4FFMA

Pylc in complex with l-lysine-ne-d-ornithine (cocrystallized with l-lysine-ne-d-ornithine)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
363
structure length
344
Chain Sequence
MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKARIIYGLEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVLKERFGAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase/product
molecule keywords PylC
total genus 112
structure length 344
sequence length 363
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ffmA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ffmA01
1F06A 4IDFA 2SCUB 4A26A 1YONA 4DPMA 5BSGA 5KJFA 4A27A 1B3RA 1I3NA 1GSAA 4TMFA 3Q9UA 1M6WA 3JQ9C 3BMOA 1TLTA 2X6TA 1PS0A 2DBQA 4BO0A 3C1OA 1Q7BA 4NZ9A 4MP6A 4GKBA 1HDRA 1MV8A 3PPIA 1TA4A 3QWIA 4QFCA 5CEEA 1V3VA 1DDOA 4ALNA 1Q0HA 2WSBA 5BNFA 3WR5A 4FFRA 2VR1A 1BXZA 4B79A 4L4XA 4OXKA 1O94A 1Y9AA 1KERA 3LQFA 2PVPA 3LC2O 5H82A 1ZEMA 1ZNQO 1UAYA 4FBGA 4WLNA 2CD9A 2VWGA 5TSDA 3O8QB 4I5FA 1MX3A 4DIBA 4EBFA 3K3PA 2Z04A 1WVGA 5I7EA 1VC2A 4YACA 3DWFA 1DIKA 1A9YA 4CMAA 4YB8B 3U5TA 3VPCA 1OBDA 2CZGA 1SBYA 3IJRA 1QKIA 3I9LA 3PYLA 3C8MA 1RM0A 1QSGA 1NVTA 1QYWA 3IKVA 3L6OO 2BFMA 1ML3A 2JL1A 4PLGA 4BQRA 1EBUA 2GPSA 4PRLA 4MIYA 3OQ1A 3JD0A 2I3GA 3VPBA 3R1IA 1U28A 3MJCA 1I3LA 1IUKA 3K2BA 4GX2A 4XR4A 3ZNOA 1IHYA 4L76A 5F5NA 3DB2A 1HDZA 3PHLA 1N7HA 4BKPA 3KM0A 4RPJA 2J5RA 5COBA 4HR7A 3ZV5A 4K1LA 4DIMA 3VC7A 1WNTA 2NVUA 4GLLA 3ZV6A 4YQZA 4BNJA 5EQFA 1CS0A 4XD2A 3KREA 2X22A 4HNGA 4DBVO 1E7QA 3KLPX 3OEYA 5JVLA 1P31A 4R54A 1LRJA 3NT5A 3FRJA 1DHTA 3DOCA 4EZBA 2W71A 3A1NA 2CNBA 4MDHA 1E7RA 1ADGA 3HDHA 3BYZA 3F4BA 3HN7A 1TVEA 2QZZA 1T2CA 4ND3A 3UHAA 2E49A 4Z9YA 4WLVA 1SCUA 1E3WB 4CR8A 2NVBA 2P68A 1DIGA 4CM7A 4RPHA 1T26A 2QRLA 4O4HF 4O7YA 4H7PA 3PHJA 2HMTA 4RVUA 1J49A 2FSVA 1C3VA 4PLYA 1GU7A 4AICA 1YDEA 2H6EA 2BGMA 4CM5A 5C3MA 5C1OA 4YWJA 4YAKA 4IXWA 4XR9A 4WEQA 1NFRA 3AM3A 1AHIA 2Q45A 2OUIA 1VKOA 3FR8A 1PL8A 3JD4A 3DHYA 3F46A 3WGQA 1LTHR 1R66A 5KKAA 1F8GA 1MB4A 2GF2A 3DR3A 2Q99A 1MUUA 2B69A 4S1VA 4WOKA 3E9MA 4FQ8A 3FHLA 3PYXA 4E2WA 5JC1A 2DU8A 1UDBA 2DTEA 5A5FA 5LDGA 2Y1GA 4NHEA 5C5IA 3AI1A 3FNHA 4JX8A 3EAGA 5KKNB 4PLCA 1EYZA 5JFOA 3GNSA 1PJQA 2SCUA 1B8VA 3RBVA 3OIGA 1JKIA 1XA0A 1H94A 3BMOB 4YJHA 4MIEA 5ILOA 1JLLB 4JP2A 1YOVB 3EZYA 4CMCA 2W6NA 1BDBA 3VKUA 2HMSA 4XWYA 4OIMA 5CAEA 1HL3A 1E3JA 2X23A 3ZHZA 1NHWA 2IDZA 4BNXA 3WQRA 1E1NA 3VDQA 8ADHA 1DEHA 1HSZA 1NFFA 1E1KA 2JJYA 3G3EA 1WXDA 3E5MA 2VHVA 2FN7A 2VQ3A 1E3SA 2JHFA 3DTTA 4XX0A 1XR3A 1Y7TA 4ZQFA 3KUXA 3LK7A 3FCOA 4N54A 2FR0A 2JAPA 2O3UA 4AJHA 3TOZA 3R5XA 4M87A 4ZVVA 1MFZA 1Y8QB 1WPQA 3MCVA 2AG5A 2Y1DA 1MXHA 2WWRA 4IQ8A 3AWDA 1KVUA 1Z82A 5C8YF 1PQPA 2AW5A 3W1VA 4AJ2A 3U3XA 1EHIA 2CVZA 1LDBA 2GN8A 4IBOA 4DQUA 1DRVA 2V6BA 3VH3A 3F9IA 5IZCA 1ZW1A 3ADOA 1FDUA 2YFHA 4JROA 3K96A 1KJQA 1HDOA 4LK3A 4E5NA 1ADFA 1E77A 4EJMA 3AU8A 2JFHA 2P0AA 4RZHA 3W4KA 4ALLA 2UYYA 3E48A 4TKMA 3EDMA 2PZMA 3SLKA 3TL3A 3TIGA 1XU9A 4IIVA 1I2BA 1LEHA 2FPIA 1EVZA 4G5HA 2I9PA 2DAPA 4FC7A 5LC1A 1A7KA 1YRLA 2JCXA 4FB5A 4FFPA 4OQYA 1ZBQA 3AUSA 1ZH8A 4Y6PA 4WJZA 1HRDA 4A5OA 3IJPA 5FI3A 4AJLA 4FJ2A 2DUUA 4YJFA 3W8EA 1VSVA 1M0TA 3AK4A 3HUDA 3VDRA 3ETDA 1ISHA 2ZATA 3SJUA 4XJSA 2GN4A 1KIFA 4HNVA 3GDGA 2I3AA 5KKCA 3JQGB 3S2IA 4XB1A 5TF4A 3KSDO 4MV4A 5A9RA 3DAGA 2QYSA 5TNXA 4FFNA 3DBHA 1W96A 2NUAA 3DMTA 3RBZA 1U9JA 3VOSA 3NJ8A 1EFLA 4NIMA 2NADA 4C5CA 2GR9A 2EKPA 3QLJA 2C54A 1HETA 2OMEA 4MV1A 4D44A 2H1SA 5LOVF 1T4DA 2C59A 1QV6A 4RJTA 3PJDA 3CMMA 1X7HA 3P7MA 5G4KA 4R41A 1U3TA 4ALIA 4IGEA 5LDHA 1GQ2A 1DRUA 3ANNA 4CLDA 4O84A 5L3ZA 5T64A 2HJSA 2AQ8A 3IQDB 3I12A 3UCXA 3WMXA 1YDWA 1CQJB 2A92A 2HCTA 4EGJA 1QRRA 4Z6KA 1YQGA 1ID1A 1A4UA 2V6MA 1I36A 4PZCA 4CM4B 1YL6A 2NLOA 2OZPA 2GUGA 3KV3O 4HFRA 1I0ZA 4BB5A 4RF4A 5T8KC 4IINA 1OC4A 2QW8A 3GRKA 4LCEA 5LCXA 3C3XA 1N8KA 4Q39A 5DBGA 2FR8A 3PWKA 5JSFA 3OMLA 1NVMB 2PGJA 4Q3EA 3Q2KA 8LDHA 2R00A 3NUGA 1B3BA 2P91A 3C7CB 3PDUA 2HMVA 1ZK3A 3DF7A 1QYXA 4FU0A 3WYBA 1QV7A 1IY8A 2JHGA 4CQLA 2EKQA 3C7DB 2O2YA 4XGNA 4ZQBA 5HTOA 1KVRA 2A4KA 2TMDA 2JFFA 3GMSA 3ONEA 2Y1EA 3WGYA 1OC2A 3K5IA 2PZJA 2NSDA 4IGFA 2B37A 1K6IA 2FRDA 4JXKA 1PJSA 2VNAA 3OSUA 1ZIDA 4DGSA 5JBIA 1W73A 3VZRA 3TN7A 4BNTA 1AUPA 3WYEA 2V5AA 1E92A 3KXDA 2EJVA 2WMDA 4UEOA 4BMVA 1LLUA 5JQWA 4LW8A 1R15A 1YB5A 3DMTC 5IDXA 3VTZA 5A04A 5A3JA 1FDSA 1X7DA 4B8WA 5ITWA 2YRXA 3UXYA 4GX0A 5FEUA 1M6VA 4YAGA 2VTEA 5CEJA 2Q2VA 2VYVD 3I4FA 3LDHA 4O2AF 3H3JA 4PGFA 2PKQP 2OHXA 5F3RA 3TPCA 3AX6A 3LZ6A 3NDRA 1ZZEA 4XRRA 2AEFA 2FWMX 4WKGA 1NQ5A 5FYDA 4D43A 3UH1A 1OZAA 1ENZA 1PJ2A 2B36A 5L7TA 4ZD6A 1PGJA 2JD1A 2AG8A 4JBHA 4NU5A 3GEDA 2WE8A 4PN3A 1GZ4A 1DAPA 4O81A 5I7SA 3UF0A 4RPKA 3JQFC 4KMSA 3NT4A 1AUXA 1H6DA 3FD8A 4KDFA 4BQPA 3ETHA 3UKOA 4J2OA 5IFLA 2JD2A 5L7YA 4EI2A 2NU8B 1X14A 3KETA 4IDAA 3NTOA 3RD5A 3WICA 2CSUA 3WWYA 3E5RA 4OL9A 3FPLA 3PFFA 3R5HA 4ZQHA 1M75A 3SC6A 3DQPA 4WEOA 1UZNA 1RPNA 3KBOA 2HMWA 5JS6A 3VPSA 4DBZA 3UFXA 4HQ6A 1B16A 4QFDA 4B4VA 3KTDA 1P1HA 4J1QA 4MVJA 4YBZA 5TRTA 2XD4A 2NU9B 1I2CA 1LQTA 2UVDA 