4FFMA

Pylc in complex with l-lysine-ne-d-ornithine (cocrystallized with l-lysine-ne-d-ornithine)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
363
structure length
344
Chain Sequence
b'MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKARIIYGLEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVLKERFGAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PylC
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase/product
total genus 112
structure length 344
sequence length 363
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ffmA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ffmA01
5JDIC 5K0ZA 2IE0A 4OYRA 4XYLA 1IUKA 2I67A 2D8AA 1CYDA 4PG6A 1IHXA 5ILOA 2NLOA 4M86A 3Q0EA 4LISA 1PJLA 3TZ6A 4EUEA 5GZ3A 4O7ZA 4OSPA 1G1AA 1C0PA 2JCYA 1PEDA 3FTNA 3JQCA 4O59O 3ON5A 2NUAA 3OECA 3UFXB 1Y8QB 5L53A 1DJQA 1GV1A 4KMSA 4AJJA 5BSFA 2YWVA 4KWIA 1DV2A 3PWSA 4XYMA 1BXRA 2VHZA 2D4AA 4BL5A 3WICA 2AEJA 3Q9UA 4CMJA 3JZIA 2NTJA 4PRKA 3MWEB 4FS3A 1GSOA 3IL2A 4MO2A 5KJEA 2PKRA 1Y8RA 2HAEA 4C5BA 1MC4A 5CPFA 1UP4A 2Q45A 2QZZA 1JN0A 3I12A 1R0KA 1DBVO 3RCBA 2DAPA 3PZBA 3WLEA 3GVCA 1LDBA 4DRYA 5KJ1A 4J4HA 1ORRA 3W4IA 3I4FA 5TSDA 2DTEA 2AQ8A 3I83A 3OSUA 4IBOA 2I99A 2JL1A 2PD6A 1B8VA 4OQYA 4AJHA 2QRJA 2C2XA 4CM8A 3OA0A 1KC7A 3OBBA 2ZB4A 2VUUA 4MV1A 1J4AA 3C7AA 4FGWA 5CEEA 4NMHA 4RL6A 3ORRA 3FNGA 3RAJA 3V8BA 2XOXA 4R68A 3OJFA 2G17A 1K2WA 4YJ2F 1HSZA 4GPD1 3E9QA 1PJCA 2W6ZA 3FF4A 2CNBA 4MKRA 1P1FA 2HSDA 3BXXA 1GZ4A 3N58A 2AQKA 4KUHA 1N92A 1E7WA 2I66A 3D0OA 3WYEA 3WGQA 5H82A 1F06A 3FCOA 4E6PA 1IL0A 1N9GB 2O3TA 5F1OA 3ZNQA 1H9BA 1Z7EA 3X2EA 5KJCA 1OBDA 2Q1UA 2TMDA 1R0LA 2PWZA 1S6YA 4WLNA 3ZV4A 1B26A 4BMSA 4CM5A 1LLDA 4TQGA 3WMWA 4XQEA 3VPFA 5HRUA 4G65A 2J9GA 1U2DA 4J7CA 7MDHA 1O8CA 5CDYA 4U0JA 4D46A 2EGGA 3QY9A 4R54A 4ZRMA 4EDFA 2W4QA 1T25A 1YGYA 4BNYA 1E4EB 3OICA 3CE6A 3IKVA 3HDHA 4PLVA 1KVQA 3PVZA 3QFFA 4IJUA 5GMOA 1H6AA 1G0OA 4Q39A 4H15A 3K8ZA 4P4NA 3D1LA 4UVGA 5C7OO 3MTJA 1H6DA 1PJTA 3WLFA 3NGXA 3HUDA 3WWZA 3GVIA 3H9GA 1U3TA 5KVCA 1P3DA 5F1KA 3K96A 4KOAA 1P1KA 1DJNA 1VL0A 4MV4A 3RBVA 4M1QA 3GQVA 4BNLA 1QSGA 4ZU3A 2CVZA 4EI2A 3V5NA 3RU9A 1PS9A 1V3VA 1UZMA 1X7GA 5IJZA 4RGBA 3RD5A 4E2ZA 4DLAA 3G8DA 3OH8A 3QRWA 1TI7A 4UVDA 3G79A 3CZMA 4AJ1A 4BNNA 5KJ6A 3A06A 4CUJA 4EJ6A 1LU9A 1I7NA 4DLLA 5TGDA 3UUWA 3WX0A 1WMAA 4P4LA 2V58A 3L0DA 4XGKA 3QV1A 4XX0A 4D0SA 5KTKA 3LZ6A 2YV2A 3GR6A 1PU2A 3O38A 1PQPA 4WASA 5BT9A 1EZ4A 1N5DA 4F46A 3BTSA 4NBUA 2E6UX 4NBWA 1ADBA 1BXGB 4ZQEA 5KKNB 2VHVA 3PQEA 1SB8A 3C1AA 4Y98A 3WDSA 1A4IA 4CM7A 4CM3A 4CV0A 3ZV6A 2W70A 4JJGA 1VLLA 1E3JA 5JCXA 1PL6A 4RJTA 2YDYA 2G5CA 3PIIA 3LVFO 1XHLA 3RJ5A 4A10A 3OFSA 4HUJA 3GN2A 3QLJA 2R7MA 1Q1NA 1ZH8A 1QR6A 4ZI7F 3KEOA 2X9NA 3FPLA 4O84A 3L4BC 3QP9A 5K9ZA 4NI5A 3WNVA 4WBNF 2FPIB 1MG5A 5L4NA 5EJ2A 7ADHA 1NWHA 1PJBA 1Z73A 2RHCA 3L4SO 4ONEA 4QECA 3IAHA 3WTBA 1I3MA 3I9OA 1LDYA 1ZCJA 2DPHA 4YAKA 4FN4A 4CODB 3VOTA 4J2HA 3E8XA 3JQ8B 1A71A 2BI8A 5LXTF 4AL4A 1U8XX 4E2YA 1T24A 2D59A 1F8FA 2FR0A 4NFYA 1I33A 4BMNA 2DBRA 2JD1A 3PJGA 4J6FA 1H6BA 3KLPX 3OM9A 5CAEA 2OMEA 2GDZA 1UZNA 2YZNA 5U1PA 3C24A 2BKAA 5U4QA 5JNLA 4MVJI 3G3EA 4RF3A 3IQDB 2OBYA 1JWAB 4IMPA 1IYZA 1P0FA 4MOWA 2DM6A 3ZU2A 4I08A 4I1IA 3QE3A 2R85A 4Z0PA 2BHLA 1Q2XA 1JLLA 2F00A 4ZA2A 4BO3A 1I8TA 2QW8A 4CLXA 3F4BA 3U9SA 1EE9A 2HUNA 2DZDA 5EMHA 5FYDA 1P1RA 1D4FA 2AE2A 3OP4A 2FWMX 2VWQA 3ZGYA 4CUZA 4AVYA 3RSHA 2J5KA 1YB5A 4UEKA 4XZ3B 1B3RA 5FFFA 2B35A 5KVQA 2X0SA 1QORA 3OA2A 5JDCC 1PL8A 3HJAA 1GYRA 2Q2VA 2NWQA 4ZHSA 2CVOA 4YJHA 4NFSA 3OJEA 1ONNA 3WGTA 3RUFA 4DPKA 2OHXA 3W4JA 5U9CA 1X0VA 4IDEA 3H5NA 4O83A 4AG3A 1AGNA 4OOEA 3CMCO 4E12A 5T6BA 3GAFA 5AVOA 1M0TA 2EEZA 4O0LA 4QFCA 5A9RA 1ZW1A 3O26A 3R23A 3D5QA 3LF2A 4FE2A 3V4ZA 3L77A 5FWNA 4HNTA 1ZKMA 4IIJF 3C3XA 4ND1A 3I1JA 5HBRA 1NTOA 2IP4A 4K6CA 1NVGA 1E77A 1QV7A 1Y5RA 5L4SA 3FRJA 3W4KA 3BMQA 2QG4A 1D1SA 3F1KA 5JCJD 4CLEA 2YFHA 4DBZA 2CDCA 4BB6A 1LDNA 5H81A 5HWSA 3F9IA 1RWBA 3HDQA 5L4LA 4E32A 3DAPA 3TZKA 1G0NA 2YHIB 4MV7A 3B1FA 3GVXA 3QQPA 4HV4A 1PJSA 1KERA 2OORA 1EBFA 5JC8A 3TL3A 3R9RA 5A4DA 3VH3A 4IXTA 3GN1A 3G1UA 3GNSA 4ZQFA 3JD2A 3U4IA 5IDQA 3FBGA 1M75A 1PWXA 4MA0A 3BMOA 2R7LA 3ZW8A 2R6JA 2YS6A 4JIGA 3INRA 3OJLA 1XQ6A 2GN8A 2P9CA 3N8DA 3KALA 2PLAA 3GC6A 2AE1A 2EIHA 3D64A 1GU7A 5A1TA 1JDJA 2XPCA 2H5LA 4F6CA 5COQA 2RH8A 2V6FA 3KVOA 4W4TA 3NTQA 1Z6ZA 2V65A 6LDHA 3C85A 1L1FA 3VMMA 1K6XA 4O63O 1R4NB 2HMTA 4DL9A 1GPJA 4NG5A 4H7PA 1O0SA 3E6AA 4N7RA 1IB6A 4O4HF 2PH5A 3D7LA 2VHYA 1AE1A 3CH6A 2EKPA 3K5PA 3ZWOA 2W8ZA 1R6DA 4QUKA 2V7PA 4J4TA 2YW9A 3BHIA 3P7MA 4BNZA 1UR5A 4MVJH 3RFVA 3U49A 3C8MA 2Y1CA 2NU7B 3HFGA 3T4XA 2IZZA 1KJQA 1XR3A 5I7SA 2VTDA 1XLTA 3WJ7A 3U5TA 1C1DB 2YQ5A 2YY7A 1ULZA 3Q1KA 1SEVA 1B2LA 4IPTA 4B4WA 2GGSA 3GHHA 4ZD6A 4BO8A 3HO8A 4B3JA 2RHRA 2PV7A 1X13A 1B8UA 4EJMA 1E6WA 4PRLA 2VWHA 3MEQA 4MIOA 2NQTA 4YDRA 1B7GO 1HETA 4TKMA 3W6ZA 3CIFA 3SLKA 1AUVA 2AG8A 3RU7A 4DMMA 1A7AA 1SOWA 4FFOA 4XDZA 4WCFC 1EQ2A 2GD1O 2YV1A 4R1UA 