4FFLA

Pylc in complex with l-lysine
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
363
structure length
353
Chain Sequence
b'MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYGLEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVLKERFGAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PylC
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase
total genus 117
structure length 353
sequence length 363
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4fflA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fflA01
2W2KA 1JDEA 3FD8A 2X58A 3GUYA 4R5MA 3SLGA 1OFGA 3PJDA 4JP3A 7ADHA 4HXYA 2W6QA 2GRAA 5HS4A 2YJZA 3TF5A 4ALKA 1HTBA 3VH1A 4TRJA 1Z2PX 1IY8A 4YAKA 3NT5A 1ISIA 1LLUA 4WUVA 1C0IA 3EY4A 1IULA 3ITDA 6LDHA 2NU8B 5HWSA 3I23A 4UEOA 5ENDA 1IHXA 5A3JA 3KALA 1EDZA 2Q49A 3DZGA 4BNUA 5GZ3A 5GY7A 4UVIA 1DJNA 1QYVA 4BO7A 4LCJA 3RU9A 4XX0B 1I0ZA 5IXYA 4TSKA 5T6BA 4DMMA 5JMWA 2Z02A 1IYZA 2RCYA 1TB4A 3FCOA 1J0XO 4G81A 5DT9A 4BHTA 3LYLA 2YW9A 5EPOA 1XA0A 1FMCA 2Y67A 1PQUA 4GX2A 4HNGA 3FF4A 1SMKA 1PJLA 5L4LA 4J1TA 2HLPA 5COQA 2H1SA 4GKBA 3EVNA 3DC2A 2BFPA 3I5MA 3F46A 4ID9A 5I9LA 1PZEA 1YOVB 3D7LA 4J90A 3ZW8A 1WVGA 1ONOA 3GZNB 1R6DA 5KCZA 1HEUA 2CFCA 4CM4B 3AI1A 4XGNA 4J1NA 3UKOA 1LSOA 2YY7A 3NDRA 2CD9A 3HADA 1KBZA 3BMQA 3QVOA 5K9ZA 5ER6A 1W0CA 3NKLA 4WEQA 4KDEA 3H3JA 3CXRA 3B20A 1RWBA 4PG6A 5AXBA 4YT5A 2Y1DA 4D42A 5IDWA 1F8GA 4J1SA 1Y8QA 5JXWA 5JCJD 3DONA 4Q9NA 2VHWA 5J2TF 5H83A 3VZQA 1GZ6A 1HF3A 3GG2A 3GLQA 3LWBA 4WOKA 5EINA 3AFNA 1G0NA 3WJAA 1VSVA 2A9FA 1GLVA 1I24A 1QORA 4B4OA 5JFOA 1TA4A 1YJQA 2V6GA 3HJAA 3OJFA 1V6AA 2IZ0A 3QRWA 4UUMA 4J4HA 1NYTA 5CA1F 2PA3A 1KY4A 2BGKA 3TIIA 2I6TA 3RI3A 5IDQA 1OMOA 5T67A 1SCUA 4E12A 4O59O 4BNWA 2QYTA 5L9AA 2WWRA 4PG7A 2QK4A 2FR1A 2YQ5A 1L1FA 1M0TA 2W2LA 4CR7A 4OL9A 1GQYA 1XELA 2PD4A 1ZIDA 3DOOA 4JROA 2HMVA 4AJKA 1D4FA 5LA6F 2EGHA 1I2BA 2GQRA 5JCXA 1QLJA 1NFFA 1QSGA 3KOUA 4BNFA 5I7FA 5JBIA 3LT0A 4CJXA 2Y0DA 2DT5A 1GAEO 3LQFA 1JTVA 2NU8A 2QRJA 3F3SA 2IP4A 1Z73A 2D5AA 3GGOA 2BF7A 1IE3A 1I7NA 1JKIA 1PEDA 1YBVA 3L9WA 3PHHA 4Z0HO 4I1IA 4IJWA 3OA0A 4XX0A 1UXKA 2P5YA 1A27A 2ZJ0A 4CMIB 3L6OO 3AFMA 3LF2A 4CL8A 4WK6A 3KSDO 2Q46A 1KERA 4PRKA 4OO3A 1JW9B 4JNKA 2YUTA 3D1LA 4JP2A 4IDEA 4DIOA 2GO1A 3FTPA 3UCEA 4IIJF 3KXDA 1HL3A 3NDIA 1DRUA 1B8UA 3ITKA 4JJFA 5DMXA 3U4IA 4HV4A 3GH3A 2YZMA 3I9NA 5COBA 1T1RA 4I4TF 4NI5A 3ZWVA 3H5RA 3QWFA 4ALJA 1N8KA 2AHRA 4EGQA 2Y1FA 3ZWOA 2GQSA 4JIGA 4WE3A 3S2IA 3JYOA 1YOVA 4A26A 3DZHA 5B1YA 2J6IA 4EG0A 4L1KA 3GZNA 4R3WA 1ZMOA 1RJWA 4CM4A 2YS6A 4K9DA 1NPYA 3SEFA 5FWNA 4YRBA 2D4AA 3GVPA 3PHGA 2OXIA 1ZUD1 2OORA 1GPJA 3C1AA 3PGXA 2NVBA 1P45A 2WD7B 2HU2A 4PLTA 4PVDA 2VTDA 3RASA 3ZNQA 1NVMB 4E32A 4EITA 1PU2A 2YYYA 1UH5A 4YAGA 3PWKA 2X0NA 3R3JA 3C1OA 3DOCA 4ND4A 3WWYA 2WSBA 5A9SB 2XF8A 3IL2A 3ZV6A 1IZ0A 3UN1A 3WG9A 1QYWA 1YB5A 2W6PA 1MC4A 4MIEA 1NWHA 3DTYA 4FN4A 1MFPA 3DQPA 4I5DA 2GN8A 2VRBA 1GY8A 4LW8A 3GIDA 4OIMA 2W2LD 4BS9A 4Z3KA 1P31A 3UUWA 3U9TA 4YA6A 3VPGA 4N7RA 1EQUA 2BGMA 1E7QA 4DQVA 4DYDA 5BMVF 3C85A 1E3IA 1QV6A 1BVUA 2C5EA 4E4YA 5HS6A 4QFCA 3RUEA 1VM6A 4HFMA 5JQGF 4G2NA 3H7AA 3JQ9C 3PZBA 4II2A 3K31A 1YL7A 2ZDQA 2BD0A 1GYPA 3JSAA 4XB1A 3U54A 1B8VA 4WKGA 3VPHA 5JNLA 4XQ9A 5ILOA 2AEJA 2R85A 1RM0A 3BYZA 3VH3A 4GVLA 3Q1KA 4O86A 3H5NA 3OF2A 3IP3A 3RFTA 5K6AC 3DBRB 1X13A 4HFNA 5L45A 4OQYA 1ZFNA 4OQZA 1UZMA 4CUKA 3S2GA 2AQHA 5C1OA 1VSUA 4YJFB 4AJHA 1Y1PA 2QZZA 3U4CA 2HO5A 5FEUA 2G0TA 3A9WA 4DLBA 5JC1A 3BG5A 5JDCA 4CMAA 3DWFA 4CV2A 1GV1A 2WDZA 4N5NA 4NBVA 1AUXA 4E5MA 1U3TA 2B36A 1ISJA 1D7OA 1T2AA 3DZJA 4MKXA 1A72A 1ID1A 3KB6A 5LOVF 2JKVA 2YZGA 1BXRA 3ZV4A 1H2BA 3HWRA 5ER9A 4CMIA 3D5TA 4Q3DA 5TSDA 1EK5A 1V8BA 2R00A 1D3AA 1B7GO 1BGVA 1VJ0A 1RPNA 3M1LA 3DXFA 2HMTA 3OECA 3GDGA 1IPFA 4NFSA 1NQAO 4RPLA 2I80A 1VKNA 4IDCA 1U28A 3K96A 3B1JA 4AJJA 3HB4X 3ZDFA 5A5EA 2PK3A 3RBXA 4ALMA 5KNLA 4BNVA 2OP0A 4MVJA 4RLHA 1EQ2A 2GPSA 4CV0A 1F17A 1NPTO 4OXKA 1PX0A 1LC0A 3ZWNA 5CDGA 5G0VA 3TFOA 4GWKA 3BTOA 3HE3A 3AI2A 3PWSA 3QLJA 3RWBA 1JWBB 3NJ8A 3U55A 1XKQA 2BI8A 5MDHA 1NR7A 3K5PA 7MDHA 2J9GA 3NTOA 2NWQA 3D64A 1FDVA 3U0BA 2DVMA 3QIVA 1JA9A 2NADA 2WD7A 4EUFA 3L9XA 2CNQA 1Q1NA 4UULA 1LBEA 1R37A 3HFGA 1N92A 3GFBA 4DMLA 2D1YA 2FPGB 3GVXA 1H6DA 4WASA 1B8PA 3I6QA 3M6IA 5A9SA 4TKMA 2DQ4A 3CZRA 1C1DB 4QFDA 4G5HA 3QY9A 4OOEA 1YO6A 2FY8A 4GL4A 3RUFA 5JY1A 2V59A 3H9GA 1E7MA 2PKQP 1HYHA 1NP3A 4NBUA 2YV2A 1EYZA 4AJ4A 1KVRA 4R1UA 4W7IA 2O3SA 1XHLA 4I55F 4CM9A 2J8ZA 3G8CA 1DXYA 3PJGA 4BO2A 3ZHYA 1PIWA 3PP8A 5TC4A 1MB4A 2ZYGA 5B4TA 2BMAA 1WZIA 2JCYA 4J9UE 2B5VA 4TRRA 5TJHA 4I9UA 2J3IA 1HDZA 4JBHA 1BTOA 1HDGO 3O8QB 1U8XX 5CHEA 5F5NA 2X0IA 1DPGA 3QVWA 4BKRA 4NFYA 2IEDA 2PD6A 2YL2A 2HK8A 1WR2A 3KYDA 1GPDG 3WNZA 1ZKMA 2EKPA 5JVLA 2Y0CA 2FSSA 3DBRA 2GNAA 1BW9B 3NUGA 1S7CA 3H3FA 1M67A 4YJFA 4Q3CA 1QYDA 4KUEA 5EESA 1KOLA 1MC5A 1V35A 2E48A 3Q9NA 4XGIA 3RU7A 4ILKA 1YQGA 3FN4A 1LXCA 1EUZA 4I9HA 4MVJD 4MP8A 1U7HA 3ON5A 4FSHA 5A9TA 3RC1A 3BMOB 4PRLA 4JBGA 1I3MA 2ZTUA 2OO5A 3VKVA 2QYSA 3I9LA 3DEYX 3GN1A 3W4JA 1E3SA 