1EFKA 5DP1A 3H9GA 4FFMA 2RH8A 4I5DA 3L9WA 4HFJA 4P22A 5TC4A 4C5AA 3E82A 5G0VA 1LDMA 5TJ9A 4IS2A 4ID9A 5L40A 3PVZA 2GO1A 4MP8A 1UXGA 3GNTA 2C82A 4AJJA 4OO3A 5G0WA 3GVHA 3CIFA 2PZLA 2GQSA 3TRIA 1BXGB 4IUYA 5DCUA 5KVQA 4DLAA 4YAKB 3PGJA 4TRMA 3Q2OA 3MOIA 2Z95A 2Q3EA 2UV8A 4QEDA 3KZVA 2Y0DA 4AJ4A 4CM4A 2H63A 1VJTA 1JKJB 3IMFA 1P0CA 2NTJA 1I10A 3RBXA 3NGXA 2OP0A 3DBVO 3CINA 3ICPA 4MINA 5G4KB 4J0FA 3A06A 4J90A 5G0SA 2EG9A 3UVEA 4PLZA 5JAZA 3S2GA 3UCFA 3E03A 2Y0CA 3Q2IA 4QXMA 4R1TA 3N7UA 3Q6IA 1XEAA 3OH8A 2IZ1A 1NQOA 1ZJYA 4J1NA 3VH1A 3VZQA 2Q4BA 5A3VA 3ZHXA 3L77A 1GTMA 3D3WA 3QE3A 4E33A 3KO8A 3PLRA 1BRMA 1VKNA 4CR6A 2YZMA 1VJ1A 4TZTA 3ZNQA 1J5PA 4XYMB 2I67A 5ADHA 4R9RA 4HY3A 1NQAO 1PJ4A 2I87A 3KEQA 3U0BA 3K30A 1PZEA 2X0IA 3JQ6A 1W0CA 3GA0A 2YL2A 1M6HA 1OI7A 2GERA 3G1TA 4UUMA 1L7EA 4TRNA 5I8ZA 2WJPA 5JAMA 5ER6A 2Q1UA 4LRTB 4U0KA 3L07A 5CFZA 3VAZA 3ZWPA 3DHEA 4ZICA 1KEEA 5ICMA 1EZ4A 3RASA 4MV8A 3OHSX 1B0AA 2X0NA 1IOWA 1PGPA 1OAAA 1K6JA 2WYOA 1LA2A 5C1PA 3PEFA 4Z0TA 1XHLA 5A9TA 4D3FA 4WASA 2P4HX 1T2DA 2DQ4A 1ZUD1 4OYRA 3ZH2A 5GZ3A 3W6UA 1ZK2A 4R5HA 3IDSA 1W6UA 2HDHA 3B1FA 2P5YA 3JQ9A 4U6SA 1ZO8A 4WNIA 3QY9A 5AXAA 3JQDA 3AFNA 1A9ZA 1E7MA 1FDWA 2OP1A 4CMGA 2NU6B 2VN8A 2PWZA 2UUPA 1VJ0A 3ST7A 2O4CA 2YV1A 2GCGA 3GMDA 1HF3A 3I9KA 4KQWA 4LCJA 3ZN2A 4HKTA 1JKFA 2VUUA 2W8ZA 2OL4A 4TROA 4CM8B 1Q7CA 3O4RA 5L45A 2W6ZA 1Q0LA 3BA1A 3ADPA 3JQ8B 3FNFA 3RUFA 1IL0A 1PGNA 3OBBA 1GAEO 4RVDA 4CV3A 1EDOA 1ZK4A 3WS7A 2FPPB 4E32A 2FPIB 4EG0A 3CUKA 4IZIA 3RC2A 5CHEA 4BGVA 2CUKA 4ZRMA 1NASA 4GH5A 3CPSA 5C7LO 2J9GA 1R4NB 4BV8A 1Z45A 1XG5A 3QA9A 2JFGA 5AVOA 4U7WA 3JZIA 3PIIA 3H5RA 4MIOA 1N7GA 2FMUA 1PZFA 3W4JA 4B8ZA 2CNVA 1OFGA 3PP8A 1K6XA 3KHUA 4IJKA 1GPJA 2B5WA 1WWKA 2BI8A 3D64A 3RKRA 5EINA 4W7IA 3RU7A 1ZVMA 1Q2XA 3GUCA 1SOVA 3BTVA 4O4IF 4O4JF 3V2UA 3BMCA 1N92A 3H65A 4FGWA 4QTZA 1F17A 4R16A 4NBRA 2XPCA 3L6DA 4GGPA 3X2EA 1NXQA 1DLJA 1X1TA 2P9EA 1E1LA 1Y81A 3G0OA 5BT9A 5A02A 4KTTE 4P4NA 2O3SA 5T57A 4ME6A 5K6AC 4NK5A 4WE3A 3RV3A 4JJIA 1SB9A 3U54A 3AI3A 4D0SA 2B4TO 4CLHA 1IYZA 3UICA 4B3IA 3SEFA 4ZOLF 4RVFA 4R3NA 3GUYA 4RVGA 3ZZNA 3BMNA 4Q3AA 2BMAA 5KTKA 1KY4A 3UUWA 3GFGA 3PXXA 3INRA 1MXFA 4BO6A 4MV9A 2J5QA 4E2ZA 1K0UA 4N5MA 3F5SA 2C20A 3EUWA 3P2YA 3ZU3A 2GRAA 4O59O 5G4LA 1Z75A 2YUTA 2D2IA 4FFLA 3GVIA 1QLHA 2W2KA 4JP3A 4XZ3B 1XELA 5I9NA 1JLLA 1P1JA 4XYMA 4CMHA 3GAZA 2IODA 2AEMA 1U1IA 5TQVA 4DTIA 4UVEA 5HRUA 3VZPA 4TUYF 4HP8A 2PTGA 4RL6A 1C30A 3MJFA 3K5PA 2C0CA 3KLMX 4Q3NA 1KJ8A 5HM8A 4BNIA 3KYBA 5C37A 4M86A 4HNHA 4A2CA 4CMJA 5KCZA 1WZIA 4NNJA 4JQCA 1CJCA 4O7RA 5LYJF 3GPDG 1MLDA 4PVCA 5DZSA 3PJFA 7MDHA 1B7GO 1HYGA 3ANLA 1KJJA 2Y67A 2YY7A 3G8DA 3GN2A 4W7HA 1KJIA 2YS7A 4QSHA 1C1DA 1WDLA 3O38A 5ES3A 4D79A 2IYPA 1DIRA 5JY6A 1OOEA 3DO5A 2BD0A 3VOTA 2PD6A 1LJ8A 1ZEJA 1YBMA 5KJEA 3VH4A 3NKLA 4MKXA 3GGPA 1NAIA 5BSEA 2YZLA 3O9ZA 4JJGA 2C7VA 1TI7A 3GDFA 4N7RA 2VOEA 3ETGA 4ZA2A 3U4IA 3WBFA 1XYGA 2O3JA 1DBVO 1YB4A 5JDCA 4O86A 1PL7A 5FFFA 3SLGA 1B26A 2FPPA 3ULKA 3K8ZA 3ZWVA 4BNVA 5TS3A 4S3MA 4PLTA 2YHUA 1ULSA 1T2AA 2BGKA 2QIOA 1AUVA 1DV1A 1UZLA 3D0OA 2GPTA 1DIAA 1RJWA 1IPEA 4J49A 3A4VA 3KYCB 3R9RA 1GY8A 3AUTA 3G17A 4Y6SA 4F3YA 1QXSA 3U09A 1J0XO 2O3RA 3C1TA 5JCJD 1HXHA 3BMQA 1W93A 3OJEA 2ZYGA 5KJ6A 1R4MB 5JDIA 1GUYA 3PDJA 3CMCO 3GQVA 1DHRA 2V65A 1N5DA 2DZDA 4CLXA 3BMCB 4TRRA 2ZDQA 4IIJF 3MTGA 3BTUA 4DUPA 2DFVA 4A0SA 3K9QO 1PU2A 4JK3A 2CFCA 1GV0A 4IXTA 1LSUA 1Y8RB 4L4RA 4J6FA 3VHRA 1P9LA 3TWOA 1UXIA 3TF5A 1ZMOA 2EV9A 3JQAB 3ONDA 1SAYA 3FPCA 5BSHA 2CNUA 1LDNA 1P1RA 3F1LA 4PVDA 5H83A 3SXPA 3ZWMA 4RPGA 3KSZO 1EUCB 4WECA 1P44A 4HBGA 1YH3A 2CNQA 4YAJA 2WD7A 5DULA 5CDYA 2C00A 3U49A 4D0RA 2J3IA 2Q2WA 1E1MA 3R3SA 2HK8A 3U62A 1UR5A 3AOEC 3LYLA 3OUZA 2C5AA 3AW9A 4MVJI 3TZQA 3D4OA 3F47A 1ISFA 4FSHA 4OAQA 2R7KA 3DEYX 2J6IA 3AM4A 3JD3A 3HBLA 4MKZA 1LU9A 4JJFA 3K31A 3B6ZA 1LDEA 3V1TC 3N8DA 1HWYA 2RAFA 3CKYA 1ZJZA 1R0KA 4II3A 5EPOA 4L8VA 5C7IO 3ROQA 3QWFA 1B2LA 3WIEA 3ZWYA 3BIOA 3D3WB 3AOEA 3JQEA 4PIVA 5A1TA 4BMNA 1P3DA 2POQX 1GL3A 4CMIA 3WSVA 4I50F 1CE8A 4F6CA 5DBIA 3WFIA 3EY4A 3LSYA 3RWBA 5JQGF 2FR1A 2V59A 2B35A 2QG4A 5ITVA 4O7NA 1B6SA 3ZHYA 1X0VA 4D3DA 1M2WA 4U6QA 1ADCA 5IF3A 1P77A 2ILTA 1SO8A 3GLKA 3VMMA 1KBLA 4B7UA 1I8TA 2ZDGA 4Y9DA 5EN4A 5GMOA 4HUJA 1ENPA 3EMKA 3FN4A 4QSMA 3ANMA 4XX0B 1EUZA 3OIDA 4JGBA 3UGKA 2EKLA 1TEHA 3UOGA 1WDKA 4XJTA 3T4XA 4J4HA 1F0YA 4I55F 1RYDA 3CH6A 3TOXA 4B3JA 1ARZA 3TIIA 3EK2A 1VKZA 3GVXA 4OM8A 4CUZA 3HWRA 4ALKA 3WWZA 1E4EA 4FD3A 4YEDA 2DPHA 5IZ4A 1U2GA 4Y8VA 4O6VA 1JAYA 4YCAA 1I5RA 1JTVA 2YDXA 1KY5A 4G81A 4GQAA 4F6LA 2ZCVA 2H9IA 3BG5A 1C1DB 2EHDA 1GLVA 2O7QA 4Y67A 4Z9XA 5B37A 1GYPA 2PD3A 4O2BF 3JZFA 1DIBA 5DF1A 3ZU5A 1YB1A 4J3FA 4UULA 3WXBA 2X58A 1AN9A 4E4TA 1DFHA 4ROSA 2D5AA 2D8AA 1HE2A 3WJAA 2Q1WA 2CDCA 3C85A 3DZIA 4FC6A 4HX5A 2G0TA 4MO2A 4O7SA 1WP4A 4ZQGA 5DOZA 4XQCA 2W70A 2BH9A 4OSPA 2AQHA 1YE3A 2HSDA 3LT4A 1D4FA 2Y1OA 2BI7A 4PZEA 4ZGWA 3I9NA 4BNYA 2YRWA 1A27A 3HB9A 1NPYA 2O3QA 4GWGA 1R4NA 1ZMTA 3UCEA 1HE3A 3U4HA 3JYLA 4QUKA 1D1SA 1EQUA 3L0DA 2VZ9A 3D5QA 5L4NA 1BWSA 