2NVUB 3VPXA 1E7SA 4BUCA 1H2HA 5G0TA 4R5HA 3IS3A 1KEUA 2YQ4A 4BGIA 4LK3A 1M67A 4J1TA 1YB1A 2YL2A 3PRJA 2GNAA 4NK4A 4WE3A 3JQAD 4ND4A 2YZGA 5G4LA 4CLRB 4NK5A 4F45A 1ZSVA 1H93A 1PR3A 1WP4A 4JP3A 1EUCA 2AQHA 2P68A 1VE9A 2RCYA 3EGOA 4J7XA 4TRJA 4YAJA 2EKLA 4HADA 5B4VA 2D2IA 4RVUA 4OKNA 1ML3A 1NQ5A 3O9ZA 3VH4A 3UW3A 1YRLA 4II3A 4QSHA 3WO1A 3DOJA 3I52A 3SC4A 3KUXA 4RZHA 2Y0CA 1H5QA 2Z1NA 1E7MA 3ASUA 2Q4EA 5A9SA 2D5CA 1XA0A 2PZKA 2IDZA 4U5QA 4LCEA 1JQBA 4YRAA 4AJNA 3QVOA 4L1KA 2C54A 4Z9XA 3KYCB 2VUTA 4KTTE 3C7CB 1DIKA 3I4CA 2ZDQA 3DL2A 3QVSA 1KBLA 1DIBA 1LSJA 2ZTVA 3PHLA 4MVJF 1U5CA 4YB8B 3L9WA 3PHIA 4YT4A 1WW8A 1IHYA 2O7SA 2FPPB 1SCUA 1ZK3A 4LRTB 4O2BF 2BD0A 3KO8A 1RM0A 5JAQA 3WFIA 5TT1A 2I3AA 1EK5A 1HE2A 2G76A 1EUDA 5DOZA 4XYLB 4BO4A 1HT0A 1DFGA 3WIEA 3DHYA 1LXCA 5IZCC 5A03A 1ENOA 1YB4A 1M6VA 4CMIA 2V59A 1A5ZA 2WTBA 3GNQA 3HBLA 1J0XO 2WDZA 2VWGA 2CZCA 2VOEA 4IDDA 1CJCA 1HTBA 2C7VA 4XJSA 4XR4A 5JVLA 2O3SA 1ISFA 4W9NC 1AUPA 3SJUA 3Q6IA 1I3LA 1HE5A 3F6YA 3JYQA 5JO9A 4Q3DA 5L40A 4JN6B 3ZCXA 2D0IA 1BWSA 4I5FA 2FR1A 2GN9A 2YRXA 3B1JA 2ZYDA 2QRLA 3OQ1A 3DDNA 1C3VA 1Z75A 1U4SA 4CM4B 3R3JA 1UXHA 3AUSA 5KX5F 1WWKA 5CDSA 5IXSA 5JDCA 3DAFA 1JVSA 3JRXA 3IJRA 3KV3O 3GMSA 2EGHA 3JQGA 4LVUA 2WM3A 3ONFA 1CQIB 2LDXA 4M8SA 1I32A 2EP5A 3BMNA 3AY3A 4MVJD 4UUOA 4P8RA 2IRWA 1M6WA 1E5LA 3ZWCA 3GZNB 4W82A 4M54A 1T2AA 3GAZA 5DDIP 3T4EA 2EF1A 3ZWMA 3UCFA 3GZ4A 4ILKA 4IJWA 4DLKA 4XIYA 4IDFA 4WK6A 3AU9A 3RKUA 4BS9A 1H2BA 4EYEA 2HJWA 1F14A 3BMCB 4DYDA 2Q4BA 4QX6A 3VTFA 4GMFA 1SAYA 3NRCA 2J3JA 4E0BA 1KC3A 2I80A 1T2DA 3DFUA 3ZWYA 4YT8A 3FI9A 4R9RA 1DB3A 4CMEC 4QSMA 1ADFA 1X1EA 4MVJE 3M2PA 4GWKA 4UUMA 1C0LA 1ZEJA 2BGKA 5DZSA 4K28A 3Q9NA 2RH4A 1DC5A 1H0KA 5JY1A 3GEMA 1B3BA 4PG8A 3K30A 1OAAA 1P9LA 4WLUA 1EVZA 2B0JA 3QA9A 3WBFA 4E31A 1P1JA 2VCYA 2I5PO 1P1IA 2HO5A 3PQDA 1YKFA 1CETA 2GASA 4NYEA 4B3HA 3EVTA 3DBRA 4PIVA 2C82A 3LT0A 3ICCA 3ZWPA 4PVCA 2VOJA 1QP8A 2WD7A 5CB4F 4I9NA 4DPLA 3RUHA 1W73A 1UDCA 1GL3A 2PZMA 2NNLD 3Q2IA 2YRWA 5JAZA 3RC9A 4GBJA 2EV9A 5B1YA 5CG1A 3M2TA 4WNCA 2I87A 1JVBA 2E82A 1HLDA 2PNFA 3E1KA 5L3ZA 1VL6A 1KS9A 4YJGB 5TRTA 2O3UA 2Y93A 2VRCA 3RUPA 3MTGA 1E1LA 1DRVA 3GGGA 4XWYA 5J23A 4PLWA 4MKXA 5A02A 2BMAA 1MUUA 3I9NA 3HHPA 1C14A 3LQFA 3TWOA 3ZH2A 1NNUA 1ULUA 3W8DA 4E5YA 2JD2A 1LDGA 4NHEA 3S2IA 1DLIA 1K0UA 4YAIA 1JKFA 3VPCA 1E6EA 4IIUA 3ABIA 5DN9A 4UUNA 1Q0LA 3WWYA 3KYDB 3I9LA 1NR1A 4E2XA 1EVIA 4CR6A 1U7TA 1Z2PX 2BELA 2IEDA 3VZRA 5ER9A 1QYDA 1YBAA 2FSSA 5DMXA 1GZ3A 2EJVA 3E9NA 1XQ1A 3OIGA 3H8VA 2J3IA 2GERA 1PGNA 5EESA 4CL3A 4BNKA 1XG5A 1Q0QA 3MJEA 1QKIA 1EHIA 4WPGA 4WCFA 5ADHA 5A06A 1IY8A 4WNIA 5HS6A 3UN1A 1YDEA 1BDMA 5DF1A 3DR3A 3F46A 3P19A 3RROA 5EQDA 4AJOA 4PG4A 4XRGA 1OMOA 1PJQA 5KNLA 1E6UA 2DPGA 2Z5LA 2Z95A 4E13A 5LOVF 5JSFA 2HDHA 1VKNA 2OFPA 4LGVA 4CV2A 1W6UA 3U09A 4TZKA 1DEHA 2VYND 4KP7A 5F21A 5C1OA 3H4VA 1FMCA 4Y67A 3UICA 3ZDFA 3NKLA 4JP2A 1NWCA 4AJKA 4TWRA 5EL0A 5JC1A 4E5NA 4BNVA 3EHEA 4TUYF 3LDHA 4IQ0A 3KTDA 4QO7A 5DULA 4KWHA 5JYDA 4J0FA 2CUKA 4FBGA 4OXNA 1NQAO 4EZBA 3GDGA 1JDEA 3FTPA 2ZB7A 2ZJ1A 1PZGA 4E5PA 2HU2A 4CV1A 1P0CA 1YOVB 5HM8A 5DBFA 1MP0A 3DBHB 4WLEA 4M9UA 4B4VA 1K6IA 1Z7BA 4PLZA 1HEUA 4FU0A 4I50F 4RZQA 4NZ9A 2WD8A 1C0IA 1NXQA 5BNIA 1RM4A 1M0WA 3RFTA 4DIOA 1O95A 4R4JA 3IMFA 3VPBA 1DIGA 2HMWA 1KVUA 3JQ7A 3KRTA 4PG5A 2AHRA 1HDOA 1CERA 5G4KB 4YBZA 5IZCA 5ICMA 1I5RA 1M2WA 2G82A 3GDOA 4M49A 4DXHA 3GUCA 4JCOA 2GQRA 4EGJA 5DNAA 5DCUA 3JQAA 3VPGA 2ZIZA 3TF5A 1W96A 4RVHA 4TSKA 2NVBA 4MKZA 4PLYA 4CPDA 3NUAA 1WR2A 4XKJA 5AXBA 3ETGA 1T36A 3TFQA 5EPOA 3KSZO 1HYGA 2CMDA 5EINA 3U0BA 1ZSYA 4PZEA 3PQFA 4O6VA 4W9NA 1D8AA 4B3IA 4O7TA 5CFZA 2ZB8A 1YH3A 1ZXLA 4C7KA 3Q2OA 3BAZA 4GH5A 1NHGA 3IP1A 4CLHA 2VNSA 4RPHA 5T57A 1FDWA 1B6SA 5C3MA 4BO1A 3K2EA 3VTZA 3H9QA 4DMLA 4MIEA 4BNJA 3PJEA 3LT2A 4BO5A 2Q3EA 4IGEA 4CR8A 5L45A 4MV9A 3GF4A 4MINA 4OQZA 1B14A 1HDYA 2DWCA 2R84A 3P5SA 4YA6A 3HG7A 4BOYA 2NV6A 3H3JA 1GUYA 1QYXA 6ADHA 2PGLA 1NX6A 1UUFA 2NU6A 1LLQA 2RBEA 1GCUA 1O94A 3FR7A 1D1TA 1GAEO 4W6ZA 1ISHA 5LCXA 1ISGA 2X23A 5LP6F 1ZK4A 4WEOA 4IQ8A 3RUEA 2YYAA 5JQWA 2X0NA 4J9UE 1EVYA 3K3PA 5TT0A 1IPEA 3AU8A 1Y5MA 2HRZA 1QYVA 4QXMA 1RJWA 1SMKA 2D5AA 2Q1TA 3NV9A 2FRDA 5BPFA 1ONOA 1BXKA 4MP3A 3NDIA 2AEMA 2C29D 4R69A 3A14A 2NACA 4OJNA 3K73O 3ZN2A 3WGIA 4FSHA 4H3VA 5EIOA 4I8XA 3LT4A 1QYWA 1A9XA 1Z45A 4X54A 5BSEA 1PK8A 1WVGA 3TNLA 4IS3A 4UVIA 4BO0A 5LDHA 3UHAA 4CMEA 2FPGA 5J2UF 1KVRA 2V6GA 3RC2A 1DPGA 3WGYA 1PQUA 2B4TO 2VT2A 1DOHA 3Q3CA 4DYVA 1EMDA 2H6EA 4Z0HO 1CQJB 4QTZA 3JYPA 1EZ1A 3PHJA 1K5HA 5GZ6A 5JXWA 1OC2A 2J3HA 2FP4A 2P0AA 2J8ZA 2Z1MA 4PLGA 3VOSA 4BV9A 1R4MA 4QEDA 4FDAA 3ZWBA 2Q49A 4TVOA 3OMLA 3S2EA 2VHXA 1SBYA 5G0WA 3DWFA 1BSVA 1J5PA 2XXJA 1QV6A 1GEGA 2ET6A 4DQUA 8LDHA 4FOSA 3UXYA 3COSA 4YAEA 1T4DA 1WDLA 1HKUA 1KVSA 2GZ1A 2A94A 2J5QA 2Y05A 4EEZA 1PGPA 4XYBA 3HSKA 4B79A 5EZYF 4O7VA 1SEPA 2JJYA 1OFGA 4I5GA 1GCOA 3SC6A 4E4TA 1HRDA 5T67A 5DP1A 1YBMA 3R5FA 4BO7A 2BFAA 4FGSA 2GR9A 3WYCA 1KEWA 2X5KO 4GX5A 