1NFRA 3VH2A 2QIOA 2EJWA 4ZRMA 4BNJA 2GR9A 3JQ9A 3HDQA 2O3TA 2B69A 1ENPA 3BHJA 4B8ZA 4FW8A 1AE1A 1VC2A 2JFFA 2Y05A 3E9MA 3BHMA 2ZTVA 3JQ8B 4NBRA 3GNQA 3VPFA 5CPFA 1Z7EA 1B14A 4RGBA 3WGHA 5K6AA 1P1IA 3VVCA 3TFQA 5JC8A 1W73A 1KJQA 3PXXA 3GK3A 1Q0LA 1A5ZA 4BMNA 3A28A 1OAAA 3PWZA 3KBOA 2D8AA 4CM3A 4NU5A 3VAZA 4K6FA 4BNLA 2W98A 1HLPA 4FU0A 1U7TA 5TX7A 4I08A 3O26A 1E1LA 1NXQA 4GAEA 1YB1A 1X0VA 3GVIA 1CWUA 3WYCA 3ROPA 4CM9D 1XU9A 2FPGA 2GD1O 1M75A 4IDDA 1UP7A 4M55A 3ENNA 3KYCB 4MV7A 1C1DA 4XWYA 4XB2A 2NV6A 3HO8A 2Z1MA 4QUKA 1J49A 2VHYA 3JQ6A 3H9QA 4O5OA 3C1TA 1TVEA 4XQGA 2DZDA 4N18A 4FC7A 3WLEA 1NQOA 3G0OA 1SZJG 2WTBA 5L51A 3MOIA 4K28A 2EHDA 4MKRA 1N1GA 5FI3A 5AXAA 3NTRA 3OQBA 1SEVA 5JYEA 3IC5A 2XXJA 3RFVA 1HDYA 3HFSA 3WO0A 1DB3A 4NK4A 2X0JA 2PGDA 3O8QA 5ICSA 3KLPX 3DAGA 4F3YA 1T26A 1W4ZA 4YJ3F 2ZDGA 3CUKA 4O2AF 1CETA 1GR0A 3FRJA 4IPTA 4C5BA 4BNTA 4NIMA 2C29D 3ONFA 2IDZA 4W82A 5A4DA 1GV0A 5IXSA 1I32A 3D4NA 3GUCA 2OBYA 3P2OA 1BW9A 5EIOA 1B26A 3MJ4A 1I7LA 2BFOA 2YZ7A 2P9EA 5AVOA 5KJ1A 1YXMA 2OMEA 3ONDA 3PQEA 3ZWBA 4YPOA 1PX2A 2D3TA 3RV4A 1ZMTA 4MA0A 4M8SA 3QWBA 2A4KA 3D4OA 4XJSA 3F6YA 4DUPA 3Q3CA 5JQWA 3OSUA 1X1EA 4DBZA 4HP8A 4BO6A 4C5AA 3S1LA 2X6TA 3BMOA 4UREA 4LISA 3D3WB 2A94A 3COSA 3P7MA 4UUPA 5FF9A 4AJ2A 2V6MA 3O38A 4R9SA 2PZJA 2UUOA 4CLEA 4CR8A 1DHRA 5BPFA 1GL3A 4E30A 5HRUA 4O63O 2WM3A 3PI7A 5AYVA 3PGJA 2YZLA 1B2LA 4PLZA 3OEWA 4MV9A 3WGGA 5HBRB 5BNIA 4BO5A 5CG1A 1YJ8A 3JQ8A 3MTJA 1GQ2A 2AE2A 5GMOA 1MG5A 1X15A 3WFJA 5ITVA 4XDZA 3UCXA 3IOYA 5KJCA 3E9NA 5I8ZA 1W8DA 1XWFA 3SC6A 4UVEA 1W93A 4E0BA 1LDNA 1KIFA 1ZO8A 3A06A 3P5SA 1UAGA 4AICA 1I36A 4FOSA 1GCOA 5CEFA 5IZCA 1ADCA 1QXSA 3PQFA 3I9OA 2EGGA 3GGGA 1E6WA 1WZEA 3E9QA 4LVCA 3WIEA 5A05A 2P0AA 4ALLA 4RF2A 2DBZA 4BV8A 3TW6A 4EBFA 2R7LA 4NHEA 3KYCA 2VNSA 3LVFO 3UCFA 2RIRA 4E2XA 3N6RA 4XIJA 2YFQA 2YV1A 1Z6ZA 3RQSA 3IIEA 4J43A 5CDSA 1GTMA 1T36A 1EZ4A 2O7SA 4FFMA 3QP9A 3GRPA 3K2BA 5BQFA 5F21A 4GPD1 3RC7A 1XLTA 3RC2A 2RHRA 3WMXA 4RPKA 3HNPA 4GI2A 1HDRA 2X5KO 3VZRA 2UAGA 3E5NA 2EEZA 2HJRA 1QLHA 4IDAA 1BRMA 4IHJF 1ORRA 3QV1A 4E5KA 1E5LA 3WBBA 1A7KA 3AU9A 3JQBC 4JX8A 4E6PA 1SO8A 4BQRA 1K6JA 1LDYA 3AUSA 4OKNA 5F1OA 4YT4A 4PVCA 3TN7A 4YRAA 2PBZA 1AN9A 4P8RA 1B3RA 2X23A 4O2BF 2IE0A 5C8YF 4AJEA 1LLDA 4YJHB 1CQIB 4TKLA 1PS9A 1OBGA 4Y8VB 4RORA 3F1LA 1IL0A 4ZICA 1LQTA 4AL4A 5JS6A 3VC7A 3AOGA 1I2CA 1H9BA 2YS7A 2Y0EA 1ZH8A 2DBVO 3JYNA 5MGBA 4MO2A 2GN6A 5I8WA 2F00A 2HK7A 4IBOA 4DPKA 4YB8B 4R41A 4M86A 2GF2A 4L73A 4IIVA 2HGSA 4I9NA 3D3WA 3F47A 4P22A 3ST7A 1DHTA 3UAGA 2B4RO 3BAZA 3WOHA 4Z3DA 4BNZA 4FFRA 4BO0A 5AOVA 1OI7A 3G8DA 2SCUB 3IUSA 3ZCXA 4Q3EA 2R84A 4M49A 4YAJB 4A2CA 4B7UA 5HBRA 3MJSA 1XG5A 1XU7A 3JRXA 1AXGA 3HN7A 5G2OA 1GYQA 3NTQA 3ORQA 1M6WA 2YFHA 1PGJA 3DHNA 3JQCA 3L77A 2QW8A 2RH4A 2GPTA 2W70A 1QMGA 1MUUA 3GPDG 2IYOA 4YYZA 2UUPA 2EF1A 4OH1A 1VL8A 1EBFA 4TRNA 5JW6A 4ESOA 4I5EA 3R23A 4U0JA 4W4TA 5IG2A 1R15A 1OZAA 3ZV5A 2IXBA 5C7IO 3I12A 3C7CB 4W9NC 2NNLD 3TJRA 3W1VA 3ENKA 1QYCA 2O3JA 3A4VA 4O81A 2Q1UA 3QFFA 4M87A 4UAGA 5A3VA 3TZKA 3KEOA 3ZW9A 1KEEA 2PH5A 1Y81A 1EVIA 3LLVA 4LGVA 4ZHQF 4BMSA 1MGOA 2VUSA 1Y5MA 1LRJA 1CYDA 3FR8A 5GZ6A 4YBZB 1GU7A 1ZK4A 2CDAA 3EAGA 3IS3A 4R51A 3GMSA 4DLLA 4XYEA 1WWKA 3MJTA 3V4ZA 2GN4A 3MTGA 4JBIA 1B6SA 1I5RA 1NFQA 1A7AA 1Z2OX 5IDYA 5A03A 3SXPA 1WP4A 4OHUA 2GLTA 4YDRA 2NTNA 1PJ2A 4DLAA 4W6ZA 3ZU4A 3OJEA 4QO7A 2Y1OA 3UOGA 5JYDA 1PR3A 1UJMA 4RO0A 3AM5A 4ZQBA 3C3XA 4LMRA 1TT7A 4YJHA 4XCVA 1CQIA 2JFHA 1K3TA 2DFVA 4E3ZA 4Y8VA 3ETGA 3JQDA 5BSHA 1GUFA 1HE5A 1YONA 1L7EA 2YV3A 5L7YA 4O1MA 3BTVA 1WDLA 3OH8A 4P4NA 4O4JF 1PS8A 1VE9A 4MVJP 1LU9A 2NVWA 2UDPA 4XQCA 5KVQA 5H80A 3S2EA 2XPCA 5CDUA 1UR5A 1W96A 4YB8A 4DLKA 1M2WA 4X54A 5COAA 2ZCUA 1I30A 2IODA 5IFLA 2AEMA 4CUJA 2ZQYA 4D43A 1G6KA 3AW8A 3GVCA 3WICA 4AFNA 5JSFA 1NAHA 5ILGA 5I9NA 1X0XA 2I9PA 2SCUA 3JQBA 2WYUA 1W6UA 1P1FA 1DIAA 3RUDA 4YAJA 3U49A 4PZDA 4MVJF 1VBGA 3NAQA 5BSFA 2FPPB 2R00C 4TVOA 4JJIA 4QSHA 3WWZA 3TOXA 1R0KA 3WR5A 2W6OA 3ONEA 3ZWMA 1YS4A 4MVJI 1BXKA 1EDOA 2CNVA 4MV1A 1KJ8A 4LVUA 4MVJG 4IUYA 5JPIA 1Q7BA 1Z2NX 1ZEJA 4Q39A 1KEPA 5TNXA 5EL0A 4HFRA 2FHSA 1A4UA 1O94A 1P33A 3TINA 2R7MA 4PIVA 4OGWA 3KM0A 4PN3A 1Z74A 4CMEA 5HA5A 2O3RA 5TT1A 2X86A 3EW7A 3FNEA 4WEOA 2P9GA 2Y1GA 1IPEA 2YDXA 3OIFA 5A5FA 1S6YA 1HKUA 2CSUA 3QWIA 4O7RA 1KS9A 3EZLA 2C00A 1YDWA 3JD1A 1ZSVA 2HAEA 4EEXA 3F1KA 4CMBA 1O6ZA 5DBGA 4FQ8A 4OXYA 4J3FA 5D8DA 5EN4A 4IJVA 3CPSA 2V6BA 4BO1A 4O4LF 3T7CA 4FE2A 3G1UA 4HNUA 4GX1A 4A27A 2HDHA 5TS3A 3R5FA 1EMDA 1Y9EA 3SLKA 2AQKA 4KTTE 3IP1A 4J2HA 3UF0A 1Q2XA 4YBZA 5GZ1A 4CM8B 2PWZA 4CR6A 2ZJ1A 1H6BA 3V8BA 4CM7A 4NJMB 2X4GA 4HADA 4BGEA 3N58A 3ZWXA 5L3ZA 3RUHA 1E6UA 5JAQA 2Q1TA 2P5UA 3WGOA 3L07A 2YRXA 1VBHA 3VVBA 3ZN2A 5IYZF 3AU8A 3L6DA 3QWHA 4PLGA 3OJOA 4DREA 1PJCA 3AJRA 3EGOA 3K92A 3T7EA 1ISGA 2GASA 4W9NA 1JN0A 3OIGA 4Y6PA 4ZRNA 4H3VA 5IZ4A 3KYBA 5TF4A 1QKIA 3ETHA 4I50F 3I9JA 5ES3A 4O7NA 1A9ZA 4DQXA 1KVUA 1ONPA 4JK3A 3ZWAA 2YHIB 3H2ZA 3AY7A 2O4UX 3N74A 4FJ2A 2VT2A 1I3KA 2I87A 1BHSA 1Y8RB 3W6UA 4D46A 2CF6A 4ND3A 3RBVA 3DZFA 