1H93A 1NYTA 3U55A 3BMQB 3GNQA 4KUGA 4J0EA 3D5TA 1GGOA 4CR7A 1EE2A 1YJ8A 5J2UF 2NV6A 4XGKA 2WE7A 3R23A 1BVRA 3DZHA 1PS9A 1X7GA 3TL2A 3E8XA 1J4AA 3JYPA 4JIGA 5B1YA 2NU9A 5JMPA 2VCYA 5HBRB 1O6ZA 1YXMA 4PG7A 2OLSA 3T4EA 3A14A 2D59A 3HFSA 1EDZA 4ND2A 1PEDA 5EESA 1LBEA 1JA9A 3IUPA 4NJOA 5L95A 3VTFA 4M1QA 3HO8A 3B1KA 3KYDA 3JQAA 1V8BA 4CMBA 3GR6A 2YZ7A 3PK0A 1H5QA 3MWEA 3FNEA 4BKRA 4QECA 1QYVA 4HADA 1EUDB 4O7TA 1EUCA 1NFQA 4AJOA 4AG3A 3W8DA 5DP2A 5CG1A 5JAIA 3MOGA 2WD7B 2W2LA 1YQXA 4DQXA 3BTSA 5HWSA 2WYVA 3GZ4A 2Y0EA 1LNQA 4J7XA 4WLEA 1ONPA 3OIFA 4I9HA 5BPHA 1O9BA 1R0SA 2X5KO 3HDYA 4J9UE 4R69A 5FF9A 3UW3A 5CA1F 3ORQA 1CIVA 2DT5A 3FI9A 2O23A 3PQEA 4IMPA 1M0WA 3DBLA 4WLOA 3WBBA 3RUAA 1CERA 1K3TA 4H16A 2EERA 1K2WA 2OGUA 3HN2A 4E2YA 5JO0A 1E6UA 5IDYA 1UH5A 4NR0A 4DA9A 4A10A 4IDCA 4XYBA 4CQLB 3T7EA 1YKFA 1XDWA 4BV9A 5IZCC 1HE5A 5KNLA 4CMIB 3GGOA 2AA3A 9LDTA 2R84A 1CETA 1DC5A 2VYNA 3QVOA 5ILGA 4CM1A 3NGLA 2VZ0A 1RM5A 2HU2A 4KDEA 2IXBA 1CQIB 3OJLA 1QMGA 1GQQA 4Y8VB 3EHEA 4Q3DA 5TJHA 5A03A 3CE6A 3WNVA 1A5ZA 4CM9D 5F1PA 4BKUA 1HE4A 2YQ5A 4OKNA 1U8FO 5BR7A 1DAOA 1NHGA 2WD8A 2DUWA 3L4BC 4PLFA 2E82A 1ISGA 2QQ5A 4R5MA 3S2FA 2NM0A 3B20A 4YQYA 5T5QA 1BHSA 2I65A 3WSWA 4BB6A 4IJWA 4J7CA 4J91A 4JN6B 4NBVA 1LC0A 3PQFA 3L6EA 1KJ9A 3GHYA 2WM3A 3WG9A 5T6BA 4CLRA 4NFSA 3DONA 3I3OA 3ORRA 2J3KA 3WB9A 3AFMA 4YDRA 1YJQA 2E4AA 2V6FA 3GT0A 1IOLA 2CVOA 4OQZA 2VHWA 5HS6A 5L51A 1LLDA 1YWGO 4XRGA 1O5IA 3GIDA 2W4QA 2X8LA 3TFOA 1A71A 4WOJA 4XGIA 5IXYA 3C1AA 3RFVA 2EGGA 4H15A 1NAHA 4ALMA 4PRKA 5K6AA 4O63O 1GEEA 2C7GA 4J1SA 1BW9A 4RV9A 4AJIA 3AUUA 3ZCXA 2C2XA 2QK4A 2Q49A 3DFZA 3N6RA 4UEJA 1JVSA 1KUTA 1YBAA 2BFPA 5CEFA 2VT2A 1UXHA 1V0JA 1YO6A 1GADO 3A9WA 1HSOA 1SCUB 3C24A 2NVWA 3H9QA 4O7WA 3DXFA 5JVDF 2NU7A 4EITA 1LQUA 4ND4A 2Q1TA 4OKIA 4KUEA 2IZZA 3KRTA 1LRLA 4CUKA 3HSKA 5IG2A 3VZSA 4ZHQF 1VL0A 5DN9A 1EVJA 4CODB 4FPXA 5KVCA 1HEUA 4QT0A 5BSFA 1T36A 4YTEA 4ZQIA 3ZU2A 5K9ZA 3B70A 3GZNB 1GYRA 3P2OA 1V6AA 2DIKA 2ZYDA 1AHHA 2DFDA 4KQXA 2R86A 2IRWA 4OXYA 3RUCA 4BGUA 1ONOA 1P1FA 4FR5A 5ER9A 2I76A 4XQGA 4U5QA 1HDGO 3EC7A 2FP4B 1IE3A 1UZMA 2CVQA 3ZU4A 2OORA 4NYEA 1QYCA 2HMUA 4K26A 4IQGA 3WIDA 2GQRA 1HZJA 3U9LA 1Z2OX 4CLOA 5A05A 2R2GA 4KUHA 2VHYA 5ICSA 5HS4A 1LSSA 3RCBA 2NQ8A 2YV2A 1UP4A 4BGEA 2IEBA 1LXCA 2VRBA 1XIVA 3AJRA 4HFNA 4D7AA 3K73O 2Z1NA 1VI2A 2XF8A 4YJHB 4LN1A 3G8CA 3R3JA 2HUNA 4CJXA 3ZWWA 4MVJF 2VHXA 4YRAA 4XYLA 1MG5A 4CQMB 4NFYA 4O1MA 4CL3A 4J16A 4DRYA 2GZ1A 5ENVA 5CAEB 3WLEA 1JQBA 4O83A 4X54A 3AM5A 4M54A 5JMWA 3QJ5A 1IULA 2D1YA 3ONFA 5F1OA 3CXRA 1DV2A 2JAHA 4XA8A 1DIHA 1P33A 1QORA 1TT5A 2JD0A 4BNNA 4GMFA 4O0LA 2Z5LA 3WYCA 2BRUA 1Y8QA 2OOSA 4Z3DA 1E3LA 1ISJA 5TX7A 3KEOA 3M1LA 6LDHA 1AE1A 3MJEA 2Y1FA 1XCBA 3OUUA 4RF3A 3CZRA 1CQIA 3PWSA 5H80A 1NX6A 4PFJA 4RDHA 3DL2A 4ZHSA 4R68A 4RO0A 3LF2A 4DMMA 1D3AA 2YWVA 4PG5A 2HRZA 4TWRA 2I66A 5J23A 4TV9F 1K89A 1WMAA 2WTBA 3LT2A 4JNKA 5KX5F 4E5KA 3UAGA 1DC3A 2YYAA 2Y68A 3H9UA 1ISMA 5B4VA 3RAJA 3STHA 3V5NA 3TQHA 4ZN6A 1T4BA 1M66A 3I83A 4BIIA 3VVCA 4C7KA 4YT2A 4YT8A 2VUTA 4M89A 1EBFA 5EERA 4O7LA 1HDCA 2JCYA 1I32A 3JQ8A 4IIUA 5DNAA 3WGTA 4AVYA 4BGIA 5U9CA 3K6JA 1ZXBA 2WYUA 3E9QA 4IDEA 1EK6A 3R0IA 1PS8A 4YAIA 3BTOA 3F1KA 4NI5A 3H8VA 1GR0A 1H2HA 5TGDA 1I3KA 4F46A 3DOOA 3MTJA 2EF1A 3QSGA 3I52A 3UFXB 3DDNA 1BG6A 4FOSA 1S6YA 5CPFA 4Z9FA 3V4SA 5GONF 3PJGA 3FBGA 3V2HA 4YPOA 1O8CA 1E7WA 4I8XA 1E3WA 1HT0A 2J5KA 4FDAA 3R5FA 4DYVA 3TSCA 4PG6A 3GEMA 2CMDA 4CQMD 1D8AA 2EIHA 5C7OO 5T67A 4YBZB 4DIOA 5AYVA 1PGQA 3M6IA 3AOGA 3D3EA 3QW2A 1NWHA 3RUPA 1HKUA 4GMGA 2OXIA 5I9MA 3GH3A 4O7ZA 3GRPA 1Y8RA 4PG4A 1PX0A 5LA6F 3QP9A 3WTCA 1NPDA 2PV7A 4TZKA 1I2ZA 3TJRA 1SC6A 4GAEA 2Z02A 5U1PA 1WR2A 3ZW9A 3U4DA 1TB4A 7ADHA 1MA0A 4NBUA 3L4BA 5I7FA 4OJNA 3FTPA 2VTDA 1XGKA 2ET6A 1R16A 1B6RA 2PLAA 3I4CA 1FJHA 4KWIA 1H2BA 2ZQYA 4BNFA 1T1RA 3V1YA 4OMUA 1W8DA 5DDIP 1L1FA 3LWBA 2OBNA 3MWEB 4LISA 1JKJA 5KVSA 1FMCA 2IZ0A 5KIAA 4XQ9A 2C5EA 3ZWNA 3NX4A 1IPFA 3OA2A 4Q9NA 1Q1NA 3IOYA 2X0SA 4EEZA 1R12A 2FZEA 2PH3A 4MVJE 4MV7A 2YS6A 2FP4A 3R6DA 4W6ZA 1DOHA 1H6AA 3IS3A 4OH1A 5CP8A 3DOJA 4M49A 1GUFA 4MKRA 1XQ6A 1N9GA 2DBZA 1PJLA 1OMOA 4RDIA 4MV6A 4Q3CA 1M76A 1NWCA 1BSVA 3OETA 4CLEA 4D45A 3ZNNA 3M1AA 3LT1A 2EWMA 1DJQA 1FDVA 5JC8A 3AUAA 2WEKA 3QHAA 1H9AA 4BUCA 2P5UA 5CB4F 3CSDA 1VSUA 4II2A 1KEWA 4DPKA 1RWBA 3G1UA 5DT9A 1YVEI 2WYWA 2G5CA 1JDEA 1LSOA 4O5OA 5EL0A 3ETEA 4DQVA 3WLFA 1FF9A 1Z7BA 1IZ0A 5A5EA 1UP6A 2W6MA 3ASUA 3RKUA 4DYDA 3RSHA 2BHLA 3ZHBA 1B14A 4E12A 3INGA 5JXWA 4J4BA 3JRWA 5JYEA 2GN6A 4AJEA 1Z6ZA 1TXGA 3PJEA 3NDIA 4B4WA 4JLWA 1O89A 1JVBA 2R00C 3VPHA 1OBGA 4TVBA 4LMRA 2GNAA 3TW6A 1EVYA 1PJCA 3H4VA 5F21A 1BTOA 5F1KA 4ZU3A 2DTDA 5EQDA 2YQ4A 4E5MA 4M9UA 1RYEA 4AJNA 1B15A 4I9NA 4EEXA 4B3HA 2CF5A 3H6KA 1NR7A 2NU8A 4DLKA 2XCLA 1U3UA 3RUDA 3VH2A 1WW8A 2GGSA 4L9RA 1ZK0A 4O7VA 4YJFB 1KOLA 2FPGA 1KEPA 2D0IA 3BHMA 3S2EA 3EGOA 1Z2NX 5G0TA 4IHJF 2PKQO 2ZB3A 3COSA 4ZJUA 4MP3A 4M55A 4OSOA 3KAJA 3PTZA 3NDJA 3Q9NA 5L4SA 2W6OA 1PJTA 3M2PA 2VPQA 1D1TA 1EQ2A 1CYDA 2PZKA 3HADA 1P74A 3TINA 1Q0QA 2HQ1A 