5H83A 5JW6A 4FR5A 5A5EA 4XB2A 4TV9F 1J6UA 1BW9A 3UCXA 3DXFA 4DUPA 1VRWA 3LP8A 3H65A 1KYQA 1NQTA 3JYOA 3M1LA 4XYGA 4UVHA 4CLOB 3INGA 4HXYA 5A3JA 1QRRA 4XEHA 3D4NA 1XDWA 1XELA 2HMSA 2CD9A 4MV8A 1R12A 2IZ0A 3S55A 2PD3A 1ULSA 3TJRA 4DC1A 1C1XA 3GRKA 4FFPA 1RYDA 2Q99A 4BNHA 3N7UA 4GAEA 4RDIA 2HMUA 4EBFA 2C00A 1T2FA 3PTZA 5L95A 3ETHA 4GSLA 4YJFA 4BKQA 5JFOA 2O48X 3PWKA 4EUFA 3G0OA 5FF9A 1DLJA 4CMKA 3TOXA 1X1TA 4IXWA 4RZIA 4FC6A 3NDJA 2GN4A 4NNJA 1Y6JA 5BNTA 2X7HA 1DHTA 4HNHA 4OXYA 2LDBA 4XQGA 4CJXA 4E5KA 1IZ9A 4HFMA 1KETA 3LLVA 2HGSA 2WWRA 3WR5A 1E3WA 4WOKA 1JA9A 1KEPA 2FR8A 3DO5A 3U4DA 4BKRA 2W2KB 3ICPA 1XCBA 1ZO8A 3RC1A 1T4BA 3T7EA 4GQAA 5COBA 1ARZA 4XGNA 3UCEA 1JKJA 2EKQA 2OOSA 2VHWA 2Y1DA 2SCUB 5CP8A 3LT1A 4YVFA 2YV3A 3WNZA 3ASVA 5BSGA 4AJIA 2O2YA 3KLMX 1UAYA 3R6DA 2VYVA 4L0QA 3WBBA 1X7DA 2EJWA 5ER6A 3NYWA 4TKLA 5I9LA 4ZGWA 4LSWA 3NGLA 4LSMA 4GX0A 4RPLA 1BVRA 4RVGA 3A28A 5JS6A 4NR0A 4TVBA 4IZIA 4DC0A 1Y8QA 3UFXA 3N6RA 4BNUA 3PJFA 2DFVA 2BRUA 2WYVA 1GGOA 4FPXA 3G1TA 5CHEA 5AYVA 4BO9A 2YUTA 4OO3A 2PN1A 3S1LA 1MFPA 2QF7A 4DLBA 4K6FA 1HYHA 3V4SA 2Y1EA 3PK0A 3RASA 3DTYA 5TIIA 1ZK2A 5EN4A 2C5AA 2ZTMA 1XIVA 5BR7A 4WEQA 2CZGA 4BNMA 4BIIA 4L9RA 2C7GA 4ZRNA 3MWEA 3X2FA 2DKNA 4FGRA 4C5CA 1BNCA 1UXKA 3QSGA 1PR9A 4E30A 1HDXA 1TB4A 5A05A 3MOGA 3R3SA 1E3EA 2E37A 1Z82A 2VYNA 3AI3A 3IP3A 4M89A 3AJRA 4CQMB 2Y68A 3DMTA 2CY0A 3WGHA 3GGOA 4ZHQF 3EAGA 4ALJA 2GZ2A 2YHUA 2OBNA 4UAGA 4C5AA 1KY4A 1ZMOA 1SC6A 3R5XA 1A9ZA 2BF7A 2Z02A 4KDEA 3NUGA 2NU8A 2EHDA 4R1NA 1E1NA 1AN9A 3E5RA 1T1SA 4GKBA 4ME6A 1VBHA 1B15A 1GPDG 4RQTA 4AJLA 2B83A 3B20A 3SBOA 1LJ8A 4D79A 3UKOA 1HL3A 3U9LA 2Q2QA 3GFBA 4URFA 4UREA 4N5NA 4FFNA 2P9EA 4HFJA 3PGJA 3D3WB 1KUTA 4I9UA 3DEYX 1ENPA 5ILGA 3RUIA 4RDHA 4ZVVA 1N9GA 4EW6A 1MXHA 1ISMA 3KOUA 3NAQA 4CMAA 4OHUA 1V3UA 3G17A 4XJTA 3FSRA 3VVBA 2P5YA 3R1IA 1JTVA 1KJ9A 1T1RA 4OMUA 3PYLA 1UXGA 3GIDA 3ROKA 8ADHA 5AXCA 4O7NA 4IY1A 2PGDA 1TT5B 1GY8A 3MWDB 1PZFA 3EUWA 3ROMA 1NVMB 1FDUA 3CINA 3F47A 3H9UA 3JD0A 2JCVA 1T2CA 1U3UA 2WSBA 4XA8A 5JH7F 5EQFA 1E4EA 4NJOA 2PZJA 3W6UA 4CQLB 3PLRA 3LK7A 2PZLA 4RLHA 5L51A 3GVPA 1XGKA 2CNVA 3SVTA 1JAXA 3LC7O 3DF7A 4NJMB 3TPCA 3K5IA 4FFMA 5AXDA 4JX8A 5COAA 2ZJ0A 1I2BA 4GX2A 4OH1A 4E5MA 3AI2A 3DHNA 4ALNA 5MGBA 2R7KA 2X0RA 1MFZA 1GQYA 1VJ1A 4XGIA 2WEKA 3VVCA 1GFSA 1S7CA 3EZYA 2FSVA 3O03A 2JAHA 3BYZA 4GI2A 1L7DA 2A35A 3GG2A 4XYEA 5ES3A 1TLTA 1NPYA 4BVAA 1NHWA 2PFGA 3OIFA 1ZVMA 4YEDA 4AJEA 1MA0A 2WYOA 4DWVA 2QX7A 4NBVA 3CPSA 3H5RA 3EDMA 1KJ8A 1X15A 4DQXA 3ORFA 1PIWA 3AM3A 4O81A 4GVXA 4TMFA 3RWBA 1XKQA 3ST7A 5DCYA 1DO8A 2W6QA 3PZRA 4IDBA 4Q3CA 2AG5A 3F1LA 4O82A 1VI2A 4MJLA 1BXGA 1E1MA 3H6KA 1KJJA 2PBZA 1GTMA 3VZPA 2ZYAA 4HKTA 3VC7A 1I30A 1IULA 1NFRA 4B7XA 3MJ4A 2DTXA 2BLLA 4OXKA 1PGQA 2VQ3A 3ZU5A 1Y9EA 2CNQA 3Q11A 3ZWAA 1LQUA 4RPKA 1A72A 1E3LA 1JWBB 3AOEA 4RVFA 3TIGA 3VPHA 4CL8A 3PFFA 2JFGA 3QWHA 4KUEA 1WDMA 5DCWA 2FPIA 5ICSA 4J2OA 4Y8VB 4G81A 3S2FA 4MV3A 3KSUA 4GGPA 4CR7A 2JD0A 3Q1LA 3RV3A 3R0IA 4HFRA 4RF5A 4XCVA 3PP8A 1PJ4A 4BKOA 1FXSA 4MP6A 5DBGA 1DSSG 2NU9A 3TN7A 2PH3A 5JE8A 4CV3A 4Q3EA 4PLFA 3JQ8A 2ZDHA 1DV1A 4CM9D 3ZI0A 1MGOA 1YBVA 1VJTA 3U62A 1VKZA 4C7JA 4HBGA 2UAGA 2GCGA 3ADPA 3E9MA 4BO2A 1HDRA 3LC2O 3BTVA 4OL9A 2IXBA 3E5MA 3FR8A 3EVNA 1PTJA 1Z74A 4Q3AA 1GLVA 3JQFA 3ROQA 3GH3A 2X5JO 3MCVA 4RPJA 2Q1SA 2NUAB 5T8KA 2YFQA 1CE8A 3W8FA 3CXRA 3ZV3A 2ZCUA 4GSKA 4PFJA 5ITWA 2UUOA 1YL5A 3N74A 4L76A 1TEHA 2GLTA 5DBIA 1LUAA 5BQFA 3NTOA 1U9JA 3WNQA 2P9GA 4XYMB 1E0DA 1FDSA 4DBVO 4DVJA 4N18A 5GY7A 3TQTA 1RPNA 3BHJA 1M76A 2JHFA 3OJ0A 5H80A 1GR0A 4R9SA 1LI4A 2EW2A 3UF0A 3ONEA 1N7HA 1LC3A 3WMXA 1Y8RB 3ITKA 4KTVE 2CDAA 2E4AA 5L9AA 2WE7A 4FCCA 4JJFA 4B8WA 4E4YA 4XZ3A 3E03A 3ZWWA 3MJVA 5JY6A 1CS0A 2NTNA 1N8KA 4EEXA 1V0JA 2DIKA 4IINA 5LA6F 3AY6A 3I6QA 3AFNA 4MPDA 2OZPA 4YR9A 1WNTA 1YONA 4GMGA 3GY0A 3TDKA 2VRBA 4WLVA 4R1SA 4CM8B 4L75A 2H1SA 4D7AA 2WYWA 3PFWO 3I3OA 2Y0DA 1GEEA 4JROA 4N54A 4M87A 2FY8A 4A73A 2P2SA 4BV8A 5C7IO 4O7LA 1DAOA 1ENYA 4JK3A 2NU6B 1WAMA 3GLKA 3VKVA 4D42A 1DC4A 5HV6A 1D7OA 5GZ1A 1PS0A 3EYWA 3KM0A 3T7CA 1PJ3A 1TVEA 2X0IA 4XD2A 1GUFA 1E5QA 1I10A 4OIMA 2BH9A 4XQCA 1TA4A 1MC5A 5GONF 4DREA 4EGFA 2FB9A 5TJ9A 3GMDA 4O7RA 4BGUA 3BIOA 3L6EA 1U28A 2GRAA 2YHIA 3JD4A 4WLOA 4ZQGA 2GO1A 2J3KA 4QO8A 4RV9A 4TRRA 4PCVA 3RIHA 3QW2A 1ZSNA 5AQ1A 3OQ6A 4CM1A 2UV8A 5KVVA 1HE4A 4CMCA 2I65A 4ND3A 1Y81A 1QG6A 4E3ZA 3DZHA 4BB5A 1NFQA 3FWZA 1DHRA 2IXAA 1ZIDA 1LLUA 2TMGA 3DQPA 2IYPA 4MP8A 5TLSA 3TIIA 2GSDA 3ZNNA 2CF5A 2B5WA 2Y66A 3G8CA 3O4RA 3OEYA 2HLPA 4MVJG 3L07A 2PTGA 2Q50A 4YTEA 1PGOA 5L7YA 4D3FA 3INTA 1TT7A 9LDTA 1PZEA 3WFJA 1UJMA 1B16A 3AW8A 3CZRA 3HN2A 1XU7A 4LMRA 5F5NA 5L7TA 3FNHA 1R4NA 3DOCA 2G0TA 2W6PA 1LLCA 2H9IA 3GPIA 5IYZF 2UYYA 1Q7BA 3KAKA 3I9MA 4FQ8A 4PLCA 4TRNA 4M55A 3HFSA 1MB4A 1ZUD1 4GWGA 1LRKA 1I7LA 3ADOA 2Y1GA 4FJ0A 2JFFA 4UULA 4A5OA 3WS7A 3ZWVA 2NU7A 5CG2A 5JCJA 3GGPA 4Z9YA 3MJCA 5KWEA 3KREA 1NM5A 5IN5A 1C1DA 4U6QA 2JCXA 4XX0B 2YZMA 1FDVA 3GUYA 4ALKA 5I7EA 