3RIHA 2PV7A 4AJ1A 1LA2A 5K0ZA 1V3TA 3QVTA 5F1KA 1E3JA 3GN2A 2EWMA 4O7ZA 1ZCJA 4CMHA 3INGA 5FFFA 3HHPA 4CUZA 3OJLA 1UP4A 4WLUA 1C3VA 3JD3A 4IQGA 3VHRA 4BKOA 2H9IA 4L74A 2Y93A 3JQAB 2FPPA 1E7RA 4J7UA 2PZMA 5KVCA 4CM1A 4ME6A 2CY0A 1A9XA 3SJUA 3OBBA 3WQSB 3ZWYA 3GAFA 2Z1NA 3FHLA 3OICA 5CPBA 2TMDA 3NRCA 3QHAA 2B35A 4H7PA 1F14A 2V65A 2J5RA 1YBMA 1U8FO 3JYLA 5DP1A 5I9MA 4WJZA 1M6HA 2O7QA 4TQGA 2FPIB 4IQ0A 3WQQA 3QWAA 2XXBA 4ZGWA 1N5DA 3MEQA 4ZJUA 5HTOA 4OAQA 3FPLA 1NVTA 2B37A 3OETA 3WGIA 2WE7A 5L40A 1ZK1A 1YWGO 2P68A 3FNGA 4J4TA 3ZH2A 5EZYF 4MPDA 4TMFA 3DBHB 1PJQA 2DWCA 2BFMA 3HSKA 4QXMA 2W6MA 1U5CA 4BNKA 5C1PA 1ADGA 2X1HA 3E82A 5F5LA 3JTMA 4IIUA 4UEKA 4K6CA 4LRTB 4RV9A 1PL6A 4BMVA 5CDYA 3BMNB 4MP3A 2EKLA 2W90A 4WBNF 3LP8A 1ZW1A 4DWVA 2Q2QA 4RZHA 1YGYA 3CEAA 3ORFA 4Y67A 1O9BA 2Q3EA 4I5GA 4KUHA 4MINA 4WCDA 1NM5A 4A03A 4NNJA 4NJMA 5TLSA 3WYEA 3OA2A 2O4CA 1J6UA 4EJMA 2I8CA 4KTVE 4BNIA 1SPXA 3GRKA 4IS3A 2R87A 1YQXA 2HJWA 1KY5A 2ZB4A 4WNCA 4BKQA 4NR0A 4XR9A 3PPIA 4E33A 3PK0A 5KOIA 4FR5A 1P9LA 3JV7A 3HG7A 2FP4B 2YWVA 3R6DA 5CFZA 4BOYA 3WNQA 1QV7A 4J7XA 1FK8A 2B5WA 3UICA 3E03A 1G1AA 1DO8A 1J4AA 1UDBA 2QHXA 4B4WA 2LDXA 4BKUA 3CH6A 2Z5LA 3DMTC 5JO9A 5C37A 1IUKA 4MV8A 2NACA 3E8XA 1EK6A 3WSWA 1YL5A 2YHIA 5AQ1A 1B6RA 1PJSA 2GYYA 3B1FA 5LXTF 4FJ0A 4U7WA 2FWMX 3PTZA 1K5HA 1Y8RA 3ANLA 2OL4A 3PFWO 4R1SA 1HZJA 2ZK7A 2VPQA 1HSZA 1PGNA 3L0DA 1JDBB 4FFLA 1DC4A 3F5SA 3IUPA 2BHLA 4EGJA 5TQVA 3E5RA 2QZ9A 3I83A 1GEGA 3AW9A 2CNUA 1CQJB 2WYVA 2ZB8A 3F4BA 1N1EA 4NG5A 4RCVA 1TT5B 2E4AA 1I2ZA 5THQA 3RROA 4XRGA 5KIAA 1WPQA 4FS3A 2O3QA 3P2YA 3CMCO 3LC2O 4WGGA 3HB9A 5AXDA 5JAMA 2C7GA 2X22A 3C24A 2UYYA 3JQAA 5DP2A 4AJNA 2Q1WA 2H6EA 1KBLA 3ICPA 1EFKA 5CP8A 3TRIA 2PGJA 1IB6A 4WLFA 4GBJA 2G82A 4FB5A 3RCBA 3LLSA 1GEEA 4FCCA 3WIDA 1XR3A 2R7KA 2CVOA 1EE9A 3M2PA 1H9AA 4GH5A 4E2ZA 3AM4A 1C30A 1DFIA 3I4FA 4ZQEA 1C3OA 1HDOA 1JVSA 1N2SA 1PZGA 2PZKA 2VRCA 4FFNA 1CS0A 2HCTA 4JJGA 2VHVA 3GEMA 3BXXA 3D4PA 5ITWA 4DXHA 2R82A 1T2DA 2FPIA 3Q9UA 4IMPA 3MJEA 2Q50A 1NNUA 3KZVA 1NAIA 3CIFA 1KYQA 3KVOA 4CLXA 3GFGA 2EIHA 2V58A 2HKIA 3TQHA 3DBHA 5T8KC 4DA9A 2DC1A 5IZCC 5L4SA 1R4NB 5BSEA 4O82A 4DIFA 1DOHA 3OEYA 2B83A 1DIKA 1LI4A 5IJZA 3LC7O 1YB4A 3E48A 3TNLA 2X9GA 5LYJF 2FZEA 3BMNA 2ZQZA 3GDOA 4NFHA 3GQVA 3AK4A 1PSDA 1XIVA 5F1PA 2VN8A 1R0LA 3MJVA 4RQUA 3WTCA 2OLSA 3JRWA 4YJ2F 1CIVA 1AHHA 1LQUA 3E1KA 3I3OA 3MWDB 2R7NA 1VRWA 2JCXA 2Q1SA 3LZ6A 3R0IA 4OMUA 3DMYA 3KV3O 1T25A 2O2SA 1HETA 3FBGA 4J16A 4E5YA 3DAFA 4NBWA 4NZ9A 4D7AA 3VPBA 3FR7A 1D1TA 2DUWA 2QG4A 5A02A 1HLDA 2IXAA 3WXBA 4BGUA 4J6FA 1JLLB 1C1XB 2FP4A 2AXQA 5KVVA 5L4NA 4BGIA 1I3NA 1U1IA 5L7TA 4NQZA 1OBFO 3G79A 1F0YA 1XCBA 3BTUA 3EYWA 3P19A 2AEFA 3DO5A 4IZOA 4URFA 1KUTA 3L4BA 4P4GA 1YRLA 4A7PA 3KETA 2BRUA 3SE7A 4YACA 2NU7B 2E6UX 2EG9A 3ZWPA 3JQAD 1L7DA 3LU1A 3K6JA 2YDYA 4XQEA 4Z9XA 1DAOA 3CINA 4FPXA 4RVHA 5JDIA 3VKUA 3WYBA 1R66A 2D59A 2Y66A 4BB5A 1QYXA 3KLMX 4MVJM 4O0LA 3RSHA 1GDHA 2ZIZA 3FNFA 4E21A 4I8XA 1TT5A 2EXXA 1AHIA 3R3SA 1DC5A 3O9ZA 3ZU3A 3SVTA 3K2EA 2PFGA 4FGRA 2E82A 4BKPA 2I67A 2IZZA 4R68A 2VRCD 4ROSA 4MV4A 3TZCA 1CERA 3EUWA 3JQEA 4O84A 2B0JA 4IQ8A 1DV2A 3ZGYA 1MX3A 3ASVA 3PVZA 3AI3A 3KSZO 3WGZA 4DIMA 5G0UA 3PLNA 5FI5A 3HBLA 3OQ6A 3DOJA 4FJ1A 4TRMA 4XEHA 4ZQGA 3DMTA 3S8MA 1O5IA 4RDHA 1LC3A 2GN9A 3U62A 1E7SA 3DAPA 1LDBA 1VKOA 1RKXA 1DIGA 3IQDB 4PLWA 4U8GA 3KEQA 4ZQFA 1SEPA 4RF3A 3GZ4A 3K8ZA 4Y6SA 1EE2A 1H6CA 3ICCA 4OXNA 4PZEA 3F9IA 4E4TA 3V2UA 3JZIA 1AUPA 3INRA 2I5PO 3U9LA 4JQCA 2VHZA 2FR0A 3UFXB 3VTZA 4O7YA 5IN4A 2Q2VA 3EK2A 3OUZA 3LK7A 5TT0A 3K9QO 1GSAA 2C2XA 2PY6A 2Q99A 4DQUA 1NR1A 5ICMA 1UXJA 3D5QA 1MV8A 2E37A 5B4VA 2FN7A 3WO1A 3KAJA 1H5QA 1NASA 1PWXA 4RZQA 3DF7A 1T24A 3VMMA 1DC6A 2WMDA 3HQ4O 3GLKA 4OJNA 3UHAA 1LSUA 1R4MB 1IOVA 1VJ1A 2J3HA 2D0IA 2ZKLA 5FYDA 3IJPA 5DULA 1MLDA 2J3KA 2EJVA 1DFGA 3OIDA 5IAAA 1LLCA 3AOEA 4ZU3A 3QQPA 4KMSA 2VOJA 3Q2IA 4L4SA 2OUIA 3T4XA 2B4QA 3RFXA 3WBFA 3NT2A 2AW5A 1X1TA 1LRKA 3ZHBA 5G0WA 3D3EA 4F46A 1WDKA 3CTMA 1Q7CA 1BNCA 1HT0A 1UAYA 4CPDA 4O4IF 4GSKA 1JLLA 1C1XA 3RUPA 1IOLA 1A48A 3GEDA 3L6EA 5J23A 4FDAA 5JH7F 3FWZA 3LC1O 5T8KA 3PJFA 3BMCB 5KJFA 5G0SA 5IDXA 1ZXBA 3JYPA 2PZLA 2RAFA 4IJUA 1UUFA 1EVZA 3HZZA 4GX5A 4A73A 4XDYA 2NU7A 3LSYA 1UDAA 3ZHXA 3AY6A 2VUUA 4KUGA 3VOSA 3RD5A 3HDJA 2ZYAA 1I01A 2PKRA 1LDEA 5I7SA 2HRBA 5T64A 2YRWA 1AXEA 2CZCA 3SBOA 1NQ5A 3TZ6A 4CMCA 2X9NA 4QX6A 4ALNA 2HMUA 1PL7A 1VPDA 3QE3A 4Z0TA 1HE3A 2CNBA 1EBUA 5LP6F 5G0TA 4BNMA 2WYOA 2PLAA 1HDXA 1ULSA 3FI9A 2H5LA 3MCVA 2VR1A 1YDEA 1Z82A 2I76A 4UEJA 5KWEA 2GLXA 3QW2A 4BV9A 4NU6A 3AY3A 4D79A 3A1NA 5DCYA 2GCGA 3T4EA 1HRDA 2DLDA 1PS0A 2VCYA 4ZOLF 3EZYA 2I3GA 4GLLA 2EKQA 3EC7A 3CKYA 1A9YA 3GY0A 4EGFA 1ZXLA 5EERA 4B7CA 3NUAA 5JVDF 2DTDA 3W8FA 3R1IA 1UXGA 3RC9A 2CMDA 2Q2WA 1E1MA 3RKUA 4CMGA 5A04A 1K6IA 3NGLA 3ANMA 4U6SA 1GYRA 2IRWA 2XCLA 5EMHA 5CG2A 3ZNNA 4ND2A 3WSVA 4DGSA 3RBZA 4S1VA 3VPXA 4ND5A 5DDIP 5JDCC 4CMEC 4DBVO 3UFXA 2QX7A 3NV9A 4NK5A 3V1UA 5KKAA 3X2EA 1MFZA 1UZLA 2I99A 3ULKA 3BMQB 3W4IA 3NT4A 3NEPX 3VTFA 3Q2KA 3HDHA 1DFHA 4YXFA 