2PY6A 1WAMA 1YGYA 4L75A 4BKQA 4O4LF 1NNUA 3MWDB 4YJ3F 4MVJM 4IPTA 1DFIA 2Q50A 4QO8A 3DBRB 4HXYA 4XQEA 4RLHA 5KJCA 1U8XX 3HFGA 3LLSA 4NK4A 4URFA 5L4LA 2HAEA 1ZSNA 2ZIZA 4PLVA 1E7SA 4RQUA 5DBFA 2ZDHA 5KJ1A 4I4TF 4HNTA 3JQFA 2YHIA 3HDQA 4C4OA 3LVFO 3OEWA 1H9BA 1L7DA 1T24A 1C3OA 2PK3A 1C0IA 4BHTA 1SZJG 4GX5A 5A4DA 4HV4A 4YAJB 5DCWA 1KBZA 2QZ9A 2J3HA 4P4GA 3I6IA 1G0NA 3TZHA 5B4UA 1MFPA 3CTMA 4MVJP 4L1KA 1C1XA 3KYDB 5LP6F 2RHCA 1I33A 2X7HA 4MAMA 4AJKA 2Y93A 2HGSA 2EXXA 4DPLA 1JDBB 4EUEA 2YW2A 4FJ0A 1GCOA 2CZCA 2XOXA 3RFCA 4WNCA 4JBIA 1SNYA 4XYEA 4EW6A 3TQTA 2R87A 1NM5A 4M8SA 4UVIA 2CDAA 4GWKA 2GZ3A 1NR1A 2W90A 3HB5X 3AI2A 2JKVA 2FZWA 4IDGA 3CZMA 3RJ5A 5IDQA 4BO3A 4XZ3A 4BL5A 1BXRA 2R7NA 4ZI7F 1JWAB 3ZW8A 4N18A 1VBHA 1E7YA 3DBLB 1JDJA 4LRSB 4BO8A 4XYLB 1E6WA 3LC1O 2EGHA 1FK8A 4A73A 2Q46A 1DB3A 1N9GB 1VE9A 2D4AA 3ENKA 4G2NA 4EGFA 2YZNA 5CA0F 2V7PA 4LVCA 3GK3A 1PWZA 3O26A 3O8QA 3H9EO 3DZJA 4BNZA 2RCYA 2X4GA 4NBTA 1H6BA 1JU9A 3KSUA 4IJVA 2FY8A 4D46A 5EIOA 2R7LA 1PTJA 3WX0A 2O7SA 5HV6A 1I7LA 1NP3A 4XB2A 4YJGA 3H2ZA 3V8BA 3HG7A 4RZQA 2PN1A 1RM3A 1VL6A 4NG5A 2J8ZA 2W2LD 3PGXA 2AHRA 4EUFA 3IP3A 2Q1SA 1FDTA 2RBEA 3E18A 4TV8F 2DVMA 4Q3BA 4RGBA 3RC9A 4ZRNA 1HDXA 5IJZA 1KC3A 1Y9EA 1GFSA 3VKVA 3JV7A 4ILKA 2G17A 3GC6A 1YS4A 3W6ZA 4DC0A 3SVTA 1E5QA 4OOEA 4R4JA 1XLTA 3LLVA 3LU1A 2IXAA 1U7TA 4CM6A 3H3FA 4IY1A 4NJMA 2AEJA 4E4YA 2O3TA 1LI4A 1U3VA 4TSKA 1Z73A 1RKXA 1ZFNA 1EZ1A 3QWAA 4I1IA 4E13A 1LLCA 3WO0A 1KS9A 2ZB7A 3FSRA 5HA5A 3RUIA 2Z1MA 3JD2A 2YV3A 3KAKA 1UAGA 1LDGA 4ND5A 5AXBA 3RU9A 3DZBA 1DFGA 4B7CA 2VYND 4FOOA 1DRWA 3H5NA 1ADBA 3LF1A 5K0ZA 5I9LA 3ORFA 2AE2A 3ZWAA 2DLDA 2QRKA 4KP7A 4E6PA 5L7WA 3HZZA 3KOUA 3HE3A 4E0BA 4P8RA 3WGHA 4RF2A 3JQBC 1DLIA 2YW9A 3MJVA 3PIDA 3GF4A 4CV1A 2AE1A 2P4QA 2W6PA 3KYCA 4N5NA 3RJ9A 5CDTA 1HLDA 1Q7GA 3K5HA 1AGNA 1DPGA 3DBHB 5IN4A 5JDIC 3B1JA 2BF7A 3RUHA 3FWNA 5JY1A 2VQDA 4MA0A 1HLPA 5BPFA 5ENDA 3KB6A 5EJ2A 2UDPA 3V4ZA 2GN9A 4E30A 2B5VA 2B4QA 4ESOA 1C0LA 3NEPX 3HNPA 1DXYA 3NTRA 3BAZA 4RVHA 1HTBA 4BO1A 4GBJA 1BW9B 3IIEA 3JQ7A 4WLUA 2CY0A 2C2YA 2YHIB 4YRBA 2ZJ1A 3I9MA 1V3UA 1B8UA 4LSMA 2YFQA 4ZQEA 1A7AA 2R82A 2DPGA 2BFAA 1JW9B 3U9TA 4GX1A 2FHSA 4DVJA 1X13A 1P0FA 2QX7A 4A03A 3WMWA 4IMRA 4NH4A 3ZWXA 3QVXA 3QWBA 1CQJA 4BS9A 1ORRA 1GUZA 2QF7A 3AY6A 4YYZA 4XIYA 3ZDFA 1IB6A 1KC7A 2D3TA 5KWEA 5CG2A 2X9GA 4XEHA 1Z74A 3OA0A 3H9JA 4AL4A 1YL7A 4BNHA 2VUSA 3WFJA 1UXKA 2ZYAA 3WGGA 4LSWA 1T2FA 2HK7A 4Z3KA 1IHXA 4DMLA 1PJBA 4UVGA 5LXTF 5IYZF 1G1AA 3OQ6A 1XQ1A 2VT3A 2Y99A 1I30A 1I24A 1KVQA 4B7XA 3AY7A 2TMGA 3GVPA 1B8PA 5IN5A 3WGOA 1JN0A 3JTMA 1C1XB 1D7OA 1KEVA 3GGGA 1O0SA 1EMDA 4B4UA 1MC5A 3W4IA 1EVIA 1GDHA 3D1LA 4YXFA 1SEVA 3FBTA 3GPIA 2QYTA 4RCVA 4O82A 5B12A 2YYYA 3HDJA 4DL9A 1QLJA 2BGLA 4INAA 2GLXA 4B4OA 3PZRA 1KEUA 3QRWA 1VBGA 4BNGA 2DWCA 1BNCA 1SPXA 2CF6A 3RV4A 3GEGA 4WLFA 1Z7EA 3M2TA 2B83A 3RUEA 2O50A 1ULZA 4YB8A 1GEGA 3FR7A 1A9XA 2DTXA 2IE0A 1Y5RA 2O48X 3PI7A 2P9CA 3L4SO 3QVTA 4NFHA 4OOFA 4N5LA 3W8FA 1GV1A 3LT0A 1ZXLA 3I9JA 4GPD1 4DC1A 1VRWA 1VL8A 2RHRA 2GYYA 1A48A 2I5PO 4R9SA 1EE9A 4PZDA 5BNIA 5JNLA 4PCVA 4QX6A 3EYWA 1WMBA 3H2SA 4NJMB 1E6EA 4E3ZA 4W82A 3QWHA 4G65A 2AMFA 1MP0A 2NU6A 1JAXA 2ZTLA 1NQTA 3ZWBA 5TLSA 5JLAA 1E3EA 3AY3A 4R51A 4WCFA 2BFOA 2EEZA 1EEHA 4R3WA 2X1HA 3WNQA 3SBOA 1A72A 1E0DA 3F6YA 1NPTO 4NPCA 5I7VA 3Q1KA 1IOVA 3BZUA 4FW8A 1MGOA 5JW6A 2X9VA 1R37A 3PQDA 4UVDA 5JPIA 4R1SA 4H3VA 3BHJA 4NU6A 3ITDA 1K5HA 1PQUA 4UEKA 4XDYA 4U8GA 2UUOA 5THKA 3ZGYA 4MVJH 4FCCA 4FGRA 1G6KA 1PWXA 1PL6A 3ZWOA 1GSOA 1W4ZA 4YJ2F 3PHGA 2PFGA 4BNWA 1C14A 4K28A 1I01A 4RQTA 5BQFA 5JAQA 1WLYA 3GG9A 3OP4A 4YRDA 4KZPA 3NTQA 4RPLA 1R4MA 1KC1A 4E21A 5EZYF 1MG0A 3ZV4A 3JQGA 1P45A 3HQ4O 4GVXA 3ZI0A 4BNKA 1QP8A 3K92A 1PQWA 3QV1A 3V1UA 3EVNA 5IAAA 4J4TA 2NQTA 4XIJA 2DBVO 2NUAB 1VM6A 5JCJA 1GCUA 1N2SA 3P19A 2ZB8A 3NJ4A 1GD1O 4GGOA 1PSDA 3NV9A 5DOVA 3OICA 4PLWA 1Z2PX 4W99A 2B0JA 2HK9A 2O2SA 4AJ1A 3ZNPA 5G0UA 4CM9A 3GN1A 1LSJA 3MWDA 4MV3A 2PGLA 3WOHA 3EW7A 5A9SA 3C7AA 2R85A 3JQAD 3OJ0A 1PIWA 5GZ1A 3DBRA 3TFQA 3RVDA 4UVHA 1GZ6A 1QG6A 3DAFA 2IEDA 3FWZA 3A28A 4MA5A 4Y98A 5COAA 3NAQA 4IJUA 4IQ0A 1HDYA 3WQQA 5MDHA 4HFMA 1DC4A 4LMPA 1G0OA 1T1SA 2ZK7A 1NVGA 2EW2A 2DLNA 1CEQA 2A94A 1JWBB 3UN1A 1LRKA 1SB8A 1Y5MA 1DO8A 4J7UA 3AU9A 1PGOA 2HJRA 5AXCA 3JYQA 4FFOA 1YQDA 2Q2QA 3BMNB 2EJWA 1SOWA 4IDBA 2EP7A 3GFBA 3ON5A 4YT5A 3TZKA 1U3WA 1YOVA 4P4LA 3JYOA 1EUDA 4E5PA 3WO1A 3V2GA 4NQZA 4CLOB 2D5CA 3PHIA 3F4LA 4XCVA 3PWZA 1PK8A 3SE7A 1ENOA 3MJTA 2Q4EA 4HNUA 2YDYA 3HB4X 4PLHA 2VWPA 2E48A 1C0PA 3DAPA 4K6FA 5JCXA 1LX6A 4LGVA 4PG8A 1AXEA 1F14A 3OFSA 1HYEA 2VWQA 4RLSA 2I80A 3JQBA 4A7PA 4CM3A 3WGIA 2NWQA 3QFFA 4TQGA 5JO9A 4Y6RA 1UXJA 5I8WA 3QIVA 4AJPA 1V9LA 4NDNE 2X9NA 2VNSA 1Y1PA 4GSKA 2BKAA 4QQRA 2FB9A 1ULUA 3ABIA 3K2EA 1XWFA 4AFNA 3ETJA 3BHIA 4GSLA 4YJDA 4CL8A 1U7HA 1ZKMA 3I1JA 3WDSA 1XSEA 4L73A 2C07A 3FNGA 2OFPA 1CRWG 5GZ6A 3ASVA 3QQPA 3DHNA 5L53A 3D4PA 1YL5A 2VRCA 4UUPA 2V6GA 3QVSA 4W4TA 2QRJA 4IM7A 3OECA 1UUFA 4DXHA 2C29D 1XKQA 4U0JA 1RM4A 3RFXA 4CMKA 1V3TA 2PBZA 1E4EB 4GI2A 