2O3RA 1OBGA 1K3TA 4Q9NA 1C0KA 2X0JA 5C5IA 1B6RA 3WQQA 1MX3A 3A4VA 3QWIA 2RAFA 4NU5A 1NPTO 4S3MA 5B37A 1CDOA 1O6ZA 3KZVA 1YQXA 5IG2A 3CUKA 4W7IA 2NVUA 4JBHA 1U3VA 3UGKA 1F8GA 5A5FA 2W6OA 1IE3A 1UXJA 3O8QA 3AK4A 2W71A 4NBTA 3AUAA 3KB6A 4WUVA 4D3DA 1I3KA 4Z0TA 5TS3A 1HLPA 4CLRA 4O4IF 2R00A 1FDTA 3I9JA 5G0UA 3VZSA 4DIBA 3C7DB 3JV7A 3DONA 3GT0A 4IM7A 4RVSA 4BQRA 1V8BA 1RYEA 3VZQA 1HDZA 1MV8A 1GQ2A 2X4GA 4IJKA 4PG7A 4YAKB 2GPSA 1V35A 3WQRA 3EY4A 1JAYA 3GDFA 3STHA 4B4UA 1OBFO 3MZ0A 1A48A 3GRPA 2G1UA 4FW8A 3DC2A 4Y6SA 2UDPA 2PY6A 2OLSA 1OZAA 3DZGA 4YWJA 1KOLA 2B37A 1N2SA 5KCZA 5CAEB 2Y1FA 3H7AA 2EW8A 3K2BA 2B4QA 2WYUA 1AXGA 3KYCA 4AFNA 1P31A 1P1HA 1LSOA 4HWKA 4J49A 4R1TA 2O3JA 1O5IA 4NDNE 3P2YA 3D5TA 1HE3A 4NPCA 3F5QA 1N1EA 5I9MA 1PGJA 2P5UA 4JXKA 1JLLB 1UP6A 2DBQA 2HMVA 2Q2WA 3DBVO 5JYEA 5I8ZA 4EJ0A 3ANNA 1PZHA 4HNUA 3RQSA 1UP7A 4TZTA 3EZLA 2GPTA 1DFIA 1Q7GA 2DU8A 2ZATA 1DXYA 4YJDA 4MA5A 2OUIA 2B69A 2FOIA 2P4QA 1U8FO 3IIEA 2QIOA 2CF6A 4YJHB 3H2ZA 3GVHA 1D3AA 3RUAA 3DMTC 3ZNOA 2YZ7A 1LSUA 1NFFA 2VTEA 3D4PA 4ZQIA 3WTCA 2FN7A 4J43A 1UDBA 4JBIA 4ALLA 3KAJA 1KC1A 5C37A 5IDWA 4A2CA 1VL8A 1EFLA 4E2WA 3TSCA 1NR7A 3H9EO 4JLWA 2GZ3A 1VBGA 2AQIA 3PYXA 4L74A 3JZFA 4Y6PA 5FI5A 4ND5A 3E82A 2JAPA 5B4TA 3QJ5A 2CVQA 4CM4A 3MJFA 3KXDA 5HBRB 2P4HX 3LC1O 4U6SA 5A3VA 4NIMA 4OOFA 4FJ1A 4PVDA 4DTIA 1X14A 2XCLA 1YS4A 2IODA 3BMQB 1CQIA 4IS2A 3AUTA 4ZQBA 5LYJF 4R3WA 3JYNA 1U4OA 2IZ1A 3GZNA 4JQCA 3IUPA 4L4SA 3GEDA 1LDMA 3AX6A 1AHHA 3IC5A 4IIVA 2NU8B 2VT3A 4MIYA 3ENNA 4QFDA 3EK2A 4O7YA 2D1YA 3OEWA 1LTHR 2HQ1A 4PGFA 4CM9A 5CDUA 4XQ9A 4RVDA 3RKRA 2V6MA 3HNPA 5F3RA 3BMCA 2IEBA 2VZ9A 4XIJA 4IDGA 3W1VA 3ZHXA 3BMOB 3JRWA 2W2LD 3GK3A 3NEPX 2ZQYA 5CEFA 5I7VA 1A4UA 1AXEA 1KJIA 1CF2O 3QVXA 1SO8A 1HDCA 2NADA 3NT4A 4D41A 5IDXA 1WPQA 5IDYA 1R16A 4N5LA 4E33A 1UZLA 4BNXA 3OUZA 4O2AF 3BTUA 4FJ2A 4WOJA 1I24A 3GLQA 2WJPA 3OIDA 2Y67A 3WSVA 2O4CA 3F5SA 4Y9DA 3SLGA 3DBLA 4BKUA 4P22A 3IJPA 1LNQA 3HB4X 3AFMA 2YYYA 3WB9A 1C3OA 1DRUA 1HSOA 4J4BA 3DZFA 4FD3A 1PWZA 5I9NA 4R51A 3ANLA 4RF2A 4XR9A 4HY3A 2DLNA 1E1KA 2R86A 1KEVA 1P33A 2I76A 1P74A 1EEHA 1VJ0A 2NM0A 4J7UA 4PZCA 4MVJA 3HDJA 2C07A 3OETA 1SB9A 4QQRA 3PJDA 4YJGA 4L4RA 4FOOA 4LN1A 2ZYGA 4YQZA 3KBOA 3ZW9A 1F0YA 2IYOA 1LRLA 4PZDA 2EG9A 2X9VA 4AJ2A 1PSDA 1XYGA 4WECA 5BPHA 2YJZA 2ZCVA 4I5EA 4UEOA 3FNEA 2Q1WA 5F1PA 3KSDO 5AXAA 4EITA 4EG0A 3L6OO 3DHEA 1IOVA 2GQSA 1GV0A 4O1MA 4ZQHA 1NASA 4BNWA 1X0XA 2FZEA 2OGUA 2QYTA 3U3XA 5K6AA 1X7HA 4L4XA 2CNUA 3PXXA 1IZ0A 2YW2A 4GL4A 5IAAA 2O50A 2Y0EA 3KYDA 4JJIA 2YZLA 2F1KA 4K9DA 3UOGA 3ZWXA 5J2TF 3AOEC 3GG9A 3DZIA 3GOHA 2CSUA 2ZTUA 4P4GA 4ZOLF 1MG0A 3QWFA 3TZQA 4Z6KA 3VHRA 5THKA 4A26A 1H6CA 3PEFA 4BKPA 2DVMA 3QHAA 4TRMA 1M66A 1EUCB 3GEGA 4NH4A 5G0VA 3RBXA 4MAMA 4YAJB 2I6TA 3QWBA 4IJVA 4Q3BA 5FEUA 1HXHA 2PGJA 2O4UX 4FFLA 2X1HA 1BTOA 3K31A 3I23A 3JCZA 2GYYA 5JMWA 1LDEA 4YT2A 4U0KA 3W8EA 5A9SB 5FI3A 4D44A 3CEAA 4MVJP 3AM5A 2HK7A 1QLJA 2DT5A 3ROPA 1A9YA 5CPBA 5KJFA 5CA0F 1XEAA 2DLDA 4JNKA 4DIFA 1FK8A 1OOEA 3OUUA 4XB1A 4CMBA 2XAAA 3JQFC 3NTRA 4CQMD 3EMKA 5HS4A 1E7QA 3WGOA 4LCJA 3TRIA 5FNVF 5T8KC 1U3WA 1CEQA 2NU9B 3FHLA 4HFNA 3GFGA 4Z3KA 1SCUB 2XXBA 4L73A 1ISJA 2UVDA 3LWBA 2JKVA 4IQGA 4A7PA 1GDHA 2XF8A 1U2GA 1BVUA 1EUDB 1YE3A 3ZV5A 4AJPA 1KEEA 1YQGA 4FFRA 1WZEA 5F5LA 1EUZA 2E49A 3SEFA 5JBIA 1WDKA 4IDCA 1M6HA 3AW9A 3BA1A 1YOVA 4YJ3F 3S8MA 4CMIB 1HZZA 3MJTA 4DPMA 3BG5A 4DGSA 4Y6RA 1EYZA 4GKVA 1T2EA 4J9VA 3WO0A 1JW9B 3DBHA 3NDRA 2OXIA 3WXBA 3I5MA 1JDBB 1A7KA 3PLNA 1ZXBA 2DBVO 4YQYA 3FPCA 1CWUA 2DQ4A 3AY7A 1E7RA 2C0CA 4W99A 1PQWA 3EW7A 3PYMA 1PL7A 2E48A 4Z9FA 2VQDA 4OSOA 2J5RA 3D4OA 5JDIA 3KEQA 4CUKA 1IPFA 3IUSA 3L6DA 5G4KA 2FMUA 3ONDA 1GQQA 4P38A 3KYBA 1FJHA 3PHGA 3VPSA 1GADO 5C1PA 2WE8A 1NBOA 4I55F 4U8GA 3VH2A 1LBEA 2A92A 1DC6A 4RF4A 1IOLA 5ITVA 3ZNPA 2C5EA 3JQGB 4ESOA 4YCAA 1ZNQO 2DTDA 2HK8A 3BMNB 4BMVA 3RV4A 3FNFA 3JD1A 2BFOA 5IXYA 2NSDA 4BNTA 5JAMA 5IF3A 1YQDA 2VRCD 3K6JA 1I01A 4J3FA 3V2GA 2VPQA 1ZK1A 1DIAA 1N7GA 3PWZA 1C30A 4PLTA 2B5VA 3H2SA 4BNIA 3JQ9C 3AWDA 4YPOA 1SOVA 4HNGA 4WJZA 4RQUA 3IKTA 5A04A 2QYSA 4HQ6A 5B4UA 1ID1A 2V6BA 2CFCA 1NQOA 1EBUA 3C1TA 3ITDA 4J1QA 1ZFNA 3ZHZA 3LYLA 2AEFA 1YL6A 4BNFA 3B70A 1QLHA 2QQ5A 2QZ9A 1AUXA 5JVDF 3VA7A 1RKXA 1VKOA 3HWRA 1LSSA 1I2ZA 1Y9AA 2O2SA 4ROSA 3RI3A 4D45A 4CMGA 1XU9A 2W6MA 4FIZA 3VDRA 3WG9A 3G49A 2HRBA 1I3NA 3HE3A 2HKIA 3DBRB 5G2OA 1DDOA 4RLSA 1AHIA 4HX5A 1XSEA 1DRWA 1GZ6A 1JKIA 2EERA 2WD7B 4UUPA 4ALIA 4K1LA 4O7WA 3JQEA 5CDTA 1CIVA 5CDGA 4R3NA 4J1NA 1VSUA 1ZJYA 1HWYA 3D3EA 4OGWA 5I8WA 3NJ8A 5KIAA 1SZJG 2ZTLA 1I36A 3JQDA 4II2A 2NQ8A 1G6KA 4JGBA 4I9HA 1W0CA 1DIRA 4WCDA 3MOIA 3U54A 2QHXA 4RORA 1VPDA 2GF2A 4IZHA 4OKIA 3UAGA 2X8LA 3GHYA 1CQJA 9LDBA 2OP0A 3BZUA 3I6IA 1K89A 1YDWA 3FD8A 4IGFA 1B0AA 1V9LA 3JYLA 2W98A 1YJQA 1I0ZA 3NT5A 3U9TA 3B6ZA 3OQBA 2X6TA 3TZCA 2VN8A 3PPIA 5JO0A 3AOGA 1GUZA 2PK3A 4NU6A 3U4HA 1PX0A 4QT0A 3VH1A 2Y1OA 1U1IA 4ZJUA 3EC7A 4WKGA 3SX2A 2I3GA 3BHMA 2JHGA 4UEJA 2B4RO 3DZBA 3ENKA 