3OHSX 3AX6A 2EW2A 2XAAA 1R4MA 3VA7A 3NX4A 4S3MA 3I1JA 1XQ1A 2NTJA 4MJLA 3JQFC 4GGOA 3ZU5A 2HMSA 3VZPA 3ETJA 2O3UA 3L4SO 4DPLA 1KC7A 1BG6A 4CQLB 4R54A 2WEKA 3JQGB 2FOIA 1QRRA 3PRJA 2WJPA 2VOEA 3GHYA 4H16A 3W6ZA 1I3LA 1P1RA 4F6CA 5JO0A 3GG9A 1AUVA 1YE3A 1Z45A 3PDJA 5JLAA 2W71A 4E2WA 1V3VA 1Z7BA 3BZUA 3CZMA 1DDOA 2JAHA 2O23A 1FJHA 4LK3A 1CEQA 1IZ9A 2X5OA 3BMCA 4OKIA 1T2CA 4HX5A 4IJKA 2EP7A 1PGQA 2DPHA 4HFJA 1P74A 4EI2A 2YYAA 3F4LA 1DIRA 3WS7A 2PGLA 2DTEA 3A14A 3SJ7A 1M0WA 1DIBA 3KTDA 1LEHA 2C0CA 3ROKA 4CLDA 1XEAA 3ZU2A 5T57A 1UDCA 4TROA 4WOJA 5AXCA 2P9CA 1NWCA 3RV3A 2V7PA 2VUTA 5KX5F 2UVDA 3PHJA 2DBQA 4DPMA 3RVDA 3R5HA 1DEHA 1N7HA 4YAIA 4QSMA 1NQTA 4M1QA 4YT2A 5DOZA 3DFZA 5L7WA 2VWQA 3DBLB 4R01A 3QVSA 5U1PA 3GA0A 4FGWA 4K26A 2CDBA 3GT0A 1BWSA 2DTXA 3U3XA 3HDYA 4Q3AA 3E18A 4J91A 4RZIA 1NHGA 4BNYA 4M9UA 3ASUA 4U6QA 2QRKA 3PYXA 4R9RA 4R4JA 1WNTA 4OOFA 5A1TA 2JAPA 2F1KA 3OP4A 3FPCA 2WE8A 2EW8A 2P91A 3OFSA 4KDFA 3UW3A 4W7HA 3UXYA 4TV8F 1PJ4A 2J3JA 1KJ9A 4FD3A 2P4HX 4WLVA 2X0RA 4TZTA 5C3MA 3MJFA 1ISMA 2NU6B 3KAKA 1GSHA 1VL6A 1C0LA 2QF7A 5JMPA 3VDQA 4A5OA 3K5IA 1DJQA 2FB9A 4DC1A 4U0KA 1CE8A 1VJTA 4KP7A 4WNIA 4Z6KA 2RHCA 3UVEA 4HBGA 4MAMA 1DSSG 2Q4BA 3LDHA 1E92A 3NYWA 3ZWWA 4ZHSA 3G1TA 3WB9A 1HE4A 3O4RA 5DNAA 4WPGA 2J5QA 1Q0HA 2GERA 4JCOA 4MVJE 2JD1A 3WMWA 4R1NA 3JZFA 1OBDA 2PKQO 4C4OA 4O7TA 1JAYA 1FDUA 3HUDA 1QP8A 3K3PA 2WYWA 1CF2O 2NQTA 4XGKA 4FGSA 4DL9A 2VNAA 3GMDA 3O03A 1ZK2A 4KZPA 1JVBA 2VQ3A 2GUGA 3N7UA 4IDBA 4RL6A 8LDHA 1MXFA 5KJ6A 1DIHA 3OM9A 4CLOB 4CQLA 2CZGA 1DBVO 3JQGA 1P3DA 4XR4A 1GSOA 4XYMB 4RVDA 1YH3A 2I65A 3Q6IA 4NPCA 4D44A 1G0OA 1P77A 4XZ3B 1P1JA 1SB8A 3INTA 3G17A 4EZBA 3BIOA 1SNYA 5J2UF 3GHHA 3JCZA 4LN1A 5U4QA 4CODB 3H9UA 4EJ6A 5A06A 3GC6A 3V1TC 2W8ZA 2NTVA 1ML3A 1NHWA 4PLPA 1JWAB 3QJ5A 1GQQA 4YEDA 5JE8A 4AG3A 4ZN6A 2VT3A 4B3JA 3IMFA 3ROQA 5JY6A 2G76A 2W6NA 3GOHA 3ETDA 4B79A 2X8LA 1E7YA 1LX6A 1Q7GA 3WLFA 2YHUA 1TXGA 3JQFA 1VKZA 5DBFA 4D45A 3VPCA 1BSVA 1LSSA 1WMBA 2NSDA 1KEUA 2ZCVA 5CB4F 5I7VA 2G1UA 3TPCA 4A0SA 2WD8A 4P38A 2Y1EA 3TWOA 2D5CA 3Q11A 4WLEA 2PTGA 4B8WA 2VYNA 4RLSA 3DBLA 5H82A 3W4KA 2C2YA 1B15A 1VI2A 1H93A 1ZK3A 2HQ1A 3W8EA 1T4BA 4GMFA 4KWIA 4XYGA 5DZSA 1NX6A 2VZ0A 1E0DA 4B7XA 3KHUA 3FTNA 3RKRA 3QA9A 5G4KB 3ZI0A 4XYBA 4QTZA 3H5AA 4E5PA 1E6EA 3CE6A 2IYPA 1B0AA 4MP6A 4RPHA 3I52A 1UXHA 2O2YA 4R16A 4LCEA 4NBTA 1PZHA 3HB5X 3GVHA 4YVFA 3DR3A 2NU6A 4YT8A 4GWGA 2NQ8A 3WFIA 5ENVA 4IM7A 4IXTA 2G5CA 3GNTA 2AQ8A 4AJLA 4O4HF 1K6XA 3GPIA 4B3HA 4BO9A 4F6LA 4L4RA 1P0CA 4YRDA 3SX2A 3KRTA 1RM3A 2G17A 1F06A 2GGSA 1X14A 2JL1A 2PN1A 4N5MA 4E5NA 3ZV3A 4GX0A 3TSCA 2AQIA 1ULUA 5LC1A 2OHXA 5C7OO 4DIBA 4RDIA 1B3BA 1V3UA 1BDBA 4WLOA 4UVHA 5I7EA 2POQX 1NTOA 3H6KA 1SAYA 3PIDA 1BXZA 1CJCA 2FRDA 3TZHA 1Y7TA 3GDFA 2PH3A 4O7VA 4CLHA 4MA5A 4YR9A 4OSPA 4ZD6A 1U3WA 2AG5A 4Q3BA 4RPJA 2OGUA 1YBAA 4Z0PA 4CLOA 3D0OA 1J5PA 2FR8A 1DV1A 1F8FA 4Y98A 3ZWCA 3EHEA 4EYEA 4XYMA 1HE2A 4UUNA 1F12A 1RYDA 4TWRA 1EUDB 1JAXA 5A9RA 3U9SA 1E3WB 4XZ3A 3Q0EA 2ZDHA 2Z95A 3M1AA 2O48X 3PLRA 4LMPA 3V5NA 1YL6A 1H2HA 4CV3A 4GLOA 1Y9AA 3U09A 3LT4A 5FNVF 3OMLA 2C54A 5TRTA 2LDBA 1PR9A 3PJEA 1RM4A 4E31A 3PQDA 4BL5A 1E7WA 1EFLA 1PGPA 2C59A 4RQTA 1VLLA 5IN5A 3V1YA 4BVAA 5B4UA 2VYND 3FBTA 4QT0A 3ADPA 3IKVA 4W99A 1SOVA 3UH1A 3H8VA 4H15A 4XYLB 4QQRA 1I8TA 2AMFA 4BQPA 3RJ9A 1M6VA 4BB6A 2ZTMA 2GSDA 5JAIA 1SB9A 4Q3NA 1FDWA 2JD0A 3KYDB 3L4BC 4ONEA 5BNTA 1JQBA 3STHA 2BI7A 2RH8A 2BKAA 4MKZA 2DLNA 2VHXA 2C5AA 4OM8A 3S2FA 3ZNOA 3PHLA 4N54A 2NUAB 1P1KA 2Y99A 4MV3A 4B3IA 2ZB7A 3U4HA 1I10A 1LNQA 3JD2A 4O7SA 5JDIC 1PQWA 2CVQA 4J2OA 4ZQHA 3WGTA 4CM8A 4EUHA 4BO4A 5LCXA 2C07A 4AJIA 4YQZA 1OOEA 4CM6A 1E1KA 1LTHR 4RVUA 5IF3A 4NH4A 5CDTA 4RPGA 2UV8A 5G4KA 1V9LA 4QECA 4QO8A 4UVDA 1Z75A 4D3SA 1HYEA 2VZ8A 4HUJA 1JDJA 1PJ3A 3RUCA 1UXIA 4GKVA 4DVJA 4EJ0A 5KTKA 1ENOA 1ZZEA 4E2YA 2D2IA 1BXGB 4IS2A 3BTSA 1O89A 5ADHA 4O7WA 4CMKA 1R12A 1M76A 1PJBA 2C7VA 3DZIA 4YTEA 4BNXA 3ZHZA 2DBRA 3PYMA 4IGEA 4CMJA 1RYEA 2IEBA 1U9JA 4PG8A 1U4SA 1C0PA 2JHFA 2P4QA 3WTBA 3DZKA 2CVZA 4XKJA 4R69A 1XSEA 4HNHA 2CF5A 3PDUA 1U2GA 1BMDA 1P1HA 2GZ2A 2JCVA 2ZB3A 3Q1LA 4E13A 4B4VA 1C14A 3WNVA 2W6ZA 4IXWA 2B4TO 1QG6A 1YQDA 2FMUA 2VWHA 4CQMB 4UUOA 2A92A 2IZ1A 3ABIA 1WLYA 1T4DA 9LDTA 3BA1A 2BLLA 2NVUB 1UZNA 1TLTA 4HY3A 5T5QA 4PG4A 4C7JA 4L8VA 4PLVA 4XD2A 1ZEMA 4LSWA 4HWKA 4PZCA 8ADHA 3KSUA 2Y68A 3E6AA 2DIKA 1YVEI 1UP6A 4WCFC 1E1NA 3AOEC 3V2HA 1JKJB 4CLRB 1DAPA 1EUDA 4J4BA 1E3WA 4O83A 1ONNA 1GGOA 3PYLA 2YZNA 2GZ1A 3GAZA 5H81A 2J5KA 4RVSA 3QSGA 3GEGA 4B4UA 4HNTA 4EDFA 2W4QA 2XOXA 4II3A 1LJ8A 4IDGA 1NPDA 1LRLA 1LLQA 4M89A 4XYLA 3TL3A 1T2FA 4D3DA 1QR6A 3V4SA 5KKNB 1ARZA 4HR7A 1U3UA 2A35A 2YW2A 3PHIA 4EUEA 2HRZA 3JYQA 1ISHA 4G65A 4HNVA 1RM5A 1O8CA 1DRVA 2ZATA 5F3RA 1D8AA 3MWEB 2HK9A 2X7HA 5DCWA 2NUAA 4ND1A 3PFFA 2R86A 1X7GA 3B1KA 4J9VA 3IJRA 1LDMA 3WQRA 4DTIA 1A4IA 3ADOA 4WCFB 2HMWA 4FOOA 3DTTA 3JQ7B 4DC0A 4MOWA 2PNFA 2FZWA 1P0FA 3IKTA 1Q0QA 3GF4A 1BVRA 3X2FA 2PVPA 4DYVA 1V0JA 3DL2A 5GONF 4IMRA 4YAEA 1EVJA 2VWPA 3F5QA 1PZFA 3KO8A 4DRYA 1O0SA 4CM5A 