD 2WEKA 2PUVA 4NPCA 1XQ1A 2WAOA 2Z9CA 1WEHA 4FQ7A 4WFQA 2G6BA 3B3AA 5CB4A 1JL3A 5H3HA 4TWBA 4RYLA 5ALUA 4CKWA 1WSBA 3TVYA 4GWGA 3WRVA 1QS0A 4CZ2A 4Q5IA 2TMKA 5G4LA 3OOHA 3WC4A 4N12A 1I33A 4F5YA 4KGZA 1AH2A 4CIDA 3DOFA 3GDFA 3TDKA 3LBIA 1BHSA 2FPXA 3JY6A 4BUZA 3DTTA 3L6RA 3TH5A 5LU8A 4B3FX 4H6XA 1R4NB 5EMMA 1QVVA 3K3PA 3HYCA 2WVAA 2EJUA 4CNQA 1TTPB 1RT9A 3EVFA 1I2CA 2G4VA 2X1HA 2GRJA 1DI0A 3W2IA 1ODSA 1P4JA 4G5QA 5E9WA 2ET6A 3K9LA 4K3UA 4BLVA 4B6EA 1Z0IA 2FWPA 3BN3A 2C31A 2CLKB 5J5CA 3WLOA 5BYKA 3VTZA 1WU7A 4D9CA 2WTNA 2XHEA 3A6FA 1GVNB 1KO4A 3DPSA 3BDAA 3D4IA 5ALNA 5EIBD 1C0EA 2LBPA 3OA0A 3THWB 1KZYC 2AVDA 5DHQA 3RVPA 5KYXB 4NZZA 3DLIA 3KE8A 4D0SA 4BWGA 4QT4A 1Y1SA 1YQWA 3I37X 4PAQA 3GRVA 3CH5A 4YLEA 2Y0BA 3GAAA 1QOPB 1ECCA 2B7LA 3TX2A 5E6UB 5ED0A 4CF5A 1GO2A 3TRFA 5T64A 2Z8XA 1QGUB 2JBHA 3F97A 3SBDA 4PHHA 3I61A 2BONA 2HIHA 2XQFA 3B48A 2F3SA 3ZE1B 3AJ8A 2BKUA 3CV3A 2CNLA 2R00C 1N5DA 3FYUC 3LDFA 4IIYA 4ZHQB 5C8ZA 3KQLA 2FPKA 3M1YA 2PGXA 4LSWA 5KHAA 2POQX 2PL5A 4WXPA 1HFKA 1FU8A 4Q3DA 2XA1A 2OWDA 3NALA 3L8DA 3QBTA 1ULZA 1Z35A 4JT8A 3NYIA 1I8TA 3VNBA 4CKWB 4KR7A 1N2JA 1XZJA 1O94C 4XQ0A 2B8WA 1QS0B 3PT9A 4JLMA 4LVCA 2WABA 3RHSA 4DV2B 1P4HA 3FCSB 1ZVQA 3G2NA 1OFTA 2ZIWB 4HTFA 4TMVA 4KLCA 2PRKA 4TL6A 1CR6A 2AF3C 4ZEMA 2FRXA 3MNFA 4FINA 4JLJA 2A1TR 3U7FB 3L7NA 2EIYA 3Q10A 3BMOA 1NVWQ 5BYBA 4JHXA 3AINA 4UU8A 3P4UA 4E5KA 5JVLA 1ZJ4A 5K45A 4UCOA 3TDNA 3ROFA 1P4AA 4P5EA 3G49A 4WQMA 1WL8A 4Q6BA 5TMDA 1UEIA 4L8YA 3R1IA 2RKBA 3UPDA 4AZ3A 3LVBA 2PBRA 4ZT7A 2MINA 1BOOA 1FXSA 1E20A 3AILA 4OL9A 3AONB 4OMDA 3SYTA 4A5OA 5I45A 3HDQA 3K0CA 4II7A 1GP2A 2V6IA 2JI8A 4EMTA 3W5AA 1NPYA 1PL6A 4MVJH 1W19A 2IHYA 3B7GA 3N70A 2YZLA 2KMLA 4G1VA 1THMA 4YRRA 5F2EA 4BO8A 4EI2A 2W00A 1XMSA 5LZ4A 1SCQA 3MFQA 4CV1A 3SN6A 2P2LA 5U9CA 4DV4B 4V24A 5EN4A 3EDCA 5IVIA 3E70C 2X3YA 3IMEA 4H7EA 3TLKA 4KO4S 4DCSA 2RIRA 4IDOA 3V2IA 4NCJA 4A8PA 3ZU2A 2FP4A 1ULSA 4PYNA 3SQOA 5MGBA 2VQEB 5IJXA 3KR9A 3GMIA 5HK9A 1JIUA 5E6SA 1IOVA 3HXTA 1GQ2A 3H9GA 5E4YA 4GI3A 1WXXA 4DRFA 3HCWA 2ERYA 4ND4A 3VNSA 1J5EB 1YQDA 1T9GS 3AVVA 3IQEA 1G6HA 1YBMA 2VN8A 3B36A 5GZ6A 4IJKA 1FRZA 4ZT3A 5EHZA 3KJXA 3VKGA 4PE5B 3G0CA 1U04A 2HJSA 4RK7A 