1SNYA 4LRSB 2BFPA 2VR1A 1R37A 4XRRA 3ZU4A 1R0SA 4G5HA 4B7CA 4KQWA 3JQBC 4U7WA 2PA3A 1V3TA 2BGLA 2O23A 1L7EA 1GYQA 3V1YA 1EVJA 3FBTA 5DOVA 5ENVA 2PKQO 4TV8F 3QVWA 2R00C 3I9KA 4OM8A 4YAGA 2FZWA 2X9GA 5LC1A 5B12A 3P2OA 1O9BA 2D3TA 4WCFB 2W90A 1U5AA 3CTMA 3ZWNA 3JSAA 4EUHA 2W2LA 5THQA 3F4LA 1NAIA 5KKCA 3ETJA 1RM5A 2I8CA 3O8QB 4J16A 1K6JA 1P44A 4J0EA 3HADA 1LX6A 1QYCA 3S2GA 4CLOA 1PX2A 5BSHA 5DP2A 1W93A 1LRJA 2A4KA 4INAA 4N5MA 2POQX 5JQGF 3PHHA 1ZEMA 3B1KA 5JLAA 2FHSA 2O3QA 4R41A 4UVEA 1DIHA 1E3IA 3WJAA 5T64A 2EXXA 1ZJZA 3VKUA 3NX4A 3AUUA 2QK4A 1NP3A 1N1GA 2GN6A 2A9FA 1YO6A 3CSDA 1HDGO 4ZN6A 5KVSA 1UXIA 3DOOA 3L4BA 4DQVA 3Q2KA 2PR2A 3PDJA 4F3YA 2HJSA 4YRDA 1ZZEA 2HCTA 2R7NA 3ORQA 4D43A 5IFLA 1U7HA 3FWNA 3WOHA 2ZQZA 4ALMA 4A0SA 4BNGA 4O86A 3VAZA 1NAHA 1YJ8A 3TINA 2JFHA 5JMPA 3LF1A 2W2KA 5AOVA 3ULKA 4W7HA 3DTTA 2DUWA 3JQ6A 1E7YA 1R15A 3HN7A 4S1VA 2OP1A 5EERA 5TF4A 5ENDA 1W8DA 2PD4A 3V1TC 2ZDGA 2SCUA 3LU1A 3E18A 2V5AA 2DFDA 1WXDA 3A1NA 2YS7A 3JQ7B 2VZ8A 3M1AA 1KIFA 3PI7A 4IDAA 3V2UA 5CA1F 5DT9A 3NT2A 4YBZB 5L7WA 3AM4A 3RFXA 1I2CA 2CDBA 4LW8A 3DFZA 3TZHA 3KETA 1H9AA 1UDAA 3IOYA 4L8VA 5TX7A 3GA0A 1BMDA 3JQAB 2DBZA 4D0RA 4IHJF 3HZZA 5IZ4A 5MDHA 2W6NA 2XD4A 4R5MA 1EFKA 2DC1A 4KUGA 4PN3A 3RBZA 2Y99A 1HYEA 5A9TA 1HZJA 4O4JF 1Y1PA 4FB5A 2OL4A 1JU9A 2OO5A 5LDGA 2VZ0A 4HR7A 1NVTA 4CLDA 5G0SA 1WMBA 4KDFA 4BO6A 2NTVA 4IMRA 3WGZA 4GX1A 4ID9A 3HQ4O 1HF3A 3E48A 4I4TF 4FC7A 5JPIA 4BGEA 5C8YF 4GVLA 2EWMA 2WMDA 2X58A 1DFHA 3RJ9A 3WYBA 1KVTA 1Z2NX 1PJ2A 3ETEA 4MDHA 3CKYA 3DMYA 4WLFA 3ZHBA 5IN4A 1KBZA 5HTOA 1YVEI 2PVPA 2ZB3A 3OHSX 4CQMA 1NPDA 1YL7A 3WSWA 2P91A 4G2NA 1ADCA 3TOZA 4O4LF 5CEJA 4OAQA 1ZBQA 1P77A 2H63A 2X5OA 1EK6A 4YT5A 4B4OA 4E21A 1ONPA 1GYPA 1SPXA 2BFMA 4YRBA 2ILTA 4GGOA 1VSVA 3R5HA 1UAGA 3JQ9A 3H5AA 4BGVA 3HB9A 3WQSB 4KZPA 4YACA 2ZK7A 4NBRA 4JBGA 2ZKLA 5BNFA 2FPGB 3D3WA 1DC3A 4BQPA 1RM3A 2VWPA 4DIMA 4J91A 3OF2A 5T5QA 2C20A 1QMGA 2HK9A 2HJRA 1DAPA 4NQZA 3KHUA 3UVEA 1VM6A 1GD1O 3FN4A 3PDUA 4GLOA 5KKAA 4D3SA 1BHSA 2GUGA 2FP4B 1F12A 1ZK0A 3NJ4A 4B8ZA 1NYTA 3DZKA 4MV6A 4CMHA 4GLLA 1Q7CA 1R4MB 3DBLB 1Y7TA 4RCVA 3QVTA 5TC4A 1UH5A 3QWAA 1LQTA 1TT5A 3MWDA 2GLXA 3V1UA 3QIVA 4MVJM 5C7LO 3ZU3A 2RIRA 3K92A 3SJ7A 4PLHA 3TQHA 5JAIA 2Z04A 1WLYA 1T26A 2C59A 4RO0A 3TL2A 4Z3DA 3U4CA 4J1SA 4RPGA 4CQLA 3LLSA 4A27A 1MXFA 5K6AC 5HA5A 3E5NA 1PS8A 4F6LA 1VC2A 3H3FA 2PKQP 3RFCA 1ADGA 4HNVA 1LC0A 1W4ZA 1XWFA 2BI7A 3DAGA 4J90A 4NJMA 4YYZA 3TFOA 1YWGO 4Q3NA 2AA3A 3HB5X 3WIDA 3HDYA 1ZMTA 3V2HA 3PGXA 3RUDA 3RC7A 2B36A 5TNXA 1IOWA 1BG6A 2Q46A 4DA9A 1BRMA 1WZIA 4IUYA 3C1OA 1GSHA 3JD3A 4ZICA 5TJHA 1E92A 1BW9B 3A9WA 2YDXA 1BGVA 2O7QA 5BMVF 3RUCA 3K9QO 1R66A 4LMPA 1EDZA 3GNTA 1EDOA 2VYVD 4ITUA 2R2GA 1E3SA 2AMFA 3H9JA 3JQBA 3MJSA 3U55A 1FF9A 2J6IA 2R87A 1Z2OX 3UH1A 4C4OA 2X86A 4NFHA 4XDYA 1EE2A 2VUSA 4ND2A 4CM6A 3JTMA 1C1XB 4AICA 2R82A 3WGGA 3GPDG 4K26A 3SXPA 4HP8A 4LVCA 4O7SA 4YXFA 1V6AA 1B8PA 4O5OA 2AW5A 5KOIA 2UUPA 3ZZNA 1BDBA 1BXZA 4YJFB 1ENZA 4I5DA 4WGGA 1GSAA 1Q0HA 4BHTA 1LA2A 2VNAA 3IDSA 3LSYA 1EQUA 4PLPA 1MLDA 2DUUA 2X22A 3RVDA 3DZJA 3TW6A 2NVWA 3M6IA 3PIDA 2BGMA 3ANMA 1OC4A 1P45A 2C2YA 4TROA 1OI7A 3OJOA 5TQVA 3F3SA 4H16A 4Y8VA 1KY5A 2I9PA 1H94A 2AXQA 3DB2A 4R01A 1YXMA 3VDQA 1E3WB 4EGQA 3AI1A 3ETDA 4KQXA 3K5HA 5D8DA 1TXGA 2GPWA 1ISIA 3ZHYA 4A03A 1O89A 4YB8A 1JKJB 2QRKA 3CMMA 1QXSA 1J49A 3L9XA 2FPPA 1F17A 4AJ4A 4R16A 1CRWG 2EP7A 4IZOA 1LEHA 4B7UA 3SE7A 3BTOA 1A27A 5I7FA
chains in the Genus database with same CATH superfamily
4ENPA 3M9WA 1EFVA 2IE0A 4TTSA 3U4MA 4XYLA 4OQLA 4FIDA 2EZ4A 5DYYA 3MLBA 4DWWA 2H16A 2HRQA 4M86A 3DAYA 5CVEA 5ILOA 2I8AA 4LAFA 5F2OA 1P72A 1S01A 3VPDA 2JGKA 3OLVA 3SIWA 1C0PA 1Z2DA 5M5BA 1AS3A 1FYFA 2FOXA 5GGYA 3B7PA 1TUGA 4R8MA 2O0MA 5CTJA 5L53A 1DJQA 1Y1RA 3R41A 3A9RA 2IP1A 1S2OA 3B8EA 5BSFA 4AI6A 1WXGA 4LGYA 2EFCB 5JNTA 1U8TA 3PWSA 4XYMA 1XTZA 1BXRA 2E1RA 4NKRA 2VHZA 2XRYA 2ZRIA 1YCDA 1YR2A 4HB2A 3WICA 2AEJA 2JK0A 3Q9UA 4C07A 4CMJA 5JH7A 4S04A 4OX9Y 2OESA 1AS0A 2QGNA 1O4VA 3VVLA 3PUWA 4MO2A 1OX4B 6YASA 1DC8A 4G1CA 1G41A 2CNWA 2VDMB 1UP4A 2XY4A 3T41A 3O47A 4L6AA 2BMFA 4F11A 1DBVO 4QGGA 4YCJA 3WLEA 4DRYA 3OIUA 4MYDA 3SJAA 1ORRA 2NN3C 3NNNA 2XYQA 4AW9A 4DNQA 3AKDA 3I4FA 3JVVA 1BFDA 2J59A 3OOWA 3I83A 4MWCA 3O2NA 4ND7A 3COZA 1CR4A 3ASYA 5G1PA 4IBOA 2NZYA 2PD6A 1B8VA 2JGDA 3T38A 4OQYA 4AJHA 1XN1A 2QRJA 2ZJ8A 5DNDA 1ZJ4A 1NX9A 1P7VA 4K6NA 5F3DA 2IYZA 2GILA 4PR3A 4WOPA 4F4IA 3EMBA 1FQKA 3C7AA 4FGWA 4RTQA 4RL6A 3I5XA 3RAJA 3E2MA 2F9LA 2XOXA 3KEGA 3V8BA 1R0CA 4Y2RA 2SHKA 4JLAA 1BJKA 3NIDB 2ORWA 1VZ2A 5C8VA 1PJCA 2XCRB 3NASA 3QVMA 4D3XA 3BXXA 3ONVA 3EIFA 3EVFA 5A4JA 5CCXA 3W04A 4LV5B 5B36A 2YN0A 1TOAA 1NN3A 4G4SO 2WUGA 5I5YA 1SU7A 1TUBB 3LYAA 3NHLA 4MAAA 3W06A 1N0WA 2A0UA 5F1OA 3THYB 1GM5A 4C7OB 4X1YB 3ZQKA 4GOND 1SBCA 4TXJA 5BRAA 3EDOA 1D2AA 4C6TB 1T4GA 1V41E 4QBHA 2TMDA 2PWZA 3DPSA 4WLNA 5HUJA 2Q0HA 2WD9A 4Q9KA 4HDKA 1LLDA 1IDN1 1XTIA 2YJ3A 1RZVA 5BOVA 5TPZD 5ADVA 3AG6A 4G65A 1E5VA 2J9GA 1U2DA 