3R5XA 2GZ3A 2QRLA 4L9RA 3WGYA 3RFCA 3ZZNA 1R0SA 4PLCA 5KKCA 1HWYA 1NBOA 1SOWA 4RF5A 3GNSA 1BXGA 3AWDA 3JD4A 4RF4A 4J1QA 1ZSYA 2VYVA 4FBGA 4J0EA 1WMAA 1U5AA 4CV1A 2E49A 4R1TA 4IY1A 4NYEA 1K0UA 2JD2A 4FFPA 1ADBA 3HN2A 3EMKA 4LSMA 4GMGA 1KVTA 1XGKA 4PGFA 3DZBA 4RVFA 5G4LA 1KVQA 2FSVA 3EDMA 1EZ1A 4YWJA 3DDNA 1MG0A 5EQDA 2NM0A 4BNNA 2V5AA 1CQJA 3DHYA 2O50A 4WLNA 1P44A 2X9VA 1ZBQA 3E5MA 3K5HA 2JJYA 4L76A 5CEJA 3R9RA 1CDOA 1PQPA 2OFPA 2CDCA 1ENYA 2NLOA 2OP1A 4CQMA 3W8DA 1KC3A 3TQTA 4C7KA 2R2GA 2NVUA 2RBEA 2XD4A 1GD1O 3DB2A 3VZSA 1IOWA 3AM3A 4K1LA 3C7DB 1ULZA 3S55A 3ETEA 4GSLA 1PL8A 1FXSA 2EERA 4N5LA 4CLRA 1JKJA 3DHEA 3OQ1A 5B12A 4U5QA 2VZ9A 4L0QA 4L75A 1DLJA 3TDKA 1E77A 1I33A 1XYGA 2Y1CA 4D41A 5BR7A 2VTEA 4YJDA 1ZJYA 3H9JA 1GUZA 1PTJA 1R16A 1EUCB 1K89A 2V6FA 4MDHA 1E3EA 2DU8A 4A10A 2NU9B 3B70A 1FDSA 3I4CA 1N7GA 4CL3A 5BSGA 3RJ5A 4RVGA 3ANNA 4D3FA 4XRRA 5CA0F 3K73O 5DF1A 2HUNA 1Y6JA 1FF9A 5KJEA 4AJOA 4D0RA 1JU9A 3LT2A 1R4NA 1OC4A 2BFAA 2AG8A 4NMHA 3TOZA 4BUCA 3JD0A 4IGFA 1X7HA 4J49A 5C7LO 3PIIA 1PWZA 1YKFA 4ITUA 2VQDA 6ADHA 2X5JO 3WDSA 2EV9A 1PGOA 3MWEA 1X7DA 3VOTA 4YJGB 3TL2A 3G49A 4GQAA 5TJ9A 2R6JA 4J7CA 5HV6A 2EP5A 1A71A 4FC6A 1FDTA 1WXDA 3QVXA 4EEZA 4PFJA 4WCFA 3MWDA 5CAEB 2DAPA 3AUAA 5KVSA 1E4EB 3JQ7A 3V2GA 1EEHA 4R5HA 5LDGA 2BELA 3MJCA 3DFUA 4PLFA 5DOVA 2VYVD 2DM6A 4MIYA 3NGXA 4JXKA 2ZTLA 4HKTA 4BNHA 1TI7A 4EW6A 1M66A 2OZPA 2CUKA 4QEDA 1H0KA 4BIIA 4LRSB 4ALIA 5BT9A 1LDGA 2DKNA 2PR2A 2QQ5A 1ADFA 1N9GB 5TIIA 4FIZA 4MV6A 1NVGA 4OSOA 3FSRA 4KQXA 1WDMA 1HDCA 2BGLA 1ENZA 4KOAA 1KJIA 3FWNA 3I9KA 3KREA 3NDJA 3BHIA 1JKFA 2JFGA 4ZA2A 2DFDA 4CQMD 1C0KA 1D1SA 3N8DA 3RAJA 1ZK0A 1KEWA 1U2DA 1DC3A 3EVTA 1Y5RA 9LDBA 4FFOA 3WX0A 3PZRA 1ZSNA 1LUAA 1TEHA 1EVYA 2ILTA 2W2KB 2X0SA 5BNFA 5DN9A 4BNGA 3AUTA 3GGPA 1ISFA 1XQ6A 5L95A 2AA3A 1E5QA 3OUUA 1GZ4A 2PD3A 1KEVA 4IZHA 4O7LA 1VL0A 4OYRA 4F45A 2I66A 2AE1A 4YAKB 4JN6B 1DRWA 3LF1A 4JLWA 4PCVA 5B37A 4J0FA 1GADO 3TIGA 1SBYA 3MZ0A 4ZI7F 1HXHA 3LT1A 1GFSA 1EHIA 2P2SA 2Z04A 1KC1A 4IINA 1XDWA 5DCUA 3TZQA 3ZNPA 1LSJA 1MA0A 2Q4EA 3CMMA 1HYGA 3ROMA 5EQFA 3H2SA 4YQYA 1MP0A 3C8MA 1ZJZA 1MXHA 1ZVMA 2VWGA 3G3EA 3DBVO 1H6AA 4I5FA 2OBNA 4KQWA 3UGKA 4O6VA 1ZNQO 1U4OA 4PLHA 4NDNE 3SC4A 4TVBA 4C5CA 4PLYA 2HJSA 1U3VA 3K30A 1EUCA 4M54A 4YCAA 4Z9FA 3I9MA 3IDSA 4WECA 2NU9A 3M2TA 3WGQA 4BGVA 1H94A 3H65A 1KETA 1CRWG 3OJ0A 4INAA 4R3NA 4TZKA 4ZQIA 1HZZA 4GVXA 1SC6A 3B6ZA 4XJTA 1GCUA 3U4DA 2Q45A 3CSDA 4ZVVA 4D0SA 4AJPA 3GR6A 1K2WA 3H4VA 5THKA 4JGBA 4UVGA 5BPHA 1KVSA 1HSOA 2TMGA 2DPGA 3VPSA 2GPWA 4YJGA 1GZ3A 3PEFA 4MVJH 4AVYA 4MIOA 5TGDA 5CEEA 4NJOA 4PG5A 1PJTA 3RUIA 4HQ6A 1GUYA 4IZIA 3FNHA 3KUXA 1Y8QB 4Y6RA 3RUAA 5CAEA 5C5IA 2JHGA 1E4EA 3U5TA 1T1SA 4GGPA 3C7AA 3VDRA 1AGNA 1IHYA 5EJ2A 4P4LA 2DUUA 1OC2A 5L53A 1WW8A 1DLIA 2GDZA 2C82A 1T2EA 3ORRA 3H9EO 2C20A 5U9CA 3AUUA 4TV9F 4L4XA 1B16A 1E3LA 4TUYF 4XIYA 3MOGA 1N9GA 2YQ4A 4Z9YA 3IAHA 5JCJA 3WJ7A 1WAMA 2BH9A 2ET6A 2I3AA 3I6IA 4IDFA 1O95A 5HM8A 5JAZA 1SCUB 4BO3A 2ZYDA 5LDHA 1BDMA 5DBIA 3VH4A 1KJJA 4Y9DA 4BO8A 4XA8A 2H63A 3Q2OA 2HSDA 4KWHA 4RJTA 1PK8A 2OOSA 3NJ4A
chains in the Genus database with same CATH superfamily
2GJKA 2YVAA 2W2KA 2GVZC 1R0ZA 2H29A 2WHYA 4KQJA 3ETCA 4BQOA 2YV5A 4BE7B 3BWCA 4RWZA 4XM0A 2GTPA 1UBUS 1C8BA 3O83A 5EJ4A 1BZYA 1JI3A 3V1NA 1L4BA 5HWSA 1C0IA 5EHGA 1IULA 4J6EA 2J33A 4Q9LA 2A8YA 3I23A 2F43B 3AC0A 2WIFA 1I51A 4UEOA 5AW3A 1IHXA 4QODA 2ZJ4A 4JEUA 4RDXA 4FUQA 2V9PA 1Z2AA 1CNFA 4LZLA 2QLMA 4YCBA 5GY7A 4PX5A 1QIHA 3W04A 2R60A 4DLWA 4F38A 1DJNA 1QYVA 3NHKA 3VX3A 2B20A 1I0ZA 1QGUA 3CPEA 3ESQA 3F6BX 5BQ3A 1IYZA 3CEMA 1T34A 2IPOA 4QYMA 2RCYA 3OLWA 2AZMA 5DYNA 3RRFA 3TM4A 3TTSA 5KNBD 1TKRA 4HNAB 1J0XO 1NC1A 3EXAA 1QMPA 3WVNA 4HDSA 1K6EA 5E38A 4BHTA 3FHCB 3REGA 1CHDA 3LYLA 5MN4A 4WH0A 4ITVA 1ZNYA 4HNGA 3VKGA 5KSYA 1SMKA 4KCGA 4J1TA 2OG1A 4U4AA 2XA1A 3A70A 4QPDA 4MR8A 2H1SA 3OE7D 3EVNA 1KI6B 5IVKA 2O5RA 2Y77A 1PZEA 1M1YA 2HA7A 3KR9A 4FT2A 3KEMA 3GZNB 4QASA 1R6DA 5KCZA 3R3WA 1XPJA 1HEUA 1RWQA 2CFCA 4YP0A 2DHQA 2EX1A 4XGNA 3GP8A 2WYHA 1VJDA 1CG6A 2IV2X 3HADA 4M22A 5AKZA 1QFJA 3VR6H 3H0CA 3KQNA 1H5UA 3GMIA 3OZFA 4ZVNA 4EPRA 2JJ1D 3TBHA 2EG5A 1QZ3A 1GN8A 1M34E 4R2HA 4W5RA 4MS4B 3B52X 1NF3A 2Y1DA 5I7AA 2BEVB 1F8GA 3F98A 521PA 5IDWA 1P4RA 2IH2A 4HDMB 4NDAA 4BXOB 1UMCB 1PRYA 2GM3A 3EGEA 2R6DA 3S2ZA 5JLJA 4OYLA 3PQCA 1FNDA 1Z29A 5GOZA 4BLVA 4PPYA 4XSGA 1HF3A 3VZQA 1WCIA 4WOKA 5EINA 3AFNA 4L50A 4BUJA 4UMEA 3WJAA 2Q6IA 1EX6A 1MO6A 1FFEA 1GLVA 4DABA 4AWXA 5JFOA 4CG1A 1ZHHA 2D2VA 2O2XA 5DKFA 1V6AA 2IZ0A 3GYGA 2B7BA 1IQUA 2BVNA 3AG5A 3O75A 4MNTA 5CA1F 2QPTA 3EIEA 3IURA 5I4BA 1KDOA 1OREA 1VBKA 3TIIA 4GPEA 4EY8A 2IWHA 4L07A 3OZEA 4LDAA 4DCMA 4NE7A 5AM0A 5U4XA 5KPJA 4BNWA 1UKZA 4KGZA 2J7KA 2F8TA 9ABPA 1Q1BA 3ZK9A 2QQFA 4PG7A 3FOFC 1U0JA 1NLUA 1R18A 2FR1A 4LGYA 4XASA 1CXZA 1QVWA 1RI3A 4CR7A 2O8EA 2PD4A 1TM1E 2ZGVA 3GLTA 3DOOA 4Q1FA 4YROA 4D2IA 4RTNA 3G7UA 5KSPA 2GJAA 1HQDA 1VIAA 5LA6F 4H77A 4KYUA 3SU8A 4NV3A 4AKIA 5HM6A 3AJAA 4O2BA 2P9HA 2WWXA 3JZAA 4FKBA 5JBIA 3RT1A 4JB3A 2ZSFA 3LT0A 