1M73E 4CLXA 2Y9MB 3E7FA 5G1NA 1SO8A 3DKRA 4CLDA 4U9HS 4HTFB 1KQGA 3DLBA 3P5SA 4M1ZA 2EX4A 4ZT2A 1U94A 4XQEA 3VH2A 3ASVA 3EBLA 1W5AA 5BQ5A 3BMOB 3GEPA 1ZI8A 2Y2VA 2C7GA 4EFDA 1GEEA 2BFBA 4EY8A 2IEGA 3R5KA 1RQPA 4GZLA 4AZ3B 1T8SA 4XI9A 5HYVA 1TLFA 1SCBA 2ONCA 1Q0RA 1U7TA 2MINB 2BCJQ 3DH0A 3DYIA 1HURA 4PYKA 1D5CA 1A7KA 1MPTA 1TYBE 1V6CA 4P31A 4F9FA 2ZM5A 2Y1GA 2UYCA 2AG5A 1EGVB 1PDOA 3SEFA 3D5TA 3LVFO 3SS8A 5GONA 1NBOA 1IBCA 2ZQ5A 3I64A 3KPJA 4JZKA 5HEKA 3KLMX 2D7DA 4RCYA 1N2CA 1J5PA 3DF7A 1T15A 3T9BA 1FP4A 2W6NA 1D9XA 4MUIA 4ENRA 5L6MB 5BSWA 1FEZA 3N75A 3WIOA 1NQWA 2OHXA 2PCLA 3NHAA 4FFVA 3RVNA 2FP4B 2G09A 4OBEA 4U4AA 4XH9B 4BHTA 1HEIA 3I9JA 1TVEA 2H57A 2QW8A 1F3OA 2CDAA 1U8FO 3W3AH 3CCCA 5AKYA 5THXA 4RDCA 1U0TA 2FOIA 4MPDA 4PHGA 4E1VA 4XGRA 2JGEA 2K2WA 3WO1A 1WU8A 3PIIA 4PYQA 5HF8A 4HI0E 1Z68A 2JFPA 3A1VA 2GCGA 4NULA 3IUJA 3M1LA 4LDZA 5IKOA 4W82A 2H7CA 4XLTA 5I47A 2W6QA 2X3UA 4LTNA 1ZIPA 2IEYA 2P1DA 4MW6A 4G81A 2R6DA 1Y3AA 3L7YA 1RKXA 2B4YA 2CVFA 2FVYA 4NAHA 5T5QA 3IKLA 1GRNA 4LW8A 2PZFA 4DMGA 1SVIA 1NQ5A 4YO7A 1JTVA 1HLPA 4PV7A 2DEUA 4RPJA 4XDYA 1CZNA 5GOTA 3RS8A 1P9WA 3TQIA 2BFBB 1IEXA 2QQFA 1ORWA 2XUGA 3HKDA 5DNYB 2VQSA 3DHVA 3SS7X 2XB2A 2BKAA 1PJZA 4JP8A 1SXJC 3D6TB 5BWXA 2EERA 4JR0A 5DXJA 1IAVA 3UKJA 1JWLA 4F3TA 1IPEA 3COWA 3UJ6A 2DECA 4MK4A 1DQNA 4LYFA 2YBDA 5F73A 1M7HA 1XEFA 3HWRA 4E88A 4G1EB 2H1LA 5GONB 4UBNA 4B0PA 1SVUA 3LPMA 2AWNA 1N2CB 1PFQA 3BQMB 2M98A 5CXXA 1FP4B 4E2ZA 4OHCA 2K5UA 1PJ3A 1OZ0A 3OZXA 3K53A 4DMMA 9MHTA 3ZDRA 1W73A 3S8MA 1H2BA 4KQ6A 3OQOA 5JDIC 1FJHA 1Y6RA 4RKWA 2IE0A 3S1LA 1MQSA 4Y2QA 3SAJA 2FRDA 3QELA 2MSCB 1VJ5A 5CYFA 5EGSA 4O4HA 1WNFA 3C5HA 3M2PA 2G5GX 2JJQA 2X0SA 1ZMTA 1HH4A 2AZTA 3BFPA 3RANA 1HDZA 1I14A 1WKBA 3ZE2B 4ENTA 2R5WA 4ND7A 5K3BA 4V0KA 5ADHA 2EXXA 4DSUA 1SKBA 3SHVA 3V2UA 4BBZA 4ZDIA 4ZZIA 1FL9A 1M6HA 1UEXC 2C57A 3GLHE 3RR5A 4QJIA 1LS6A 3NETA 3HP7A 4JUAA 3TF5A 1SAYA 1IN5A 1SA0A 3EXHA 1T8TA 4GLBA 2BGMA 2BBOA 2PKQO 1R50A 4OOEA 1NN3A 1RWWA 1U3UA 2I3DA 4KYIB 4GICA 1Z28A 1EVEA 4IOMA 1HYHA 3SJCA 2ZRNA 3U7EB 1QO9A 1XD8A 2PM8A 4GDMA 4X7RA 5JZ9A 1SXQA 1KH1A 4B6RA 1AZLA 4CE6A 4ECAA 1Q50A 4D4GA 3VA7A 1BKDR 4BO1A 1IJBA 2VRBA 1HFEL 3T0GA 3V34A