3BXXA 3OM9A 4XYGA 4CMEC 2PD4A 2VOJA 2J3JA 3E9NA 3MJSA 4FJ1A 3TNLA 3IL2A 4J2HA 4DLBA 1AXGA 5CPBA 3L9XA 5DCYA 4CPDA 3JYNA 3PFWO 1QR6A 3F5QA 3TZCA 3IC5A 4MVJG 5AOVA 1X0XA 4CM8A 4BO5A 2VWHA 4CLRB 4WCFB 4ALJA 4IZOA 4BO4A 4GLOA 4P38A 4BNUA 1XU7A 2DKNA 1P1IA 4IS3A 1J6UA 4CUJA 1R6DA 4WCDA 3LP8A 4KTVE 4EJ0A 1A4IA 4OHUA 5TT0A 2HO5A 1HYHA 5FI5A 1PR3A 2ZB4A 3I9OA 4WGGA 5BNTA 1UDCA 4F45A 4OGWA 3DFUA 2VHZA 3GAFA 2FOIA 2FPGB 1ZSYA 5A9SB 2AQIA 4HWKA 1U5AA 2A35A 1U2DA 3I6QA 3NYWA 4BO9A 1C0KA 1H6CA 1SEPA 3GLQA 4J9VA 2PKRA 3G79A 2R6JA 3ENNA 4EJ6A 2NU7B 3HHPA 2NNLD 2JCVA 3ROMA 3PLNA 1KVSA 1LUAA 3OQBA 3QVWA 1VLLA 4ONEA 4D41A 3FF4A 2X5OA 3ZV3A 4E2XA 1PR9A 3ROPA 3EVTA 2YJZA 5EMHA 2HLPA 2W98A 5B4TA 3AW8A 4JBGA 4FS3A 2PGDA 5GY7A 1P1KA 1IZ9A 1ISIA 1LC3A 1CWUA 2NTNA 2G76A 4YAEA 1ZSVA 2LDXA 4NMHA 4EYEA 2DBRA 1GQYA 3FTNA 1T25A 4C5BA 1ONNA 3Q11A 4K6CA 3GY0A 5JH7F 3GHHA 3S1LA 4RORA 5COQA 3WJ7A 4DREA 2VZ8A 2B4RO 5F5LA 4W9NC 4EUHA 4UREA 4MJLA 5A06A 3WQSB 2LDBA 3JQCA 4BKOA 1ZK1A 3VPGA 3T7CA 5D8DA 2PNFA 4I5EA 4DLLA 3JD1A 1E5LA 1LDYA 4K9DA 4NBWA 3RC7A 2GSDA 4RZIA 5KOIA 2ZCUA 3RC1A 1BXKA 3D4NA 2HJWA 3PHHA 2DM6A 5CDUA 1LLQA 3IAHA 5FWNA 2GZ2A 5J2TF 4BOYA 4MOWA 2I8CA 1V35A 1BDMA 3TZ6A 1TT7A 5IXSA 3ZWCA 5L9AA 4OXNA 1WDMA 2I6TA 3IUSA 2VYVA 5TIIA 5AXDA 4XDZA 2W2KB 4R1NA 4DIFA 1SMKA 2GDZA 4CMEA 3GOHA 9LDBA 3GDOA 4EDFA 1PZGA 2PR2A 3Q0EA 1UP7A 1I7NA 2F00A 2G82A 2H5LA 4L0QA 4L4SA 3WNZA 3D7LA 2O4UX 4EGQA 4CV0A 4CQMA 3PYMA 4FE2A 3ICCA 1BVUA 3VVBA 1GZ3A 2R7MA 4WUVA 4BMSA 1NBOA 4E5YA 2OBYA 1OBFO 5T8KA 4RF5A 3PRJA 4WPGA 3JSAA 1DSSG 4JCOA 3INTA 1KYQA 4E31A 2W6QA 4WBNF 2ZQZA 3F3SA 2QHXA 4ND1A 5AQ1A 1MC4A 4YA6A 4YR9A 2XAAA 3RQSA 5BMVF 1BMDA 2A9FA 3IP1A 1WZEA 1TT5B 2EW8A 4GKVA 4W9NA 5THQA 2WDZA 4BO7A 4YJGB 5FNVF 4FIZA 4Z0PA 1GYQA 3VPXA 3E6AA 1H0KA 3OJFA 4BNMA 3DZGA 1U4SA 4XKJA 1DC6A 4C7JA 4FGSA 3S8MA 1ENYA 1KETA 1M67A 4CV2A 3PZBA 3IKTA 1U4OA 1NTOA 4D42A 2RIRA 1E3IA 3GVCA 1F8FA 2F1KA 1VPDA 4D3SA 1CDOA 4BO2A 2AQKA 2EP5A 2X86A 4YT4A 3DZFA 2VRCD 2XXJA 1PX2A 3NUAA 3RFTA 4GVLA 4DWVA 1GPDG 2X0JA 4MPDA 3RROA 3EZLA 3U4CA 3ITKA 1UJMA 5JDCC 4I08A 2HKIA 2DC1A 2HRBA 3S55A 4ITUA 2X5JO 4LVUA 2ZTMA 3DC2A 3O03A 2P2SA 2X0RA 3LC7O 2NVUB 1X15A 3DTYA 3NRCA 1I3MA 2ZJ0A 2PA3A 2I99A 1ZCJA 2FSSA 1X1EA 2IYOA 2NTVA 3KVOA 3NT2A 5IDWA 1DJNA 1CF2O 3SC4A 3P5SA 5CDGA 3HJAA 2GD1O 1Y6JA 2BLLA 3OJOA 1N1EA 4TKLA 3RIHA 4I9UA 3VPFA 1PJ3A 2YZGA 2E37A 2NACA 3Q3CA 3SX2A 1N1GA 4BVAA 3JRXA 4PLPA 1BXGA 2BELA 4UUOA 3KALA 4BNLA 5DMXA 4MVJD 3X2FA 2ZKLA 4WCFC 3CEAA 3JCZA 3DZKA 4Z0HO 1YBVA 3MZ0A 1R0LA 1UDAA 3E5NA 5H81A 5HBRA 3OF2A 5G2OA 2OO5A 5TT1A 3JQ7B 1QYDA 3DMYA 2G1UA 4FN4A 1PZHA 1T2EA 4UUNA 2AXQA 3SJ7A 4J43A 4IDDA 4QO7A 3H7AA 2ZTVA 4YVFA 3G49A 2ZTUA 3H5AA 3GG2A 3MEQA 1U5CA 3WGZA 1EK5A 2RH4A 3GZNA 5CDSA 3RI3A 4KOAA 2GPWA 2XXBA 4WK6A 1BGVA 5JE8A 5MGBA 1F12A 2P9GA 5U4QA 1GSHA 5KVVA 2GASA 4I5GA 1FXSA 4RVSA 4J1TA 3WTBA 2PH5A 3I5MA 4L74A 3VA7A 2E6UX 3TDKA 2Y05A 2UAGA 4KWHA 4UAGA 4TRJA 1HZZA 2Y1CA 3Q1LA 2IP4A 4IZHA 1O95A 3MJ4A 5JYDA 2GLTA 3N74A 4TVOA 2Y66A 2CDBA 3E1KA 4GL4A 2V58A 1S7CA 3N58A 4R1UA 3U9SA 3I23A 6ADHA 4R01A 1KVTA 3ROKA
chains in the Genus database with same CATH superfamily
3E5HA 4DPMA 1FFGA 1WDTA 2PLFA 5KJFA 1I3NA 1UPCA 4TMFA 1L7QA 3KWFA 4DNFA 1TW3A 3BMOA 1CUXA 3HYLA 4RXTA 3C1OA 1Q7BA 3OOJA 4MP6A 4NZ9A 1HDRA 5IULC 1BD4A 5CEEA 1IM2A 4FLFA 1V3VA 2PMKA 3H99A 1FDOA 3N5CA 2WSBA 1ZOSA 5BNFA 3WR5A 1XAJA 3C3AA 2VR1A 1BXZA 1JHQA 4B79A 1Y9AA 1KERA 5J40A 3KT6A 1MJFA 3RTDA 1W1UA 5H82A 2XQGA 1ZNQO 4FBGA 1IOZA 3CT6A 3G5MA 1YB2A 1UEIA 2GCIA 3LIPA 1EVQA 3M6AA 5CM8B 4C6RA 3KZMA 1MX3A 1DEAA 1N2XA 2C99A 3K3PA 2Z04A 1DBWA 1WVGA 1V1RA 5EC8A 3R3UA 4AAYA 5IJWA 2RHDA 4ZYZA 4C6TA 2J46A 1EIWA 1VP3A 2ECOA 2I4RA 1A9SA 1U1EA 4ZJYA 3ZS9A 2A0WA 4K87A 3HBMA 5A71A 2CZGA 2I2WA 2JG3A 1OASA 1FTSA 3TBFA 3CEMA 1RM0A 3L1JA 3L6OO 1QYWA 5C8VA 1P6UA 2JL1A 4KXQA 2FF7A 3IQGX 2WF9A 3MB8A 3NUZA 3OQ1A 4FYYA 4QGSA 3VPBA 1U28A 1O97D 1I3LA 3U60B 4L6AA 1YS1X 4GX2A 4XR4A 2V1UA 2FW1A 1XFDA 3DB2A 3OLVA 4R2MA 4FMPA 2QTHA 4M99A 1TUIA 3AC0A 2OD7A 3ZV5A 4MLZA 3VC7A 2HBYA 3GFFA 4QG7A 1DAEA 2NVUA 1BQEA 2SKEA 2YC4C 3A1EA 4MR7B 4TKUB 3QLUC 3AF2A 4KWCA 5I5WA 2X22A 4RENA 3QENA 1E7QA 5CFPA 3BACA 1P31A 3UB2A 4E7OA 2ABJA 5ERXA 3HR8A 2HIAA 4WESB 1JMKC 1H2WA 2PV0A 3E84A 3FRJA 4KRYA 3UV3A 3BCSA 3VI3B 4H6XA 2W71A 2O6LA 3N0RA 2VNHA 4M1EA 3ZZUA 3IPCA 1E7RA 1ADGA 2ERCA 2A1IA 3BYZA 4A8JA 4IRMA 4R2JA 3HN7A 2X0EA 2Z2YA 2Q0XA 3OZUA 1T2CA 4ND3A 3UHAA 2Z9DA 4UCQA 2COJA 3S1AA 3PL1A 2Q4DA 4Z9YA 5BW5A 1RWXA 4DZZA 5JQGA 1YFJA 3QUTA 3G5UA 1E3WB 2C77A 4YPFA 4BWVA 2E5FA 2CGEA 3QE4A 4P4SA 3ZLBA 2PUAA 1A9QA 1T26A 4D82A 3F6CA 4O4HF 2VUGA 4O7YA 5LYJB 4TV8A 2WU1A 2R44A 2YVKA 1NZJA 1ULBA 3SXUA 1C3VA 1RLOA 3KNZA 1MAWA 4NATA 5BV7A 1XPUA 1Z4OA 1ZN8A 5C3MA 2WMNB 4IXWA 4WEQA 1IBMB 1B6TA 3U3JA 1F4VA 3LQ2A 4WY5A 2OUIA 3EBPA 1JV2B 1VKOA 3IEUA 1PL8A 1U80A 4IEFB 3WI7A 2YWXA 4OQ4A 3NC0B 1ZNYA 2B8EA 3F46A 3ZGLA 2H0QA 5G1OA 4DMRA 4UFPA 1LTHR 1ZOIA 5JAOA 5KKAA 5HUHA 3OI7A 3OPNA 4AECA 1G291 2ST1A 2CHUA 2FSFA 3LCRA 2Q99A 1MUUA 3A6EA 