1E5DA 1QJCA 2H3HA 3HB0A 4G24A 2JLRA 2GZHA 3GT4A 1ZM9A 2AL7A 2MYUA 1JTVA 3LQFA 5BWVA 2QRJA 4X6LA 1HG1A 2NU8A 5JBNA 1RYNA 2VNJA 3VV3A 3K0EA 2VHJA 4JBLA 2IP4A 3NBUA 1NGSA 1XQVA 1Z73A 4FYJA 1VA5A 1VFPA 3RG8A 4KR0A 1X2EA 4M0PA 3GGOA 1PEDA 4YCJA 4CKCA 4OREX 3G1WA 3R3YA 4ZOAA 4R1OA 4BDSA 3U7FB 3O8RA 1G3MA 3CN9A 4DC9A 4WMLA 1A27A 2BWJA 4NOLA 4CN9A 1U7WA 1JMYA 4WK6A 3KSDO 4M1TA 3EPRA 3TRHA 2HSEA 3BGOS 4JNKA 2EX0A 2ZWIA 4DIOA 4IDEA 1FMFA 2GO1A 3MCAA 3UCEA 1KH3A 1Z5GA 3NDIA 1MCZA 2W6JD 1KHHA 3ITKA 4JJFA 5DMXA 3U4IA 3SQMA 3UT5B 2GK6A 4E94A 3GFTA 1Y33E 4I4TF 5DNUA 4NI5A 3ZWVA 3G6WA 1D1QA 4TXLA 2AHRA 1Z4JA 2Y1FA 1PFVA 1TD1A 5FJIA 5BR8B 1P17A 3OLXA 2YJNA 3EA0A 3Q8MA 3EB9A 3D4IA 3ZQJA 5B1YA 3GEIA 4A8JB 4L1KA 3ZHSA 3E7DA 5EEGA 1RJWA 4PZ8A 3WHPA 4HGRA 4DUGA 3IJ5A 2BZ0A 1NPYA 4WV3A 1O8BA 1OGIA 3A6JA 3GVPA 3I30X 3PHGA 4YRBA 5L3QB 2FMKA 1DAEA 4EUNA 2DHRA 1TMKA 4LC9A 4YRCA 2FQ1A 5K8LA 5C1BA 2VTDA 3REQB 3T35A 1PU2A 3BERA 5ALJA 2I3DA 1HUQA 1H8HA 5B1SA 4Q34A 3W5DA 3R4VA 2PQ2A 4DCCA 1N6IA 1NE2A 2WSBA 3L0OA 3DOFA 3B3QA 3WLMA 3E84A 3N2EA 2AF4C 2ODAA 2XF8A 1J0CA 3G7NA 3D0KA 4ZCPA 4QTYA 2O06A 4AN4A 4BV3A 4DR3B 3L6RA 3WG9A 5T7BA 1OR8A 1ZIXA 3K6SB 1MC4A 3BSYA 4BQQA 4KQIA 3LUDA 3BRSA 2FNAA 2C2GA 2R1VA 2ZR0A 3DTYA 1X7YA 1B93A 3KDSE 4OI4A 4YV1A 4LF9B 4V39A 4I5DA 3L40A 3VKFA 2AN5A 4OXXA 5CB4B 4OIMA 2VRBA 4Z3KA 4LW8A 3SFTA 4BS9A 1P31A 2JA1A 4ABTA 3U9TA 4H9GA 2LZ0A 1A50B 3OPYB 3VPGA 3R8FA 2KS6A 5FTMA 1JG4A 3R7FA 1Z0ZA 2J67A 3LDUA 3W3AD 5BMVF 2JIZD 3G2NA 1Z28A 1E3IA 1YOBA 1QV6A 3E8SA 1YK0A 1XZIA 4OQMA 4QPJC 4CFSA 2XMCA 2RBGA 3GW8A 2AR7A 1Z4IA 3ZDBA 4KXYA 4C0LA 3N8NA 4G2NA 3IH5A 3OT1A 4C78A 4FB4A 5JIBA 3I5YA 1YL7A 3M89A 4DILA 1OB5A 2O2GA 2HXSA 4WKGA 1ZD8A 2QN7A 3H9CA 4XQ9A 5EMJA 3T7TA 5LQAA 2R85A 1RM0A 1NBAA 2NX2A 4WHXA 3MSXA 5AKLA 3Q1KA 3ELDA 3P0HA 4EO9A 4GLFA 2JJ8A 4KQCA 4NE9A 5HJ5A 3LFTA 3OF2A 3IP3A 5BW6B 5M3BA 1XE3A 3KSRA 3QLUC 1X13A 2FDRA 1ND5A 5B3AA 5K8VA 3GU3A 4OQYA 4Q1CA 1RTTA 4WACA 3S2GA 2AQHA 4O25A 3QX9A 2QSYA 4D0GA 1TZ2A 4I50B 3STUA 3LQ1A 5ERXA 4IHQA 4D0NA 4DLBA 1PJZA 1M3SA 3SP1A 3U37A 4N5NA 1U0GA 4XW2A 3C87A 1FNBA 2AMJA 2A14A 3PDCA 1IY0A 3BPSA 1T2AA 3DZJA 3OCVA 4MKXA 5F76A 3RR2A 3S40A 1JBQA 3HMKA 2WHQA 1JSCA 3VHQA 4ZXPA 1FDRA 2JKVA 4EABA 4MMYB 3CB4A 2YZGA 1AKUA 4HXGA 1NJFA 5IAJA 3HWRA 3ZV4A 4YHHB 1IHDA 4CMIA 4Q3DA 3GJ7A 1EK5A 3R4CA 3B5JA 1WVMA 1B7GO 4F21A 3EEOA 3M1LA 3VR5H 2HMTA 4R2LA 4C6TA 3HUFA 1K1EA 3EE6A 4QXRA 5D3MA 4DSNA 5KU7A 4NULA 3K96A 2MSDB 4G07A 1SIWA 4HX9A 2YFYA 3ZDFA 3UYYA 2CL7X 4URXR 3ER8A 2HWYA 2WM8A 1XT6A 2Q0XA 3HY6A 4GYKA 2CYAA 3CLVA 4CT0A 1G38A 4CV0A 4B6PA 4OXKA 4K9PA 1DEKA 3ZWNA 1H05A 2CGEA 3H1BA 3BTOA 6GPBA 4HAIA 5TARA 1PTJC 3PWSA 3LKDA 2ONZA 4L22A 3RWBA 3TTXA 4C89A 3BRCA 3I2GA 4GF5A 5K3OA 4FMBB 1XKQA 2BI8A 5MDHA 3K5PA 7MDHA 4GR9A 1XB2A 2GAJA 3SJCA 2D1FA 2FEOA 2FQXA 3UT0A 1IVSA 2VDRB 4Y9SA 1AZSC 1FDVA 1WLSA 2B30A 3CLTD 3IP6A 2GMWA 5I7OA 2DVMA 2GLUA 2NADA 2WD7A 1USKA 2V0CA 1Q1NA 4MVYA 3H16A 4UZFA 4DKXA 5C9ZA 1W4CA 2M98A 3OZWA 1UDXA 3IRVA 1N92A 2E5FA 2BEKA 1F2VA 2HIMA 3UYLA 3ZE9A 5JXIA 5EA2A 4TTPA 2PMDA 4W6QA 5GP1A 3PXDA 2A84A 4ESHA 3UHFA 3JALA 4LDJA 1GM5A 1HQYE 1B8PA 1IWBB 3BAAA 1KORA 1KQOA 1WUYA 3LPNA 4TKMA 1C1DB 3ESXA 3QY0A 1OU4A 3HGTA 3IQGX 5EZYB 3KVVA 1E0SA 4GL4A 3TL6A 5JY1A 1T0UA 2V59A 3TAUA 1WBBA 4GI7A 4D6YA 4EQZA 1HYHA 2QLJA 1QPGA 4B73A 3SI7A 1GPNA 4PQYA 4EGAA 5KNDD 3SM3A 4QG3A 1UQUA 4D9EA 1G3UA 3MMSA 4AJ4A 5BW4A 3IRUA 4R1UA 3RVPA 3VTKA 1E6MA 1XHLA 4HVLA 1RQ7A 3M8KA 4LI0A 1ST3A 4EYQA 3ASZA 3G2IA 2ISCA 4MUYA 1QU2A 1FFWA 1MB4A 2LRHA 1XJQA 3IUBA 2VPPA 1WXXA 2P0EA 3ODGA 4I9UA 2XCTB 1HDZA 1KSFX 4JBHA 4PO1A 1HDGO 2OSBA 5JZBA 4FIDA 2FYTA 1GPH1 1LVUA 1AF7A 1QVZA 2PT9A 2G28A 1G4UR 1ZRHA 3L7YA 2NMVA 3RBAA 3QVWA 1W5SA 2QR3A 1ZI6A 4K5QA 2R1ZA 1UK9A 1CV2A 2PD6A 3A6EA 4P1ZA 2HK8A 1WR2A 4C01A 1GPDG 2A4MA 4MUKA 1ZKMA 5JVLA 2Y9MB 2COUA 3DBRA 1BW9B 3C6MA 1STOA 3F6RA 3MSCA 1R0RE 4IUDS 4MRVA 2BE9A 4I5IA 3SK0A 1L5VA 1A2QA 1VZ3A 2NAFA 3H3FA 1M67A 3ITEA 4ML3A 4YJFA 1QYDA 3B8HA 4RHUA 1KOLA 3NBQA 3T1VA 1MC5A 3UWOA 4A2PA 4R71A 1R6UA 4ENPA 1VG9B 3W6PA 2FX3A 3KVRA 1XTZA 4RS4A 4D9NA 3LX8A 3T9DA 2XDQA 2JZCA 2MDTA 3DZCA 2H4ZA 1P81A 2JVKA 1N6LA 4BX3A 1GPMA 4QXAA 2F3UA 1SUSA 4GXQA 4X91A 2YJ3A 2CDNA 2R47A 5A9TA 5K4AA 3R9IA 4PW0A 4JBGA 1N57A 3OZBA 1PI3A 4WESA 5EJIA 3URMA 3K4HA 3AQIA 3EGDB 4IEEA 3MWLA 3TLZA 3I9LA 2DCUA 2ZBPA 4Y1EA 3WRWA 2EJWA 4OD0A 1N5LA 4B34A 1ENPA 3AR2A 1AE1A 1DRJA 2MHCA 3FZEA 3ME5A 4Y2JA 5BXYA 1W44A 3BHMA 3CB2A 3JQ8B 2GBGA 4AP6A 2OCKA 3VPFA 2OGZA 4RGBA 2VK2A 1CJTC 3QLUA 3IAM1 1KJQA 1Q0LA 1A5ZA 2IV7A 4MPTA 1LX7A 3MILA 3TLMA 4XARA 4EGSA 3STYA 4NEHB 1RKBA 1GTJ1 1YQTA 4CM3A 1GAQA 4BMYA 2AC7A 2YCBA 1LS6A 1SCNE 4L57A 1JA0A 1YULA 2I1LA 4JL8A 4E5UA 3QENA 3R8XA 1G291 2IHVA 4B87A 2DT8A 4GAEA 4YP7A 3UQZA 3DWEX 4XGRA 3GVIA 3ND8A 3WYCA 5I48A 3KJXA 3TZBA 3FFWA 3ER6A 3W05A 1DGQA 2ROQA 1N6OA 3PKJA 4IDDA 4M55A 3ENNA 4G9GA 3KYCB 3L04A 3LUAA 3FWKA 3HJRA 3NASA 4IXNA 5CURA 1FP4A 2FV8A 2NV6A 3EHDA 4F86A 3JQ6A 3H9QA 3MWYW 1NRXA 5K0LA 5T4HA 1UT5A 3OWXA 1TVEA 1H1DA 3AYXB 