3VI4B 4MEBA 4B44A 4BRSA 3TR5A 4D46A 3FCYA 3L0IB 4PC3A 4EG4A 10MHA 4KXNA 2W4QA 4FQ7A 4BNYA 3I9V6 4P3YA 3FFTA 1DOAA 3PXBA 4C2UA 2H51A 5CK5A 5ADWA 3HDHA 5H8WA 2Q5JA 3PD1A 3QFFA 2QN8A 2ZYWX 1EJ6A 3F4KA 3AVXA 4U3JA 1QU3A 4PFSA 1BRTA 3D1LA 3K6RA 3NO4A 3HCEA 3AFGA 2OBFA 3IRUA 4R1OA 3AT1A 5TQ0B 1YQUA 3DWGA 4DF3A 1T6ZA 3NGXA 1V95A 1YASA 3HUDA 3M3HA 3H9GA 2PBRA 1U3TA 3NM6B 4R2KA 3C97A 4W1PA 2DFLA 4YONB 5GOTA 3K96A 1P1KA 5IVPA 2O5VA 5FPRA 1QMPA 1VJ5A 4QPZA 2ZIEA 1KI6B 3GQVA 3ROFA 1P9NA 1W85A 2NO5A 3EPJA 4RMJA 4M0PA 3SZLA 4BZPA 4LRWA 3SDZA 1PS9A 1E3MA 5IJ9B 1X7GA 4F5YA 4ECAA 5IXJA 1OLUA 1XLUA 2PMFA 2RKWA 3D2AA 3W2IA 3JASB 2OGWA 3BH7A 3G8DA 4UVDA 2BIFA 1TI7A 3G79A 2VLBA 1F9EA 4AJ1A 1AMOA 2H9AA 2ZWMA 5HM6A 1MT3A 4F1KA 2HJHA 4GOKA 1K75A 1YMVA 5TGDA 3UUWA 3SIRA 4P4LA 3WX0A 3L0DA 1LF0A 2AD1A 3I0MA 3RYHA 2R0QC 1TMYA 3GR6A 4WASA 5BT9A 4D8YA 3ONWA 4F46A 4NBUA 3WLPA 4MW6A 2E6UX 2HBRA 1BXGB 1CW2B 1VZ3A 2YIVX 3KKOA 4WN9A 4Y2XA 4ZAVA 2GWRA 3FPKA 4BAGA 5JI3E 3C1AA 5FA8A 5KWIA 1E0JA 4GVPA 4NZPA 3UGQA 2VNIA 4MQ5A 1GG8A 1T0JB 1GXSA 2HJVA 2G5CA 1RWKA 2IOFA 2QL5A 2WAOA 2PGNA 3LVFO 3OFSA 4L85A 4MYUA 4RIHA 5F78A 5FTNA 4PQEA 1WMFA 1GTG1 2R7MA 1G6Q1 5CYOA 2HF9A 1CG6A 1MABA 2QXYA 2MYPA 1GAWA 3JPWA 4KODA 2VL7A 3FIJA 3QP9A 4RVCA 5LD2C 2C9OA 4RY8A 2YCBA 1AJEA 1Z5NA 4ZYUA 5LJLA 2GN1A 2RH9B 3H04A 5L4NA 4DILA 2LWIA 1OD6A 3BSSA 1BS1A 4GC5A 5I47A 2GUWA 4JLKA 4LJ6A 3SEQA 1NWHA 2VJQA 1PJBA 2RHCA 2XMSA 1I4EB 4D3ZA 4YMLA 2HVRA 4YQEA 2D5BA 4ONEA 4I4TA 5H1YA 3B53X 3T7TA 3H5OA 1DAGA 5C8DA 3KXPA 5ESXA 2WU0A 4UM9B 1LBQA 1YKSA 1LDYA 3BB3A 4Z9AA 1GU1A 3CV3A 2WUVA 5EP1A 2Q6LA 4FN4A 4CODB 3Q15C 1SC3A 1H8ED 3VOTA 4ZVQA 5D7NA 4J2HA 3QPAA 3IKMB 3PEWA 3FPGA 3JQ8B 4PHCA 4P3XA 1SQGA 2BI8A 1H3NA 3K9HA 4HLDA 2V6JA 4E2YA 1T24A 2ZRBA 5I3CA 4WUTA 1AG9A 3HKDB 1D03A 3B7WA 4EY6A 3UMSA 1RXSA 1I33A 2BMDA 2TMYA 2YWRA 3A4TA 3LUAA 4BMNA 1H6BA 3KLPX 2WG0A 1OI2A 3T9EA 3GCWA 3A26A 4NE2A 1YS2X 3O74A 2GDZA 2EGUA 5ALXA 3Q7QA 4LGMA 4MZXA 4D3YA 5JNLA 2ZBFA 5HZGA 4IWYA 1CE8B 5JFTA 1KP2A 4OHPA 5DE3A 3T3MB 2FKAA 2WKQA 3E3NA 3IQDB 1D9ZA 2OBYA 3QYPA 4UHDA 2PPLA 3ABSB 2FFQA 3D8HA 4FMCF 1YTLA 3R4CA 2DM6A 4YO8A 4I08A 1UBLS 3D2BA 3ZU2A 1AVTA 2HLHA 1U8UA 4XPIA 4Z0PA 4DA4A 1Q2XA 2B20A 5J2UB 1ICIA 4BJ6A 2OD2A 4AP9A 4BO3A 2ZVQX 4RY2A 4CLXA 4W9MC 4WKCA 1M34B 1D4FA 2ZI6A 2HJ9A 2AE2A 2OCXA 1RWOA 2FPXA 1ZP6A 1C8VB 2Q5HA 4EYGA 3H8SA 1T15A 4MS4B 5BRJA 3ZD7A 5JY1A 1NV9A 1WO8A 5FR9A 1SY7A 5KVQA 2QUAA 1PQYA 5FPHA 2CFTA 1CUYA 1X9HA 2H57A 3HB1A 1UC9A 3BGWA 4W1RA 4XEUA 2VZEA 5K8VA 5L3SB 2O8EA 3T0FA 2CVOA 3C5CA 3NHMA 2WIDA 5DTJA 4X60A 5IMSA 5IKXA 3M4NA 1THMA 1HE8B 2IYFA 1LV8A 4XVHA 3OHPA 1Z22A 5HKAA 3TDMA 3IQZA 2P6UA 2PSJA 3QLVC 5T6BA 4E12A 3HYCA 3IVRA 2EQAA 2ISSD 2EEZA 2QRGA 2W6JD 4O0LA 3TX6A 2QE7D 1KE2A 1M6YA 3TTUA 3W9YA 2HPAA 2C5HA 2FEPA 3DEFA 3WNDA 2EF0A 4QPDA 3V4ZA 4QUIA 1K6EA 3L77A 3DYVA 4Q1DA 4HNTA 2ABJA 1XJ0A 4IIJF 1NDQA 3C3XA 1NTOA 3QXHA 1S2GA 1Y5RA 1L3BA 5KMGB 5L4SA 2H3HA 3NWJA 2PZFA 2QG4A 4DXHA 3VV3A 1D1SA 4B45A 3F1KA 5HQTA 2A9PA 5BXYA 1JHZA 2F1OA 5JCJD 2GEFA 1S3FA 1QF9A 1A9OA 1R0YA 2CDCA 3VNRA 3CBGA 4BB6A 5J4YA 1UC5B 1EXVA 4IDQA 4BUZA 4PBSA 2C9MA 4UMVA 2P30A 3A05A 3DAPA 3TZKA 1G0NA 2IOFK 2YHIB 3P0HA 4E1AA 4QAQA 1N6KA 2ZYVX 1IYEA 2R8ZA 1JHRA 4ZZ0A 1DBSA 3UZBA 3FCEA 3ZHQA 3QVGB 2XA2A 1V43A 3H5TA 2O20A 3TBFA 1GZ7A 3ZR4B 3VH3A 3V55A 1G21E 2FSHA 3JD2A 4ZQFA 5I9BA 1NVDA 3CPEA 1DX4A 1M75A 4MWSA 4MA0A 2QLMA 3BMOA 2PU5A 2KMLA 3UB3A 1RHKA 2YS6A 4JIGA 3INRA 4BE7B 2PRYA 2Q3JA 1GR1A 1XQ6A 2GN8A 2P9CA 4DC9A 3KALA 2PLAA 1DUSA 2YVQA 3D64A 1GU7A 4QYIA 1JDJA 1M1YB 2GS9A 2H5LA 1POXA 2HIXA 4O2LA 4YRPA 4OSEA 4W4TA 4DV3B 3WJ2A 4ABYA 2JGMA 3U7QA 1Z6ZA 2FMTA 1RABA 1OW3B 2DQYA 6LDHA 2VDRB 2LCFA 3HO6A 3ZLBA 5J43A 4OEHA 2PGOA 3CUTA 5G3YA 3S27A 4UEQA 4FEEA 5IF9A 1Y4ZA 1GPJA 1W36B 1R9GA 4G0NA 4N7RA 2VDWB 1CB7A 3GJQA 3O73A 1EM8A 2IYEA 4JH0A 2VHYA 1RHRA 4P7KA 4CDMA 1B6GA 3DLIA 2EKPA 1FDOA 3K5PA 4ARIA 2V7PA 4W8OA 1MX5A 3KJZA 1H22A 1QO7A 3ELBA 5DNYB 2V7QD 3MAJA 2V9ZA 2CLLB 4P31A 4OL0A 4YP1A 4DCSA 4RY9A 1KJQA 3DVAB 2VTDA 3P9CA 3SNOA 2HMAA 4QC2A 1JJBA 1XZAA 4UOEA 2HQRA 4HEA6 1Q6YA 4GPZA 1PWEA 4HQ0A 4JOSA 3TAXA 3LV8A 1KOGA 4ZD6A 3GHHA 3NIFB 4B3JA 1XVVA 4ZARA 5AM3A 2ZZKA 1WJGA 2Q6TA 2PV7A 3KZMA 3TSAA 4DAAA 1Z4LA 3EDCA 4CE5A 5B1HA 5JZOA 1NMQA 2OCKA 1VMKA 2Q3BA 2QP9X 3W6ZA 1HETA 1YA4A 3KZCA 4NPHA 4P4SB 2AG8A 2OXCA 2RBKA 4WDQA 3AVVA 3L4JA 4XDZA 1AA9A 1O95D 2DHCA 2LP4Y 2WM9B 4RA9A 3DLHA 2O52A 4BEWA 4HOYA 5CRIA 1DL5A 1CQWA 2GD1O 2PRKA 2Z4RA 4R1UA 2NVUB 1AMUA 1E7SA 2ZRAA 2XMRA 4YXWD 1H2HA 1P3JA 5G0TA 1FTNA 1Y6ZA 3OMXA 1KMIY 3ZZUA 2YQ4A 3SGLA 3UFBA 4BGIA 1JSXA 1M67A 4LOJA 1KPGA 4J1TA 4QNMA 4US1R 1VL2A 3B48A 3RGWS 4EMTA 4NK4A 1QGZA 3HWSA 1ZGZA 1CUVA 3L6BA 1WHTB 2ZVJA 4YRFA 1E2JA 1U0BB 4CLRB 4D96A 1MNQA 2HJGA 1ZSVA 1H93A 1TQ4A 3L8HA 2HTFA 4IFBA 2P68A 4MJ7A 2A57A 3O0DA 2CBZA 1EBBA 4L5IA 4LY0A 1UJCA 3AB3A 3K0AA 4OFXA 4RVUA 4YP5A 3O9ZA 5EZQA 3VH4A 3EVZA 1YC5A 3UW3A 4DZRA 2ZM5A 4NYJR 3EA0A 3FDIA 1W35A 2RGNA 