3SM3A 2I4NA 2QRUA 2XR1A 4KXFB 3ISVA 4WOKA 1E9CA 3FHOA 3KCQA 2AWOA 4DCTA 4E2WA 5JTUA 5HJ7A 1JMYA 2DTEA 3HPQA 1XEXB 4INOA 4M1OA 5BSUA 4L4YA 1DC7A 5LDGA 4IGKA 2BTEA 1KBQA 2IS4A 3AI1A 5T4EA 4J29A 1O57A 3BE6A 4P5PA 3EGVA 1MA3A 1PJQA 1C3JA 3RBVA 2HC9A 4NLLA 5FBVB 3A31A 3QJYA 4Q66C 2PRSA 1OH8A 1XA0A 1OFTA 1OQAA 3F7MA 1EGMB 1JFRA 1JLLB 3CGGA 3QBVA 1G4UR 4MIEA 2D8MA 1BMTA 3SIRA 3NRBA 3G1WA 4CMCA 1W4CA 1VZ3A 2W6NA 4JLPA 3TSOA 3HS3A 1U2TA 3A6PC 3I5AA 4IDOA 4POOA 5K8CA 4OM7A 2P5SA 4L3OA 1D6MA 4OHXA 3IRUA 4OIMA 1S8FA 4W9RA 1WETA 4PBRA 5CAEA 2ECFA 4Y30A 1XF1A 4BXOB 5DEIA 1NZFA 3PPYA 4GLFA 4MPTA 3WQRA 1XDGA 2YWHA 3D8TA 4ENWA 5I9IA 3ZJTA 3AB8A 2JJYA 1ETUA 3JASA 3LKVA 3NG1A 1Z33A 4ZVRA 1BDHA 1UJ6A 3DZCA 1CUSA 1LK5A 1V2HE 3F6PA 2ROQA 4K6KA 4N4AA 3D3JA 4ZQFA 3ROXA 1SFRA 2A0YA 3EXHB 5IG2A 1H69A 4B2PA 2WU4A 4UMDA 4HNAA 1EDEA 4BLQA 1MFZA 1WVMA 1Y8QB 3SHFA 3UHFA 2Y1DA 3Q3IA 1XTBA 1QHYA 3E4DA 2B8NA 3JR7A 4K9PA 1KVUA 3C3JA 1Z82A 3MINB 2GNPA 1X92A 4HO1X 5DB4A 1EHIA 3ESDA 4B0OA 2GN8A 3SG0A 3A6GA 4ENPA 2J7PD 1GGKA 1TQ8A 3V3TA 1W49A 1IB0A 2C88A 1DRVA 3UAZA 1UKZA 4EI9A 3GROA 4C08A 4UDNA 1JL3A 1KJQA 2VDLB 1T9KA 1YRYE 4QBGB 4QUEA 4UNNA 1XA4A 2W4IA 1SG0A 4MQEA 4LFAB 3AU8A 1PYGA 2P0AA 1VIVA 2JGNA 4UC0A 1U1CA 4DLVA 1FTWA 2GILA 2UYYA 5E6SB 4KLCA 1Y7PA 2GBIA 2I7DA 3EDMA 3FYTA 3TL3A 3G5AA 2XKJE 4BATA 1DCTA 3WRWA 3CPHA 4DSNA 4G5HA 4CU5A 5IPFA 2L2QA 2J85A 1W4LA 4IJ5A 4FFPA 1NLUA 2QN2A 4NZZA 4WAUA 1Z7YA 2A33A 3IV6A 4JP8A 2EHJA 4TLMB 4EB8A 5CBPB 4WJZA 3BE5A 1N25A 3EYAA 4CEHB 2DUUA 3EULA 1GCAA 4YJFA 2CXNA 4US1R 3BFXA 2ZJOA 5CBKA 5JSQA 2P35A 1BX3A 2R6R1 2K7FA 2ZATA 2N46A 3LUJA 3V9PA 3S2IA 3TY9A 3KSDO 5TNXA 4C7MA 1U8ZA 3ZW7A 5C18A 4DR5B 3QPUA 1VI6A 1E5TA 3DMTA 2GRUA 1U9JA 1Z0KA 2ZWOA 3Q5DA 5C0OE 1P0QA 1JLMA 3CNEA 4NIMA 4DCCA 4I2VA 1J0DA 1SCQA 2AFRA 4OAOA 1RMYA 4EYQA 2PCJA 2AUTA 3K1AA 3T4PA 2OMEA 4D44A 2ZROA 4I55B 2I2FA 4FB4A 5M04A 4LXGA 5LOVF 4ES6A 4A0HA 5K8IA 1ATIA 4X3PA 1LK0A 2JCGA 1ZJ4A 1W6RA 4IF6A 5AHWA 2IKSA 4FKBA 1I7DA 4OA8A 1UQRA 4F85A 1QO9A 4YMUA 1QO0D 2O2EA 4CCYB 3MPOA 1P1BA 1U2GC 4N65A 4CLDA 2R5NA 2AG1A 2AQ8A 4JUFA 3RYIB 1MAHA 1NJFA 3HB7A 1U2QA 1E0KA 2W8BA 3GLRA 4URYR 3UCXA 1KI6B 4HN4B 4EGJA 1A69A 1SJ9A 1W2HA 2QDKA 3P4XA 4Z6KA 2V6MA 5F7ZA 3VV3A 1R9JA 4YP1A 2HNKA 2QA5A 1MQ9A 2NLOA 2EBWA 2OZPA 1SBCA 1N6RA 2JJ2D 1I0ZA 3JVEA 3KV3O 4I19A 4QDZA 2R2AA 4IX1A 2FKAA 5LCXA 3C3XA 2GBLA 2QRPA 3H6GA 2UYGA 1Y4AE 4D6YA 2FR8A 3KELA 3WL4A 2X4IA 3AETB 5IJAA 4EI8A 1FFEA 4E03A 4Q3EA 2EZ8A 3MT8A 5EZYA 3X1XA 8LDHA 1T3SA 4UZFA 3SHWA 2ZULA 1I6WA 2UVPA 2PUGA 1JBEA 3LQ4A 1QYXA 1TJYA 4RY8A 1GUBA 3WYBA 5K8LA 3SP1A 2JHGA 1VSBA 3F6EX 2NXNA 2O2YA 2OBMA 3LH5A 1NF3A 5EXEA 1OC2A 1XK7A 2ORED 3PQ5A 4HXGA 3VBEA 3IMGA 5EE1A 3RNOA 1E89A 5K8JB 3C5CA 4JLSA 2ZWAA 5JWHA 3QEMA 3H75A 5H3CA 2F2TA 2WWXA 5JBIA 1Y6FA 3VZRA 1N2OA 3F3YA 3TN7A 3UUEA 3W5UA 3WYEA 2V5AA 1H42A 2WMDA 4UEOA 4OEHA 3T38A 2AMJA 2I2CA 1X1AA 4LW8A 1Z68A 1SD1A 3WWDA 3C45A 2FRVA 1OILA 4I6GA 1QH1B 4GG1A 5ITWA 2QY6A 1TMKA 3ZXXA 2BF4A 1Z22A 4YPVA 2GKGA 2QE7A 3LDHA 4IDQA 4KEAA 1RACA 5LA6B 3ZLUA 4F4FA 1JAHA 1USWA 4L2IA 3AX6A 2HJ9A 1HE8B 3IH5A 1ZZEA 5E9QA 4XLLA 3PDCA 4BU1A 2FWMX 1U7XA 1BN6A 1NQ5A 4TLDA 5EZQA 5FYDA 4NZYA 4G6ZA 1E9VA 4OHKA 1PQ4A 2QAIA 4D43A 4HJRA 4CEJB 1IJKA 1UCFA 3TM4A 5IT0A 2AG8A 1QJCA 1R7RA 4I1OA 3M33A 1KQGA 1O96B 3CX3A 4HMOA 1F2TA 3UF0A 4LYAA 3FMOB 4LV8B 2V4UA 4HL6A 3RS2A 2IYUA 5K4AA 2B78A 3AR8A 1GGVA 1AUXA 5E3IA 3ZDYB 4EJSB 1QP7A 2D3WA 1MDFA 5IFLA 1A2QA 2VUIB 5HOQA 5HEKA 3Q3EA 2NU8B 4JQYA 3DYVA 4XH9B 3DFMA 1EX9A 4YP6A 2CJYA 2WWTA 3E27A 4QAJA 3V2IA 3WICA 3IB3A 4KV7A 3WYNA 1FRZA 1QGUA 2OGWA 4CMFA 5C80A 2C7PA 4M53A 3R5HA 2FGJA 3EVZA 4JVMA 4ZQHA 1ABEA 1M75A 3WL8A 1KTAA 1GM5A 3BH6A 3EVAA 4IIFA 4HLQB 1HFWA 5ES4B 3DMHA 1DGQA 1E9RA 4NPAA 5M7EA 4C01A 3AERA 1MB0A 5JS6A 2XXAB 3WK9A 3HLTA 1DX6A 3UFXA 3VPSA 4DBZA 1TQ2A 1B16A 1VJRA 2BGNA 3HZHA 3L41A 2PGOA 2R1UA 1CUDA 4KIWA 4QOIA 1YFZA 3X1JA 5JADA 5TRTA 2FXVA 5DGHA 1E1RA 1BJKA 2W42A 1H1DA 1LQTA 2UVDA 5DP1A 2D7DA 1D2GA 1R0CA 3UBTA 4FFMA 2RH8A 2DB3A 4NMLA 1JT2A 4HFJA 1V8PA 3LDUA 1LDMA 5KNDA 1QG4A 4RPIA 1VPWA 5L40A 1UXGA 1YHNA 3GNTA 4YUVA 4AJJA 3OIWA 2B7LA 5C8YA 1ZCBA 4OO3A 4DARA 4X7PA 3GVHA 3S2UA 2PZLA 3DD5A 1GGMA 1JIKA 1BXGB 3D2LA 4IUYA 4J0CA 4LDAA 5IKOA 2OFOA 1NUUA 3HL4A 2Z95A 4UOZA 5CLGA 1XU4A 3BRWD 4S0ZA 1EFPA 3SJ7A 5FI0B 4DV6B 3S8EA 1BU5A 1OUMA 3AP2A 5DN6A 4MVWA 4ZAFA 3G8AA 1I10A 1QK3A 3GJ4A 5BXYA 2RB4A 1QR2A 1FRNA 3CINA 3ICPA 2IKQA 2EZUA 4Q1AA 3KE9A 3A06A 1KAEA 1FYVA 3SSMA 4OJKA 5KYWB 5JAZA 3UCFA 1ZN9A 4JA0A 4R1TA 1MO6A 3N7UA 3Q6IA 3W3AD 1NQOA 2HM7A 4HX2A 3NHWA 5BSRA 2Q4BA 5LP6C 3ZHXA 3L77A 2E9SA 3MRTA 2W9XA 3ZY4A 3MOSA 3D3WA 3QE3A 4UTXA 3NC4A 5E7IA 2E18A 2VJPA 2ORYA 2P8JA 3LD9A 2EG5A 3PBKA 3PLRA 2G40A 2YZMA 1VJ1A 1VSTA 3BXEA 3GLHB 5AKXA 2MHCA 4DZRA 5HZHA 3V34A 3HY3A 3E22A 1F6WA 1A2OA 1EFVA 1GA1A 3NP9A 3IVCA 1GLNA 5KPDA 2B2NA 3BD9A 4ZCPA 4PBCA 3KEQA 3K30A 4FBLA 3JQ6A 1KDTA 1XZJA 3GA0A 4DR6B 3IBGA 1PE0A 1R8QA 2YL2A 1T6XA 3ZLVA 4J6EA 3VBCA 1F4LA 4MJ3A 3DOUA 2Q1UA 3ANSA 3S5UA 5LQKA 3DAAA 1EVLA 