2O7RA 3LFUA 1J00A 2ZSEA 4CF6A 1T36B 1V9SA 3QA3E 1SZJG 3RYFA 3QXJA 3MOIA 1Z6GA 4DV0B 4ZMSA 2H4YA 3LKVA 5EKTA 2XB8A 1N1GA 4MKRA 5IC6A 2QRQA 3AB8A 3Q8KA 1XYYA 3E7PA 4HRXA 3RS2A 3OQBA 2RJOA 4WBNA 2J5XA 3C43A 1YD7A 1CNEA 1ZVJA 2LCIA 3Q7QA 4P9NA 4E7OA 1ZGGA 4NOJA 1AO0A 3PJRA 2QVLA 2XBLA 1DB3A 2PRIA 3IR6A 4HO1X 3LPMA 4TTQA 4OBWA 1ADYA 2H3EA 3IEXA 5ICSA 2ZBFA 4QGBA 3VSDA 4EG1A 2Z08A 1QPBA 2VDOB 1T26A 1TJ4A 2IXFA 4AO6A 5C7YA 1U8AA 3ONFA 5J5CA 1L7OA 1TCUA 2BBOA 1O5TA 4H4EA 4ER6A 1GV0A 5AVYA 5JNUA 1QZXA 3AERB 3D4NA 1R7RA 1XAJA 3GUCA 1JBEA 2H57A 3HV2A 3LCJA 3P2OA 3H97A 1O08A 3D2LA 4HZGA 1YTLA 2Q5JA 3DV0A 2CKMA 5IVPA 5AVOA 1YXMA 2F1RA 2H52A 4IF6A 5HIJA 2VJYA 4U9IS 4EHBA 3ORHA 4M8SA 4XJSA 3EWSA 5LXTA 1OLUA 3ZS9A 4XOIA 3Q3CA 5JQWA 3O74A 1X1EA 1K75A 4DBZA 4HP8A 1S2GA 2XSZA 4C5AA 4G63A 5IULC 1FSFA 2PZBA 4TT3A 2C7PA 3S1LA 1D4OA 4F6RB 5HMLA 4FQ7A 1P7YA 3IQZA 3UYKA 5I60A 4TVIA 1TJ3A 4C1BA 2V6MA 3O38A 2UUOA 1QTNA 4AO8A 5C8ZA 4CHIA 5DTMA 3BD7A 1Z4MA 3MTEA 4PBRA 4QDJA 2F8SA 2JGKA 4H1VA 2QGZA 3SZLA 4YMLA 4ZJZA 1XN4A 2VS1A 3R9XA 4OP3A 1NDQA 2H1CA 3A6ZA 1WG8A 4BO5A 5CG1A 1K7YA 1YJ8A 2WKPA 1GQ2A 1P4HA 1X39A 2AT1A 2WSIA 4ZYYA 1RPJA 3I2IA 3MMZA 1JJ7A 1SKAA 3C3KA 3L49A 4DLSA 1J0DA 2QYOA 4C7OA 3G89A 1QQ7A 3NXKA 4PC2A 4HAXA 5I8ZA 3EQ6A 2ORYA 4HQOA 1ILWA 4JUCA 3SC6A 3TBKA 4UHEA 3TUZC 3ESYA 1W93A 4FLFA 3G9XA 2NN3C 1LDNA 3M49A 4CBVA 3A06A 3V2HA 2O0HA 4AURA 3NWJA 4YJKA 5A4IS 3LECA 4CE6A 3LBNA 3PC6A 5AW5A 4TM5A 4LZOA 3FDZB 1AF4A 3W2GA 3RIGA 3GGGA 3RSGA 3E9QA 2H07A 4KE6A 3N59A 3WIEA 4EMUA 5CM0A 1XF9A 2P0AA 4ALLA 4MRAA 2DBZA 5IUNC 2XCQA 5F2OA 2DABA 3WJ2A 3DW3X 1QRAA 4Z53A 3T0FA 4KWEA 2R25B 3UKDA 2FWRA 1EFPB 4JASB 2Q28A 2O7NA 1XCMA 1I6WA 3PPVA 4C3OB 3N0TA 3RQSA 1J9GA 3K71B 1GTMA 2GUWA 2FUG6 3WLTA 2O2ZA 4DCPA 3DP7A 3GRPA 3ETLA 3U7IA 2R9VA 3RC7A 4M8IA 1PYDA 4HDNB 2RHRA 3RC2A 3TUIC 1LW6E 4RPKA 3WMXA 4XVUA 1AHPA 2O1EA 4TYNA 4JI4B 5D01A 2X9LA 1EKXA 2I7CA 2ZJBA 2PCLA 4UBJA 1Y0BA 5IWCA 3E5NA 4KU4A 4FZ3A 2AI3A 4BQSA 4UCSA 3M4XA 1UMDB 4NBKA 4IDAA 1CB0A 4IHJF 4G86A 2XUFA 4PAQA 1E5LA 4ED9A 2O07A 4X94A 1GWNA 2WM9B 3LP6A 4LV5B 1D9ZA 4PAOA 4BVHA 4KAAA 3EGIA 5A71A 4BQRA 3CH7A 4OKNA 3U3OA 1WPGA 4BVLA 4MWTA 2ZXFA 4ZAWA 1G60A 3TN7A 3SXUA 3BXGA 1DX9A 4O4IB 2XITA 4EG8A 4MYUA 5SYAA 3LWDA 3AINA 4CETA 3IP5A 2IJGX 3EZGA 2C4KA 1SQGA 2I71A 3D6FA 5JH7B 4G36A 2G09A 4A4DA 2EP8A 1UQTA 4ZICA 1LQTA 2QUKA 4Z8XA 3T38A 1DXOA 1FL9A 3SZOA 3VC7A 3U7GA 5HKKA 3JYNA 1H69A 3O4FA 2HU7A 2QRVB 1OXMA 1JYFA 2REOA 2XQGA 4LYGA 3WRXC 5LMNB 4Y6GB 4UBLA 4W63A 5G3YA 4OQFA 2ZVJA 4TKVA 3D9QX 1G2WA 3T95A 1R5NA 1T4CA 3UATA 5CLFA 3QV2A 5TMPA 1SXJE 2F8MA 4EMBA 4P22A 2ZS9A 1DHTA 3UAGA 1N7JA 1DO2A 4Z3DA 3TIXB 5HFJA 4FFRA 4R8MA 1E1QA 3AB7A 2GOYA 3KEGA 3QF4B 3ZLBA 3I73A 5K0JA 2SCUB 4KXFB 1JG1A 2XUGA 3ZCXA 1FXWA 2QM7A 1QVRA 2XYQA 3LYAA 4JLNA 1G1MA 2NTYC 4GZLA 5IJAA 2V1XA 2O0JA 4ZZ1A 3MJSA 1NLFA 1NVEA 3U81A 3EOBI 2I22A 1GYQA 1JKXA 2Y4OA 3BJMA 2FN3A 3PR2B 2RG7A 1M6WA 1VXOA 1PGJA 2JFZA 5CTAA 3DM5A 3HN6A 4UHFA 2CNDA 2B1IA 1D4ZA 2IYOA 1OGJA 2ONJA 4IDOA 2EF1A 4FGJA 5HQ3B 4XD7D 1IEQA 3QJGA 1JLHA 1PJAA 5ALFA 2ZU0C 2VF8A 4H6VA 3I62A 4RQBA 3KR1A 5BN5A 1BE0A 3I12A 1E2EA 3OU6A 3ZDQA 2HQOA 5ALOA 4FS8A 3TJRA 4ZYZA 5TPZA 5KHLB 3ENKA 2Q5IA 3W6OA 4O81A 4JFAA 4U02A 5DNWA 4M87A 1E61A 1BO6A 2DFPA 2VSYA 3KEOA 1IM2A 1PVVA 1FFGA 3B78A 4RACA 1OWNA 3FZYA 1Y81A 4PSKA 4Z49A 1C9NA 2G25A 4HDKB 1JFSA 3JTEA 4BLQA 1ND6A 5KQSA 4TTTS 1MGOA 5AHWA 3NOVA 1JH8A 2YINC 4TWZA 3AUJB 3C7KA 2DSNA 1PT5A 4YBZB 1CDEA 5EIXA 3CLTC 5EJMA 2Z43A 4EVRA 3I32A 2HA4A 2D7DA 5DYYA 3HU2A 4BPBA 3G13A 3IS3A 3MUOA 5AW9A 1Q84A 4QUHA 2PS9A 2ZVDA 1P4JA 1S8AA 4PZZA 1QYIA 4I8DA 3M6MD 3QOWA 3U4MA 1B6SA 3PNMA 2V3VA 1I5RA 3JVEA 1QHHB 1Z2OX 1N2XA 1NU8A 1KDPA 3LSTA 4TMKA 5DK4A 4A6DA 5A03A 2P5TB 1AMUA 2B4YA 3L01A 4YDRA 2GLTA 1RI4A 4JJZA 1BWPA 4K81B 4TV9B 4P35A 4FBLA 2QAJA 3OJEA 3UOGA 2FW1A 4EECA 1RJDA 2BGJA 2D1TA 4JP1A 4ZQBA 1XKTA 2WC1A 2GKGA 1NLZA 4P08A 3HKBA 3HRIA 4XCVA 3ZOKA 1JNXX 1TUGA 4BRUA 1K3TA 2I29A 2A0UA 4IMIB 3EIUA 3IMGA 1REQB 3JQDA 4Y8VA 4EJ2A 1T5LA 2YV3A 2QTVB 3HKEA 4UUBA 2QX6A 2P6RA 5AKHA 4TWBA 1W76A 1HFWA 4ZGGA 3BBPA 1II0A 1LU9A 1NIPA 2IXEA 2PAAA 5H80A 1Z0SA 2AI1A 1W96A 3KUCA 4YB8A 1Y8ZA 2QWXA 4XVQA 1DXQA 4NV0A 4X54A 1QIDA 5COAA 2FUKA 2P6MA 2FEPA 4D43A 3BFJA 1XFAA 2P65A 1JQEA 2PKEA 1E2QA 4B35A 2ZRJA 2EKZA 2WAYA 2B4KA 4ZAZA 3WICA 5HE8A 3K0AB 4P0TA 3M5WA 4IJQA 5I9NA 1R8YA 2WT8A 2NZ8A 2X4DA 2WYUA 5HX7A 5TF0A 3QVUA 4I1YA 1F5SA 5AVZA 2WJ6A 3U49A 3E61A 5LZ4A 2DXIA 1I4WA 3AESB 2FPPB 5FTWA 2OK7A 4QQFA 2R62A 3BJRA 5B7QA 3BM5A 2H0QA 5B58T 4WKNA 4G3XA 4MUBA 1CR0A 4DXAA 4M83A 3WR5A 3ONEA 4MVJI 1NM5C 4LXXA 5DI3A 2OFFA 2ZOSA 4LVUA 3LHDA 4AN0A 2B5OA 1LLFA 4JLMA 3WYAA 4Q39A 1KEPA 3ZQUA 3SS9X 1DKLA 3GYBA 4B48A 3CSSA 1X2BA 2QJOA 1Y7PA 4K9OA 2R8XA 3G0DA 3QJYA 3KM0A 3DKPA 1Z74A 4H6WA 3LX6A 4M36A 4OGWA 1IU9A 4RANA 4PN3A 1CY6A 2AJDA 2I6XA 3OIFA 1IPEA 3A04A 4PSDA 5I9TA 4A8JC 4BX9A 1PT9A 4BC0A 1TJPB 2P8SA 5F4ZA 4DDHA 2J5BA 2I3BA 3PIRA 2ZAGA 4BTEA 2J09A 3CKLA 1UXOA 2XX3A 2AGVA 3L84A 1O6ZA 5K6RA 3P0JA 2VK4A 5F9FA 