3RVKA 1G20A 3DOJA 3RTCA 3LBNA 4NENB 2V55B 3PQ8A 2Y0CA 2R6R1 2Z1NA 2C7RA 1E7MA 5FHQA 5SYMA 2Q4EA 4GOLD 3WWJA 2D5CA 4JP5A 1H2EA 2QQ0A 2YVLA 5AW4A 3OT4A 3F7MA 3NU1A 1W52X 1N2CE 2RC5A 5B6PA 4JIMA 2IUSA 3N2ZB 4PO3X 1D9XA 1Z39A 2PX2A 1JFFA 1GLNA 4Z9XA 4E14A 1Q3KA 2VUTA 4HYQA 1CS4C 1UOQA 1FJ2A 4C2BA 5F51A 2XADA 4LHSA 4ARVA 3EVGA 1CKNA 1KBLA 1LSJA 2X77A 1JFLA 1YR8A 4DLYA 1RW4A 1MCZA 4OHFA 3L9WA 5EEHA 4C6HA 5G02A 2O7SA 1VGQA 3D7NA 4ILEA 1HI9A 4HPXB 3KO8A 4Q05A 3IPLA 1MR3F 1R5BA 1EK5A 1HE2A 2ZETA 3NTVA 4IMIB 1NQWA 4PSKA 4DV2B 1XC7A 2YJ6A 3IELA 4XYLB 1ZOLA 3FMFA 4RA6A 4IG9A 4C29A 1KJZA 2JJ2A 5IZCC 5A03A 3M1YA 2AS0A 1D0SA 1VJGA 2QVYX 5E1DA 5DXFA 4ARZB 2O1SA 2WTBA 4ERXA 4EO7A 4OGFA 2D1TA 1PP4A 2WDZA 2NYAA 3FTEA 3FPEA 2CZCA 2VOEA 4J6EA 2PXAA 5ALJA 4ZGGA 1CJCA 3IR6A 3H6GA 2X7JA 3MCWA 5EGNA 4XR4A 3FSGD 2AFHE 3GJ8A 2YH2A 5THXA 1OFIA 1L4KA 1ISFA 1O5OA 1NOIA 1QGUB 2QOEA 2VT6A 2OC9A 2G1AA 2H4ZA 4G41A 2YASA 4N1AA 5F1YA 5K3SA 4Q9AA 1I3LA 3F6YA 3JYQA 2VG8A 4Q3DA 2PKEA 3U26A 1QE3A 1OY1A 1P7WA 2VQ6A 4LTMA 2D0IA 3LIPA 4PIMA 3LHIA 3TLJA 4NJEA 3NAGA 4P32A 5T4FA 1ZC3A 1LZLA 2ZYDA 2QRLA 2Q8QA 1NKTA 2IV2X 2R44A 5C5CA 4AP6A 4Z5XA 4KR0A 3Q5EA 1JFRA 1X7WB 4G09A 1GJRA 3AUSA 5DTQA 2L82A 1WWKA 1L7XA 1UBNA 3B3GA 3PR3A 3QBVA 5IXSA 2OFWA 3AHIA 5JDCA 2X5XA 1GVHA 4M8KA 3QMWA 3JRXA 2PEYA 5EKTA 3TAHA 2EGHA 2WM3A 2HHCA 3ONFA 5EXTA 1DQSA 1Y9DA 4RZXA 3COPA 1PG2A 3OC6A 1DBWA 1WXHA 4P8RA 2CMKA 5F33A 3U0GA 4GFDA 4I1OA 1KQFA 4W82A 5LN1A 1CJKC 2C84A 2RHLA 4F4HA 3DR5A 3GAZA 2CW5A 2Z5VA 3HUFA 2PUCA 4ILKA 1AKMA 3FWHA 2F3SA 4HLNA 2CFRA 4IJWA 4TYQA 3AU9A 4XIYA 5AIAA 1H2BA 1TF5A 2FW8A 3TXYA 4HMOA 2WFZA 1ZBDA 3HCBA 1U3DA 1WU8A 1IMOA 2IUYA 2QAIA 2Q4BA 2HO4A 3ABRB 3COWA 1I3OA 3HACA 3N59A 3DULA 3ZG6A 1KI7A 3AJEA 4ZOLA 4K87A 2OHOA 2QMEA 4LDQA 5CJPA 1QRTA 3FI9A 4R9RA 3WIBA 4K2HA 1DB3A 1MO4A 4QSMA 2YHSA 1X1EA 3T7RA 2BMWA 1GQOA 3Q0IA 4YASA 1NUSA 1XF1A 1ZEJA 1YBFA 2BGKA 2J46A 2HLDD 5IMBA 4REOA 4G84A 3TIXB 2G6TA 2RH4A 5DXJA 1B3BA 4NZOA 1M2JA 1OAAA 4EF5A 1M1XB 2VDQB 4QOEA 1L5RA 3WBFA 1P1JA 2I5PO 1K92A 2GAAA 2ZIUB 1YKFA 1CETA 3K09A 3NKVA 4TQ9A 1H4QA 3BQMB 1TJNA 3PITA 3DFFA 1XRMA 3DBRA 4PIVA 3AILA 3LT0A 5B1EA 1LI5A 5GWXA 5B53A 1J8FA 4YP6A 4M36A 3VVMA 2HDOA 2VOJA 3LMKA 4I9NA 4HLCA 1TAQA 2IITA 4ZPXA 2Z6VA 5KSYA 1GL3A 1PF7E 4F3CA 2PZMA 4RJLA 2I2XB 3WQBA 1E2PA 5C51B 4NH0A 3Q2IA 4M9ZA 1LW6E 3ZHRA 4GBJA 1FTGA 2F43A 4B73A 4E30A 5DM2A 1YCGA 4HAYA 4C4YA 2O8FA 2PNFA 3EH1A 4RWEA 3AF6A 3RHSA 1CT9A 1FTWA 1BO6A 2X15A 3TKAA 3I64A 1O2DA 3O8BA 3KB2A 3MTGA 2Y93A 1RS0A 4YV1A 3TTTA 1IJKA 2DUNA 3CLTC 4QUGA 4XWYA 3UMFA 2K87A 4JD5A 4MKXA 5EMLA 1MUUA 3I9NA 3HHPA 3LQFA 2P2YA 3CRMA 3CRRA 2JIBA 4R40A 3TWOA 4ARAA 1KHTA 1ULUA 4YJ3A 2JD2A 4NHEA 4WK4B 5IK2A 3S2IA 3FZNA 4DV1B 3CURA 3F0TA 4MUGA 5HX7A 1JKFA 1F2TB 3L8YA 4DB4A 1DXHA 3EIUA 3PD7A 1O97C 4UUNA 1EA7A 3EX7C 3I9LA 3H2KA 1FJXA 1MJHA 3BA8A 5ALZA 4ENQA 4Y7DA 1QV9A 1SU8A 4PYRA 1OJLA 2BTQB 1U7TA 1Z2PX 1YMUA 2BELA 3MBIA 4FUQA 4ZV7A 5AFSA 2NXNA 2B9VA 2AXPA 1GZ3A 2EJVA 3OU7A 2B94A 4LRQA 1KDYA 3E9NA 3OIGA 4D92A 3W79A 4BJHB 2J3IA 1ORVA 1EAYA 3V3KA 1XQWA 2RAUA 3C15C 1Q0QA 1DKMA 3U7GA 2AF3C 2AJTA 5ITZA 4KRFA 1C0EA 5ADHA 1IY8A 1P2FA 5DYNA 4B87A 4CETA 2CXSA 3CVYA 2AFIE 5B3KA 5DF1A 2WHQA 4EENA 1J8YF 1UZUA 4AJOA 2VJAA 4PG4A 4KFCA 4Q1EA 3A58B 1LV7A 1ESMA 1UDXA 3T3HA 4Y2HA 4Y7CA 2JEYA 2XV1A 1RQPA 1RKUA 3A1EA 5K03A 4M7OA 4TYMA 3WRWA 1SC9A 1ZI6A 4EX6A 2SKDA 1MH1A 1W6UA 4KXWA 2RGGA 2ODBA 2RARA 1ZM2A 1AKNA 4G5YA 3HU3A 1NVEA 2WNSA 3AGQA 4KP7A 3NKLA 4OJKA 4JP2A 1B42A 4RKQA 1INLA 1K7CA 2I4LA 4LXXA 4XD7D 3DDZX 2XT9A 8MHTA 5ES4B 1OX5A 4CE6A 1N6NA 5FI0B 5JC1A 2B25A 4TUYF 2VPIA 3GEIA 3NCHA 1P91A 4DEYA 4AKIA 2UUBB 3ND5A 4FDLA 4JT4A 4DLXA 3KTDA 2X3YA 5J5AA 4B1FA 2YWXA 4KWHA 4DADA 4J0FA 3NHBA 4FBGA 1GPMA 1NN0A 1NQAO 2VPXA 4OXNA 2ZVPX 2GXQA 2R4QA 4EZBA 1JDEA 2H4WA 2UYGA 3VUFA 5GONB 4GPBA 1YB6A 1G3IA 1IXKA 1HNNA 2VA8A 4N3NA 3DJFA 4QLAA 4CV1A 1D2RA 5AVYA 3IAS1 2ZU0C 1NYLA 2YV4A 4PAGA 4F2GA 5HM8A 4TZ0A 3Q7TA 3LHFA 4GXQA 1H1LB 4M9UA 5EMMA 3AESB 4HWSA 1EP3B 1SXJD 3P45A 1TVKB 1P5HA 4QREA 2DR0A 4RZQA 3C3YA 2XECA 4G5OA 4KC0A 4NZ9A 4QRDA 4L0DA 4BEVA 1QZZA 2WD8A 4C01A 2IH4A 4TWJA 3MUNA 3BJIC 4HJXA 4GPAA 5WRFA 2REBA 4FYPA 4BECA 4EX7A 1JQJC 3DFMA 3R6TA 1XZIA 1RADA 4IO1A 3SMVA 4D4GA 2ECFA 2XWPA 1NNSA 1RRKA 5G4KB 1LK7A 1I5RA 2HXYA 2BJVA 3GUCA 2WKWA 2QLJA 5AVQA 5C8ZA 4YPVA 3KX2A 5DYGA 4CN8A 1ZGAA 2ZIZA 1ISPA 1W96A 2ZXUA 2HDNB 4RVHA 2CWDA 4FBLA 4TSKA 1JDTA 4PLYA 2VPYA 3D6MA 4CQJA 4J0IA 2XYPA 4XKJA 5IAJA 4FZ5A 1IMJA 5BMOA 3KT3A 4X95A 3BULA 1U80A 3NBUA 3RWOA 3TRKA 1E4YA 1MO5A 4O6VA 4W9NA 5TMDA 3PXUA 4O7TA 4RD0A 1KI8A 2ZUCA 2OO7A 2XH8A 5EKUA 5FULA 5KTTA 4J3JA 1T2UA 1R9NA 4GH5A 4LBZA 1Z62A 3DPIA 4Q1FA 5EIAA 3HZHA 4Y1EA 1KYIA 1J06A 1B6SA 2RD2A 5AH0A 3VU9A 5EG5A 1L4GA 1PV2A 4ZMBA 1E1QA 1H42A 5SZHB 2V3CC 1C30B 1GITA 1H2YA 1V48A 2VH5R 2XUHA 5GJBA 4LX0A 5L45A 1B14A 3P5SA 2ANBA 1XCOA 3BXEA 3USES 5LQAA 2XKAA 1RPJA 1GUYA 1AKQA 3ER9A 3NIGB 3QH4A 1NX6A 2Q5CA 2WR8A 4TTIA 