2PFKA 1DX9A 2XWPA 1LVGA 2XLBA 4IIJA 3H5LA 4PWZA 2ZRIA 1D2NA 1KEEA 3PXGA 3F73A 3RASA 1H3FA 2JAQA 4KIUA 1P2UA 1B0AA 2ZJZA 1IN5A 3GMIA 3W5SA 4QQNA 1OAAA 3CLSC 3TSWA 1BHQ1 3PEFA 5ALGA 3O3OB 1FTNA 4Z0TA 1OU0A 1TYZA 1HURA 3AXSA 3I0NA 4LNUA 3OHPA 4Q1CA 5E9JA 3ZTTA 4DA0A 1Z39A 1XYYA 3CHYA 5EUQB 4CFZA 3QFSA 4HRXA 1IXKA 2QVLA 1W6UA 3AKCA 4I4TB 2I62A 3HCCA 2V7WA 4PYRA 1BE0A 1JNYA 1KHHA 4URWR 2HPZA 4ZV7A 2QTNA 5LFAA 1TM1E 1QHGA 3HA5A 4G0ZA 2CDNA 3ND9A 4CT0A 3KD3A 4MW9A 3EPPA 2FX3A 1GRRA 2R1TB 3VDXA 2FOXA 2FN3A 2PWZA 3A3YA 3OG9A 4AW9A 3CZAA 3QLVA 1ND6A 4QWWA 5LA6A 4EK9A 2GCGA 4OHWA 4KQWA 2D2VA 3VO1A 4DJEC 1GTG1 1KMMA 2VP2A 4YRMA 4DV7B 1T8TA 1K66A 5D1NA 1OKKD 4TROA 3GBPA 1ZISA 1WD5A 5HJEA 3K0BA 3ADPA 1N2ZA 4GPEA 3RUFA 2H0AA 4AO6A 2HHFB 4P7KA 2GK7A 5H68A 2BYTA 5TQJA 3T7AA 3ZQ6A 1ZRSA 2J09A 5HKLA 4CV3A 3MHTA 3X3HA 5AJVB 3GW8A 4RMHA 4JR0A 1EDOA 3EXIB 2FPPB 1T8UA 4MVCA 3UJAA 3RC2A 2Z56A 4HSEA 2CUKA 1PR4A 3L0OA 3DEIA 4NCNA 4ZRMA 2W6ID 2J9GA 4W5WA 2N47A 1Z45A 4PYIA 2JFGA 5AVWA 4M0KA 1BWPA 5CYPA 2FMHA 3UK0A 4U7WA 4CTKA 3E2PA 1BOFA 1G3MA 2W83A 3H5RA 3KZCA 4F3NA 1CZLA 1Y1KE 3O75A 4G4GA 4OMFG 4MZXA 3VR5H 1RWOA 3ZCQA 1A5AB 1K6XA 3KQLA 3CEPB 1NDHA 1NJGA 2PANA 3WISA 4LHYA 1A76A 3FIUA 5CA0B 3NZEA 3D64A 1LZLA 3RKRA 5EINA 3RU7A 9ATCA 3N28A 3EEQA 4BMCA 4JMLA 1MGPA 2XQFA 3N0VA 1P2VA 1RE0A 5BMVA 4FGWA 4TM5A 3UT6A 3SM9A 2O7RA 4Z4QA 1M8JA 2XPCA 4HDOB 3T5PA 2P9FA 4GGPA 1IAVA 4U9HS 2V9PA 1QE0A 4X62B 3ZXSA 3T9EA 1NXQA 3HT5A 2GZRA 1Q6ZA 1DLJA 4WINA 3RVNA 2PJUA 3ONNA 3CJQA 3EDRA 3GV0A 2BE7A 3H9BA 3U0GA 3OX2A 2JS7A 4P4NA 3AEQA 5DE3A 1RT9A 1O94D 3A6KA 5DGCA 1H9CA 1EK1A 4NK5A 3RV3A 3DGFC 1N2GA 2WSMA 4WBXC 3NHMA 1W581 3IQXA 3KPUA 4YXWA 3U19A 1MX9A 1E9BA 1QHHB 1W5AA 4K40A 1STOA 3A4IA 4XVHA 2CNWD 2HCJB 4B3IA 5BWXA 3DTVA 4N8EA 4B48A 1V8ZA 4CT5A 1SVLA 3K0AB 1RD4A 2L82A 1TQDA 2BMAA 3CZ4A 1VYTA 2OESA 1N6LA 2QLJA 3PXXA 4RU1A 3R7LA 4HYTA 1HR0B 2P90A 4FK8A 4M0PA 1ZAUA 5IS2A 2XCRB 1XJWA 3DVRX 4MV9A 3QBTA 1E1CA 3SVLA 3COJA 1W48A 3GLGE 3QQMA 2O0KA 4LRWA 4E2ZA 1K0UA 3DPSA 4TMZA 2C20A 5K3AA 1G41A 4GEKA 1A8UA 2GRAA 2BPOA 3ZU3A 5G4LA 1J9GA 4ARIA 5FBKA 2F17A 4ZVQA 3HJGA 1WABA 1WA5A 4AUMA 2HIHA 4BBZA 2ZPTX 4XZ3B 3LVQE 2UVPB 5I9NA 5JI3E 1V8OA 4A4DA 3UJ3X 1N6HA 3BRWA 3WMRA 5H8WA 1FNMA 2QLMA 2AIRA 1K6MA 4J03A 3RABA 4J16C 4GU5A 3STTA 2PTGA 2WTXA 1Y3AA 2HK6A 1GNRA 4RL6A 4TOIA 5LNK6 1U63A 1KJ8A 5DYYA 4UM9B 4U2BA 4JLJA 3BIXA 2O6HA 4M86A 2YV5A 3FYCA 5DSTA 2EF0A 2QI9C 4N8DA 1WZIA 1TCUA 4NNJA 3T7KA 1EG2A 5TQ0A 5EXXA 2FRDC 3GPDG 3K2QA 1MLDA 4PVCA 2X7JA 2ATCA 3OZWA 2QI9F 3CLUD 3PJFA 4H0NA 4U02A 4US0R 1HYGA 1FPQA 1S8AA 3RS7A 4F7DA 4HDQB 1WKVA 3O1LA 4KHPB 3G8DA 4MWGA 4W7HA 3FZYA 2C31A 4AZ3A 1WUHS 5HQ3A 4YMGA 1DIRA 4PQRA 1J5XA 4CHTA 4RIFA 2BD0A 4FSXA 1LJ8A 3NEYA 1S2OA 1YBMA 2V55B 3NKLA 4PQEA 4BKMA 3KG2A 5KTTA 1TADA 1TZKA 2ZVJA 3CRNA 3KLNA 1UOQA 4JOSA 4JJGA 4ZA2A 1UM8A 3ZI7A 1RFLA 2P6MA 1P4HA 3EPLA 4E11A 1DBVO 1QGZA 2H7VA 2AOUA 4KAJA 1GFZA 1PL7A 2XDYA 4ZEXA 1DQRA 2P41A 4TYPA 5I60A 3SQXA 1T8RA 4KYTA 3LX5A 2XBUA 4D9JA 1T2VA 3KUCA 4MNTA 4N7MA 2W2TA 4KBFA 1JR3E 1H0SA 3A2NA 1ULSA 2O0JA 2PBLA 2BGKA 1T2AA 1WX1A 2J7KA 4QGBA 1DIOB 2W2VA 3DE3X 1DIAA 1TYBE 4LZNA 4JDUA 3A4VA 2ADOA 1UWVA 3QZUA 4TKUA 3T8YA 5AVKA 1RTKA 2CJFA 4KH1A 1QXSA 4HH4A 1NV8A 1YA6A 2OK7A 2I54A 1BS2A 3U31A 5JCJD 3FY4A 1DG9A 1FSFA 2BTQA 2CYAA 3BMQA 2HHFA 3EEYA 1DCFA 2ZYGA 5E4JA 3QLTA 4IFTA 5JD4A 3OUTA 5HBGA 2FPXA 3DXXA 2QN3A 2V65A 1N5DA 4QPZA 3E81A 4CLXA 4AS3A 3BN3A 4RH0A 3RYHA 2LCIA 3LQSA 1M2GA 1M2VA 1X8XA 2RJNA 3BTUA 1LTKA 3CCCA 3MTGA 3BCUA 4Q21A 3TLEA 4F3RA 4DUPA 1TDJA 3BQNB 1MRSA 2O7NA 4IFIA 2DPLA 4KH0A 4KO1S 2CFCA 1NLZA 4BRWA 4ESEA 1L8OA 5IAOA 4PZ7A 3KK0A 3NYQA 3TQCA 2G0AA 5G02A 4FDVA 4JI2B 4XJXA 4ZK6A 1RAFA 5JHGB 1FQJA 4ISBA 3TWOA 1F0PA 1UXIA 1EWKA 2QRMA 5BSHA 4F5YA 1II9A 4G0PA 2CNUA 4QG3A 1P1RA 3SXPA 2AJBA 3HC7A 1KH2A 3VVMA 4S2EA 1OYYA 1E2IA 1EUCB 3LRTA 5C31A 1QYRA 4BFCA 1P4RA 3S40A 2RGBA 4MRRA 3VOBA 4ZDKA 1YS6A 2HGXA 3ND8A 2OCAA 1E8NA 1SXPA 2PLNA 4OYLA 5CDYA 2C00A 1G2QA 2ID4A 2WJ6A 1UMCA 3K4QA 3DV0A 3U49A 4XWWA 3FTCA 1WKCA 1UDRA 3UAWA 3G0CA 2Q2WA 1E1MA 3R3SA 1LTQA 2HK8A 1UR5A 3DDHA 3LYLA 4XFJA 3OUZA 2C5AA 3AW9A 5J5CA 4INZA 4KAFA 3A1CA 4ZKDA 5MGBA 2R7KA 2VCHA 4Q34A 2ZIWB 3PXDA 4G23A 2XH8A 1BMFA 4BX0A 5ITSA 1QPBA 4NBNA 4NYIR 5AI6A 2PPVA 4E08A 3OCUA 4TVKA 1E0JA 3N8DA 1HWYA 2RAFA 3WRXA 3CR8A 1IM5A 2IPMA 3KB8A 1OWMA 4L8VA 3Q7RA 4Q24A 2IH2A 3ZVRA 3DPUA 3G7SA 4K8RB 4TXHA 3ZWYA 3EWSA 4MARA 4DNXA 4EPWA 5CVTA 5K3EA 1GL3A 4A0RA 4CMIA 3C3YA 3NNDA 3IVMA 4YH1A 3VYWA 1CE8A 3Q3HA 2C7RA 4MRAA 2ZRCA 2NUTA 3EVDA 3LZCA 1JZQA 3QKRB 4H7EA 2YJGA 4Z51A 1N1MA 4OUKX 4I1VA 4O7NA 3WWHA 3TM5A 1AZSC 2GFQA 2GA9A 3ZHYA 2KBEA 2HWYA 4O4HA 3V32A 4X6UA 1C9EA 1E98A 1BQ4A 3I0ZA 2ILTA 2XSZD 3PHCA 3SWWA 2O8FB 3GLKA 1HT2E 1KBLA 3BS4A 4X45A 1L7NA 6ABPA 3L1UA 5HGJA 1UKBA 1VIAA 2VJMB 1DP4A 1DT3A 4P35A 3R5KA 3CNQS 3D6MA 3GT3A 4NX2A 1XHEA 4QU8A 3EMKA 4JJ6A 4P7FA 4JGBA 4MYUA 3UGKA 4B3MB 2WQ7A 3UWKA 1V1RB 5H9WA 2GTIA 3A9TA 3EJWA 5CNKA 3RSOA 3UOGA 4IV0A 1NVAA 1RYDA 4IH4A 2EX4A 2F90A 2VDMB 