1A3CA 3L0YA 2OXCA 2O2HA 4QDOA 4FQ8A 4OXYA 2PA0A 2PS3A 2ZYRA 1NUTA 4MDFA 1AIPA 1GPUA 2WILA 3C3BA 5EN4A 2HLDD 4OLHA 2XNDD 1G9SA 2A9VA 2B21A 2Y9PB 1E2LA 2XTMA 3G1UA 1YS7A 3HBAA 2ZYTX 3DPUA 4R7ZA 1MTZA 3W1BA 2ZSKA 3SIPA 2HHLA 3WKDA 4A27A 3ZZTA 4F7DA 3TEKA 4HWOA 2HNAA 3C3CA 3QNWA 1S9DA 3ZX4A 3IP1A 3CJQA 4J2HA 2BTQA 2SNIE 4ZK2A 4U2DA 3QFRA 2PWZA 1OXSC 4RMIA 1OH6A 4M9ZA 2VK1A 3KYJB 4RH1A 1A4XA 1U7OA 1JQ3A 1TVKA 2V5VA 2XMGA 3CRNA 4HADA 1SXQA 3ZWXA 1T3TA 2QTWB 2R5WA 3PNKA 5KYVA 5GJVC 2CLLB 2EQAA 3KQTA 1SXPA 3NBYB 2G7MC 3WGOA 3EIQA 1X7XA 1RU3A 1W25A 1TRHA 1HNZB 1SKUA 1NR5A 3AU8A 4BMCA 3N8KA 3AJEA 1Z6TA 2ZLBA 3BWBA 1ZLYA 1PJCA 3NG1A 1CQWA 3AJRA 3EGOA 3CUYA 5AI9A 5IH7A 4E6NA 1BJTA 2BTOA 1N6KA 3OIGA 1Z7YA 5J2UB 1I4EB 5IEJA 2O2IA 2QROA 3P1JA 1VBNA 2R3SA 2NZYA 4I50F 4OYYA 3I9JA 4MS4A 1YMUA 5ES3A 3ZX5A 4ERNA 4FWBA 1KVUA 4MCAA 2O54A 1ONPA 3RG2A 2YHIB 3H2ZA 2X2OA 1I3KA 3D6VA 4BKRA 9ATCA 3DO8A 5LJLA 4IILA 1BHSA 3W6UA 1MC1A 3GUZA 3VMFA 1F48A 3RDPA 3RBVA 3DZFA 3RIHA 3JASA 2C2BA 4FILA 4I2NA 1Y3HA 2BZ1A 3RS7A 3GLHE 1I5OA 1ZOOA 1LA2A 4YAOA 1IN5A 3FVTA 2X8JB 4HEQA 1KZ9A 3HR4A 3NCTA 1YIOA 4EH1A 1RZRA 5F1KA 1ESEA 2VNHA 4L02A 5AJZA 3SHQA 3KJNA 2CE2X 3MT9A 3FTDA 4GMHA 3FFTA 5TPWA 3W5BA 1UP4A 1C3VA 5DW0A 3JD3A 4IHKA 4LXQA 3P96A 4HH4A 3M3HA 3OPQA 3UGJA 2Y93A 5TVKA 2R48A 3HS3A 5E2IA 1AQYA 1BEUB 4KNYA 4Z1MD 2JDIA 2Z1NA 3FHLA 1VRCA 2WABA 4MWGA 5BV8A 4ETWA 2W22A 1I1QB 1EVKA 2W6CX 3GJ0A 3MB5A 2AJ8A 3NRCA 4UBKA 4HEHA 4HN2A 6CHYA 1FJXA 3KWMA 1P19A 1TM2A 3F3YA 5CXQA 1SULA 1C30B 2YYSA 5GV8A 3ZXIA 3LKBA 2HA3A 4H60A 4P84A 2QKYA 4J3JA 4YMGA 4JOCA 4DB4A 1VMEA 4B6JA 2R1TA 1V71A 4D9GA 4HAZA 4Q66C 3VUEA 3WQQA 4EAQA 1UOPA 2XXBA 5CYFA 1DAGA 1N5DA 3MEQA 5SY4A 5ELLA 2B37A 4B3GA 3KT0A 3PCRB 4HQFA 1YWGO 2JI9A 2P68A 4J4TA 4ZIRA 5EZYF 4P31A 1M0EA 1VE6A 1V8PA 3ZC3A 3PLAE 4P92A 2LKCA 3M9WA 2OM6A 1ACMA 1I1LA 2W6MA 1QCZA 5E6RA 1ZHOA 3CPJB 1PTKA 4WL0A 4Y6OA 1A9PA 2XQJA 1H1LB 5F5LA 3JTMA 4F5ZA 1SQ6A 4LRTB 3U09A 2GHTA 2JCGA 4EAAA 1PL6A 1PP4A 2BGRA 2Q62A 2EKLA 1TYCA 2UZIR 3LP8A 3LVBA 3KZMA 1AJEA 5KHAA 1AQUA 1YGYA 5EJEA 1A8QA 3BH7A 3CEAA 3BQMB 2LCFA 4Y67A 1KPGA 5LZ8A 1NM5A 1X7WB 2C92A 2PVSA 5GGXA 4A03A 3ZD7A 4OLBA 4NJMA 1LJUA 5M04A 2LWIA 1P7WA 1J6UA 3KZCA 4KQMA 3W77A 4BNIA 5GOTA 1XCGB 2WFLA 3GRKA 3VO8A 1ZOSA 2R87A 2XZDA 2XZTA 1ZS9A 4IQFA 4MQEA 3R7NA 3RK1A 3TR0A 1JAZA 3P0RA 4EWLA 4WNCA 2ZB4A 4J0IA 4ZKDA 4NR0A 2BP7B 4XLLA 4A8JA 4EA8A 3ESCA 4XR9A 3WFZA 5IUJC 3DLHA 1M2JA 1V7ZA 1OVGA 4FR5A 1G20B 4ZTBA 5BN1A 4HVAA 3VNVA 3RWOA 1WZUA 2W8BA 4O33A 1W7AA 4DR5B 4JLKA 4J7XA 3GRFA 3Q5GA 3LGSA 2O5EA 2IWRA 2ZIGA 2QHXA 5C37A 1Y3BE 2IXDA 4D4MA 3HKCA 2P6OA 3QFCA 1EK6A 1GFWA 4FN5A 1PJSA 1C4OA 1W5TA 1W88B 4LWZA 4MKIA 1K5HA 1Y8RA 3ANLA 2VPQA 1DARA 1HSZA 2QMEA 2Z6UA 3GEPA 2AH5A 3L0DA 2VQFB 3U16A 2M6RA 4JWTA 2V6JA 1PT6A 5E0KB 4EGJA 3TVYA 4YDSA 4B09A 2FPXA 4HQRA 4OHVA 3KQPA 2WYVA 3F4BA 2NXJA 2D5IA 5AVTA 2CNWD 4ND7A 1YC2A 4JB2A 2HH9A 4RCVA 3RROA 2XUAA 3V4OA 2FAXA 2O3QA 2J0EA 3P2YA 4W5QA 3LC2O 4WGGA 3HB9A 4Y18A 2JFBA 3VNQA 3R0XA 2X22A 3IO3A 1RWKA 1RE0A 4QG7A 1FFHA 3G5AA 1P0MA 4OA8A 4YYEA 1CP3A 2OBBA 1Q0TA 1O6GA 3SD7A 4AAYA 2PGJA 1IB6A 2JJQA 3RCBA 1AKWA 2Y3IA 3LIIA 1UJCA 3M34A 4A8TA 2OHFA 1KS2A 1EE9A 4IJMA 2W42A 4GH5A 4FINA 3AM4A 1Z0IA 1TLLA 3I2YX 3I4FA 1DI0A 1JVSA 2VRCA 1CS0A 1BAPA 4I36A 3GEMA 3D4PA 1IEWA 2QD1A 1SJ9A 3JW8A 3Q9UA 4DT1A 3MJEA 1NNUA 4M7OA 1RRGA 3IAXA 3CIFA 1J8DA 4Z54A 2EIHA 3PGA1 1EWKA 5EXDA 2V58A 4CVNA 3DBHA 5T8KC 2FETA 2DC1A 3Q7TA 3VYSB 1II8A 1QHYA 4TT8A 1R4NB 3DOIA 1U65A 1CZNA 4O82A 4NJEB 4WTOA 1DOHA 4DIFA 3OEYA 4UE6A 2B83A 4EUKA 3HDTA 4KYTA 5JD3A 3T1HB 2X4IA 4A0GA 2E9SA 1BCSA 1SZCA 2HD4A 2ZQZA 1HX7A 2F90A 4EYOA 2XNKA 3U3JA 1SD1A 1PSDA 1XIVA 1IBCA 4JDPA 2VN8A 4JUFA 2OLKA 2HU5A 3WTCA 1LQUA 4YJ2F 1AHHA 3HCNA 4WNAA 5E9WA 3H5IA 5CFPA 2YNMD 2R7NA 1VRWA 4LECA 2XMDA 4OMUA 4QOEA 1RLUA 3ZJUA 3L8GA 5GTDA 4FX5A 4RNCA 4F4HA 3MCWA 4F93B 1UK7A 1BX1A 4PE5B 4CGYA 1MZPA 3JZDA 2ZJZA 3L1IA 3NHJA 1OF1A 4B17A 5JS7A 4BYGA 2QB5A 1QH1A 3EA4A 4HEA1 4DCOA 1N2HA 1SXHA 2DQZA 1OKKD 5LDDC 3RGGA 1Z2DA 3WXBA 1HT2E 2FP4A 3H87A 2AI2A 5KVVA 2VT7A 2VJMB 5LLTA 3GQBB 2OHHA 2VZLA 3BRWA 5FWAA 3CCFA 3TKLA 4C0SA 1FBTA 2MSCB 1F0YA 3BTUA 3EYWA 3SHFA 3TFWA 3ZQKA 4NBSA 4DLTA 5KYYA 2AEFA 3DO5A 5DJ5A 1FTSA 2OAP1 1AOXA 4LRUA 2X77A 4CEHB 2J08A 3N76A 3FF1A 4B71A 2EFCB 2LD4A 1V7PC 2FEXA 1U1GA 3ZWPA 3T9BA 4FKZA 1Z9BA 8AT1A 1L7DA 1EK0A 3LU1A 1V1RB 3U26A 4PV7A 3BIXA 5FLXA 2PXXA 3GXBA 1DAOA 5JDIA 3K53A 2P62A 1R66A 2Y66A 1A97A 1QYXA 3RSHA 3CZ4A 1T5OA 4Z0NA 1DQZA 2BM0A 2P2ZA 1C1YA 5DTEA 1TT5A 2I7TA 3W2TA 3ZU3A 4JYZA 2AXPA 2QJFA 3K2EA 2KQUA 3D6UA 4LS3A 1XTRA 3D8TA 4WKOA 5E3HA 4BKPA 3CLSD 1M54A 5K2OA 3WK8A 3TZCA 4YLYA 4L15A 4D9FA 4IQ8A 1VMIA 4O84A 3A2MA 3H84A 1DV2A 3PE3A 3STTA 3ZGYA 3WGUA 4HN9A 4AWBA 2UYGA 3KSZO 4DIMA 2ZAYA 3I9V1 4QEZA 3NZEA 4CDNA 2ACKA 2BFDA 2V54A 5KDLA 3HBLA 4BDTA 5CE8A 2YMMA 3DOJA 3GWGA 2OFWA 4LSGA 2J4FA 4TRMA 1J8YF 3DLCA 4Y9TA 3EW9A 2MSEB 2QNIA 2G0NA 1O5IA 4AD8A 1LC3A 4NOKA 1AUOA 3T99A 3U62A 1ST2A 1E7SA 3AT1A 1VKOA 4KB5A 5AWFC 5A3RA 2HOQA