2XMQA 2BC9A 4MLPA 4P82A 3TIIA 2VK4A 1VKZA 4LOAA 1K08A 1V16A 2V9ZA 3K4PA 3PD0A 4TTVA 2C61A 2V4MA 2GVNA 4L6CA 2QXUA 1M73E 1ZN2A 1U2GA 1UK8A 4O6VA 4Y8VA 4Q93A 1OLXB 2HRRA 4PCUA 2WMOB 1DQZA 2V7TA 1KY5A 4BQNA 4E88A 4PRZA 3FG9A 2H9IA 2EHDA 5DBOA 1GLVA 5EVCA 5FBWB 2R1TA 4QODA 3QOYA 1OJ7A 5KYGA 2OK8A 2ZE6A 2DETA 1O03A 2QYHA 4J3FA 2BGWA 2X58A 1AN9A 4DZTA 4E4TA 2OO7A 5CT9A 4C6SA 5DHTA 4Z8XA 1CJUC 1MVOA 4HAVA 3UJ7A 3UJHA 5DHAA 1SQ0A 4DCOA 1HE2A 1HORA 1LX7A 4WFKA 2AOUB 1K4MA 2FPLA 6AT1A 2CDCA 3C85A 4FC6A 2G0TA 1D0SA 5AVYA 3C3WA 4C0QC 1R18A 5L3QB 4KPGA 4OFZA 5HMMA 3BSFA 2FQWA 2JEOA 5KNDD 1SKYB 3A4LA 1I2MA 5H70A 2Y1OA 4BZXA 3CEJA 3HKDB 2QLFA 4ZREA 2YRWA 1DVRA 2WP8J 3OESA 2O3QA 1XVUA 2HHCA 3NETA 1VLHA 4RESA 2AXEA 3ZBPA 1XXLA 3U4HA 4QTYA 5A5DA 1R8YA 5K7SA 1ZP6A 4QUKA 3D5QA 2BTQB 1BWSA 3BMQB 3U55A 4R84A 4QFBA 4G37A 2WPDA 2VPWA 1NGSA 2XUGA 3PE3A 5TB5A 1P9NA 2R11A 3Q3JB 4F4UA 3TL2A 3DEFA 2OXTA 3E8XA 3S28A 1F0KA 1F6BA 1WTCA 4OL0A 4WDQA 2JH9A 3JYPA 5B1YA 5CDFE 2IXDA 4IMJB 1QVZA 4I6JA 4OI4A 1TF2A 1F2VA 3VDMA 5CITA 2AFIE 5HBRB 3E61A 1U90A 4FMCB 4KXMA 2OLSA 1GXSA 1V43A 1YUMA 3DVQX 1ZD3A 4O2AB 4CBVA 5L95A 4AF6A 1E2BA 3KYHC 3VTFA 2ATXA 4RHCA 4YMIA 4F1JA 3D8SA 4RABA 2SICE 4AZ0A 2QT0A 2ZKIA 1R6XA 3JZAA 4CMBA 4G9BA 3LLMA 3MD0A 4Q03A 5ANRB 3D31A 5FR2A 1J8YF 3ESYA 3VU8A 2XE7A 3D3KA 4Z1MD 4AG3A 2HDWA 1GVHA 2I3DA 5D1OB 1S2DA 3FPHA 2VTVA 5DSZA 1I3CA 1SUSA 3CR7A 1YQXA 4FBMA 1A8SA 5IMBA 2OQRA 1E4YA 3KOOA 1UMCB 3GZ4A 3OJWA 4WMLA 5DT2A 5ABPA 4WLEA 5D3ZA 4KREA 1ONPA 2OTCA 3Q9SA 5EJAA 3C6KA 2OECA 5KSYA 2UYCA 1O9BA 1V47A 1SVUA 2WMYA 3FDXA 3DTGA 1E9DA 2ORIA 4LXIA 1SHLA 1VE7A 5HW0A 2HBZA 3WBBA 3GFQA 4X64B 1JDUA 2XZLA 4X1YA 1R5JA 5K1ZA 1D03A 2F1JA 2QENA 4KNWA 2EERA 3A6LA 2VNJA 3UZUA 4FDTA 1RJFA 1E6UA 1EGHA 4GGMX 2P7IA 3H16A 3RRXA 1UH5A 4NR0A 5FJJA 1TAQA 4WGFA 4XYBA 1FRQA 2AFIA 3OFKA 3LRXA 1QB8A 1YKFA 2HQOA 4BC1A 3QBJA 4CQLB 1HE5A 1D0IA 1DE0A 5IZCC 3DKRA 3CNHA 4LY3A 2JC3A 2B5OA 5CVUA 3RB8A 4LNHA 1P2BA 1M5UA 4YAUA 4IEEA 2VF8A 5EOVA 2UZ3A 2XT6A 1J9ZA 3DUFB 3LPNA 4N01A 5KOJB 3H4MA 5K3OA 2CXSA 3Q7TA 1FQOA 4MI6A 1AMNA 3ZZ0A 2HZ7A 4Q3DA 3SSOA 2Q3LA 4OB7A 1PZXA 5TQ0B 3WNVA 1A5ZA 1FBTA 1SXJA 3HTXA 1S2IA 3NCTA 1ECJA 4PIPA 2WZDA 2V5VA 1PQYA 3NM6B 2RJOA 4GYJA 1D6SA 4INPA 4ENRA 5BUCA 1WHSA 3L4BC 4PLFA 4F6RB 1QMPA 3EXEB 2P40A 4Q4DA 4YQYA 5FQNA 3A6HA 1OE0A 2I65A 1XC7A 1K2VN 4YRGA 5KTMA 4PR0A 2BEUA 1XN1A 4G0YA 4V0NA 1SULA 4GPTA 4RLFA 4WKNA 1MABA 4AWBA 2VH1A 2I1VB 3QG5A 1SBQA 4JGIA 4RNDB 3RIXA 3JQQA 4JN6B 4NBVA 5LJIA 5LVAA 1QTRA 1GL6A 1KJ9A 1QK5A 2XSZA 3I6MA 5FPSA 4LPSA 2RE8A 1K9SA 1N2CA 2ZYRA 2WRZA 5AJTA 2VDRB 4NFSA 4NOKA 4RULA 2J3KA 3WL6A 4QZVA 2CNLA 3AFMA 4NYJQ 4YDRA 5JAHA 1YJQA 5SY6A 3KUUA 2FX2A 3U80A 3F5DA 5HVNA 4RY9A 4A9AA 1B41A 4PQGA 2VJOA 1DEOA 5HS6A 4ZYUA 1U6IA 4DNPA 5KINB 1LLDA 1YWGO 3TFOA 3GIDA 1O5IA 3BWXA 3TI9A 4UCOA 1N0WA 1A71A 4HV4A 3VAYA 1N0VC 2RKBA 3RFVA 4H15A 5K6AA 1NAHA 2VO1A 4O63O 1Q16A 2VYQA 4RPCA 4X5OA 4EL0A 5FTWA 3AV3A 1UPTA 4FFBA 3PGMA 1GEEA 2FVXA 2IW1A 4Q4AB 4JYPA 2D2EA 1WXEA 2WAOA 2QK4A 1FU4A 4DR3B 3C97A 4MB2A 2NNWB 1QQ5A 4UEJA 1KYIA 1KUTA 4LZAA 3UYKA 2JFPA 4GRAA 2VT2A 4B83A 1V0JA 3ZD9A 3FSGA 3KU1A 3FF1A 4A2PA 3H9QA 1E2DA 1KZ4A 5EIHA 4O7WA 5E9WA 5KPJA 2GCNA 2YN0A 4NC9A 4EITA 1M5RA 1FFDA 4OKIA 1G17A 1GZ5A 2ZBPA 3I37X 4KUEA 4UZSA 1CFZA 3HSKA 4WBNB 2I6SA 3HYCA 1Q12A 5REQB 1A5TA 1JTFA 3G2NA 4CODB 3JPWA 5J4LA 4BYMA 2JFOA 4M0CA 3PJRA 2CLOB 1RQ7A 1ZAKA 3B12A 1O6GA 5K9ZA 4X65B 1V1JA 2FW9A 3GP5A 1WY5A 5LWHA 2M1XA 5JS2A 1J8MF 4KIJA 1AHHA 4BGUA 3Q88A 3TQFA 4DM4A 4QOEA 4DAAA 3G23A 5JRJA 3O47A 3V1MA 4B34A 4G8DA 1QFJA 3IIKA 1CUVA 1HDGO 3EC7A 3RSZA 1IE3A 3ZU4A 1JU3A 3CU5A 4TZ6A 1LVHA 1A8QA 1H1TA 1UPAA 2VF5X 3CRVA 1ZVVA 3H2JA 3WIDA 2Q29A 4RY0A 5HNEA 1DJLA 4WOBA 1F8XA 1O8BA 4DIDA 5AHOA 1LSSA 1E1YA 2WBLC 1UP4A 4OLHA 3P4YA 1LXCA 2VRBA 3AJRA 5AJYA 3K73O 5LUBA 2V0CA 3GLIE 2XF8A 1BJTA 3SJZA 3V00A 5G1NA 3G8CA 3R3JA 4LXUA 4CJXA 2ODEA 2OCLA 2PUWA 1MG5A 4CQMB 1NTRA 4DRYA 1QKKA 4F2WA 3ZXYA 1JT9A 4GMKA 3QPVA 4HAOA 4PZ0A 3AM5A 4I46A 1KEZA 2ZBGA 5JMWA 4FYKA 2Y2VA 1QUFA 5F1OA 3SR4A 5BWBA 4I8DA 5J2UA 4NONA 2JAHA 2RGCA 1DIHA 2ZUCA 5AM4A 4EA7A 1Z2CA 1P33A 1XQXA 2JFYA 1BWRA 2Z4TA 4B3SB 4ANFA 5EIBC 4ZT2A 1QORA 2CFMA 4XASA 5EHZA 1WMEA 2YJ3A 3WYCA 1RYYA 2R1ZA 4LS3A 2OOSA 2ZSIA 4NE7A 3ZVNA 2RH5A 4I5IA 5FPOA 2BKEA 3BXZA 3M5CA 1GWNA 5FO0A 5HILA 3R8XA 5ESWA 1JG3A 1GKIA 2C92A 1PYOA 2YQZA 4I4TA 4PFJA 4RDHA 4G0UA 1J9EA 4RO0A 4DMMA 2WA1A 2YWVA 4PG5A 1MBZA 2XNKA 1NUAA 2AF3C 2R79A 2DCUA 2ZIXA 3ADCA 2CLCX 3PNOA 5IJ9A 3BK1A 1CUAA 1K89A 2IDKA 4PONA 3REGA 2WTBA 3TS1A 3KT8A 4E5KA 3KQMA 1ISMA 2VJQA 1JA0A 3STHA 1ZCAA 1WL8A 3HP1A 3HUUA 3TQHA 1M66A 3I83A 5JNRA 1UPFA 5AO9A 1IWOA 3VVCA 4BIIA 1Y3BE 1M2FA 1EVEA 2BDUA 2Q3FA 3OC0A 4QOJA 4WZAE 3UAXA 4BJ3A 3KDSE 2ZI5A 2Q5LA 3M81A 4EUKA 5EERA 1ZU4A 1KYYA 1QGYA 5TR9A 4JSYA 1OYVA 4OFBA 3K6JA 4QUDA 4RWEA 4DMHA 1IHPA 1EK6A 2R9VA 3P52A 1PS8A 3QUQA 3R0IA 5CVCA 2YYZA 5DYWA 4C1BA 3F1KA 2VAVA 5IUJC 3CR3C 2WJ3A 3UTCA 1GR0A 1H2HA 2EZTA 2Q6OA 2Q9BA 1T5OA 3DCYA 5TGDA 3DOOA 4E15A 2EDAA 2VJLA 1P9WA