5EMNA 2GFQA 4WXPA 3FR7A 3D1VA 4RZ3A 3VYVA 4ER3A 5KWJA 3T3EA 3ER6A 1ISHA 5LCXA 4UTPA 3ZGZA 1IHPA 1MW8X 2DEUA 1ZK4A 4WJKB 2YVUA 5JQWA 2A9OA 2IXGA 1Y7PA 4HD8A 3K3PA 2JZCA 2FVYA 4RAOA 3SYNA 2Z8YA 4FGKA 4IGKA 4IIXA 3EZ9A 4LRYA 4CTKA 1RJWA 1SMKA 2C1ZA 2D5AA 2Q1TA 3IBSA 3NV9A 3QKIA 5CM2Z 5E2BA 4EL5A 3K70C 3NDIA 3OOHA 4KVGA 4LJSA 4LMBA 1D4OA 1HTTA 3Q40A 4ZZ1A 3FKSA 1D09A 2NACA 3N3BC 5B2ZA 3ZN2A 4ICIA 4PC6A 4YECA 4FXPA 1KS2A 3O8CA 5I5TA 1SIBE 4AB1A 4I8XA 4DCUA 3LT4A 1DKQA 1QYWA 3PNPA 1A9XA 4DNFA 1YULA 4F8YA 1MW9X 2GTHA 3HKEB 4IS3A 4UVIA 4BO0A 5LDHA 1WB9A 4CMEA 2FPGA 3BKWA 2F8MA 1YACA 4WVLA 3RTDA 1EFHA 2GF9A 3TZBA 3UUEA 3JZMA 2O2DA 3HRKA 5JBNA 2B34A 1XMJA 4Q4HA 2PO7A 4DYVA 2H6EA 5AW5A 4Z0HO 3UK0A 5CFPA 4W5NA 3JYPA 1EZ1A 1G60A 1SK9A 2P0AA 2HU5A 2R6DA 1EUQA 1UBGA 1XNHA 3CRQA 3E84A 4I3HA 4TLMB 1M1UA 1Q1GA 1YI1A 2YN4A 3EIXA 3VOSA 2BFEA 2DPXA 5J63A 1SPBS 3IT3A 4QICA 3S2EA 5IJXA 2TYSB 1IY2A 5G0WA 4FYKA 7AT1A 2XXJA 1S8OA 2ZJBA 3UWKA 1M0EA 4DQUA 1DG3A 1NSTA 4EG3A 8LDHA 4XFJA 2C4VA 3TAUA 1S2MA 1QIMA 4FOSA 3VDMA 4OX9B 4DDHA 5F5XA 3AGPA 4YAEA 2HT1A 3AM1A 1KVSA 2R79A 2W2OA 4F5ZA 1CJSA 3R7SA 3Q8MA 2RI0A 3H1AA 2QDKA 3QXXA 4B79A 5CT6A 2KLHA 4DWJA 1SEPA 2JJYA 4JVMA 3HA5A 5MN4A 3EXAA 3G8BA 5T67A 4UHFA 1I1OA 2VDJA 3R9IA 2YN2A 4JENA 4ZVKA 5IRCD 1WKVA 4FGSA 1TFRA 3GP8A 4D81A 5EIHA 5JNVA 1K4KA 4DAEA 2YKGA 4QIHA 2X5KO 2WUDA 2Q8PA 3TL6A 3I8OA 5LQJA 4XB2A 1K5PA 4PICA 1J6UA 5KTRA 1G9TA 3CF4G 3UCXA 3AJAA 3U3JA 2LRHA 1KQPA 2ZR8A 3H97A 5IT9A 1E96A 5FTJA 4Z7OB 2MYUA 2B21A 4XYGA 4KVZA 1OZ0A 3OOSA 1QWOA 3VJLA 4HXYA 4P0PB 3K20A 1RQ2A 5FUQA 3MSCA 1OGJA 5IT5A 1II9A 2P67A 3B2QA 2IZ0A 4RACA 3X1KA 2XTMA 1DTSA 4D57A 2PZ8A 3S55A 3KXLA 3TJRA 4E6EA 3UWSA 4CIXA 4Z53A 4BZWA 2CUNA 5DM4A 1JNYA 4KIGA 4QU9A 4DCGA 1RQRA 1X6VA 2ADOA 3N7UA 2KW5A 3OT1A 4QXQA 2C00A 1TM5E 2GD2A 1X2BA 4L5YA 1RD4A 3U7RA 2W48A 4LWOA 4B33A 2B1RA 4EUFA 1T9DA 3G0OA 5FF9A 4CMKA 1PKEA 3U7EB 4I81A 1K86A 1GPYA 4P5PA 2IVZA 4ZVMA 5LU8A 4LH7A 3BRWA 4NNJA 1Y6JA 3UMBA 1MIOA 3PFBA 1DX9A 2YMPA 1DHTA 4HNHA 2B6NA 3LUBA 3HV2A 5FUYA 4A6XA 2JEOA 4PTZA 3LZDA 2QLNA 3B1XA 2QYOA 1IZ9A 3LULA 5BVHA 3UB2A 2HGSA 1OVMA 3WR5A 1E3WA 1JA9A 2VFAA 4Y30A 1G291 2ZE8A 1I4OA 1EGAA 2W2KB 3CWCA 3E3OA 3ICPA 1JDBC 1OBCA 2QAGB 1COWD 2OB1A 5JSKA 5BN4A 3AEKA 1ARZA 4LQLA 2DCMA 3SFVA 2X0DA 3AEQA 3C3CA 5CP8A 4A5SA 3FROA 5F2KA 1ZNZA 5HOQA 3WNZA 1CJMA 2AN5A 3ASVA 5E3JA 1CEXA 2ZS8A 3M6AA 4AJIA 1ONBA 2D5LA 3H5VA 1GO2A 1UAYA 3FPHA 3EG9A 3KKLA 1K1EA 2FN9A 1CUSA 2XWQA 5ER6A 3WBBA 4TKLA 4LSWA 3JARB 1RMTA 3ZVLA 2QZPA 1ZICA 2RKBA 4GX0A 1OPRA 3C6MA 3HCCA 3SZ3A 1U02A 2BGTA 3V34A 2IYXA 4BX2A 1Z25A 4IZIA 5JT1A 1RI1A 1Y8QA 3UFXA 3TTYA 5A6VA 1Z6GA 5K3FA 2YY5A 3ZVMA 1GGOA 3PNOA 3ZZTA 3G1TA 3HJUA 2C1EA 2ZWIA 2YUTA 4Q4CA 3KJEA 3QHPA 4OO3A 5AP9A 3ZHVA 4ZT4A 3QE4A 1DO2A 1XJQA 2B0CA 1KZYC 4FGJA 3ZW7A 3H1BA 4GR4A 5JS7A 3MUFA 3RSGA 2ZTMA 3LQ4A 1FUIA 4P86A 4C0HA 2QEQA 3W5HA 1TMKA 5B6IA 2XCTB 1IYDA 1E63A 2QUBA 4ZRNA 5KTSA 3ADBA 4WOCA 2IZOA 1UXKA 3QSGA 2EFGA 3PICA 4A8JC 1HDXA 4JEUA 2DLCX 4FI3C 5C8XA 3FYUC 3CLSC 3R6GA 3R3SA 4S24A 3T1VA 4JITA 5CMLA 1NR5A 1CUHA 2E37A 5F76A 1Z82A 5K4GA 1EPUA 2B6HA 4P81A 1YBHA 1ZGCA 2BHNA 3GLIB 2DHQA 3CF0A 2Y68A 1UFQA 1Z0ZA 4LMAA 1MOSA 2ZYSA 2D2XA 4OIFA 3WGHA 3QY0A 4R2HA 3AINA 2YHUA 1P4RA 2FV8A 4HX9A 4DIFA 3K94A 1CFJA 1RU3A 1SC6A 3WIOA 2I4IA 3R5XA 1DAHA 3K1YA 5DGDA 4OU4A 1QIKA 3T5MA 1NU6A 1MKYA 2GLUA 2P2ZA 2Q4OA 4B48A 4CT0A 1QZXA 3PQ5A 1JIUA 2YXPX 4GKBA 4TT3A 1VBHA 1HMYA 4AJLA 4BLOA 4DCPA 2GO7A 5HUHA 1Z26A 2OZEA 4HRAA 3B20A 3N2GB 3SOZA 1Y98A 1SZCA 4QJBA 2BEJA 2ZAOA 3LPAA 3RS8A 3FFWA 5CR9A 3L84A 4ZV9A 1CJUC 4ENVA 2RHJA 3D3WB 2B99A 2WRZA 2P1RA 2H4YA 3DEYX 1EVKA 1DX6A 4O25A 1CY6A 5IFKA 5ILGA 5IAGA 2J9XB 1YVDA 2QG9A 1BDIA 1KRWA 2O0HA 4EW6A 4N0DA 1T4MA 3KOUA 4CMAA 3QG1A 4N76A 2F8SA 3GRFA 1JHUA 3LUHA 2C83A 1Z6PA 3G17A 1SELA 3A1VA 4KREA 4M83A 4AYXA 3QPUA 5BN1A 3PC6A 3U3MA 5LOVA 3GIDA 4YROA 1O8BA 1O08A 4V3BA 1DRJA 3GBSA 5HF9A 2BGGA 1TT5B 5JASA 4ACBA 4NCIA 1N75A 4IV0A 2D1RA 2J7PA 4RH1A 5DTRA 4QPPA 2P77A 2OMKA 3EISA 3G5UA 1YR9A 4U2KA 1DINA 4XA8A 5KSOA 1WG8A 1E4EA 5EWJB 4G5RA 4CQLB 1M1NA 3PLRA 2A1UB 2DY0A 5K0SA 3W6PA 5KDOA 1YB2A 3WHIA 2O8FB 1WPRA 5H9WA 4KGZA 5BWRA 3GVPA 4FEYA 1RHMA 3K1ZA 5JNRA 5I6DA 1JAXA 3PA8A 1PQ4A 1THTA 5C4IA 3CH4B 3K5IA 3NWEA 4FLMA 4C4TA 1LK5A 4EA9A 3UPUA 4W1SA 5AXDA 4H7FA 3S5UA 3HJRA 4GX2A 4E51A 4IDOA 5LFAA 3TECE 4RDXA 4UCQA 1AZTA 5EEGA 1AKVA 3RVNA 4ALNA 2DUJA 3D7SA 4XGIA 3FWKA 1CUWA 1U7OA 1EFUA 4M9RA 3BHNA 4TTQA 4NYMR 3BYZA 2FXIA 2V5VA 1F1BA 3BE6A 3GG2A 5ES3A 3ZDZB 1NPYA 4UUQA 4BVAA 2O2ZA 4KK3A 4R1LA 3OIFA 4H3KB 3RU3A 1BGXT 4YEDA 4AJEA 3M0EA 3EDMA 3IVMA 1KFJB 3L8MA 1DGQA 5JS1A 3ZCRA 3GRRA 4O81A 3RWBA 3P9SA 4TMFA 1G4HA 3ZVKA 1VB3A 1JEYA 1XAJA 1Z0UA 3G2PA 2IPMA 2Q7OE 4X7PA 1ZS9A 3VJKA 1VI2A 4ZCSA 1XL0A 2N1MA 3CWZA 1GTMA 1FMLA 2QN3A 1NT4A 2AVNA 2JARA 2JIDA 3PGKA 3MJ4A 1GTRA 3K05A 2TSYB 4QDUA 2VQ3A 3KZOA 3VO2A 5KSPA 5BY2A 2DBYA 1KAOA 3T95A 2W5UA 2ODEA 5B7NA 1Q74A 3CF4A 4WN3A 3AOEA 1E3LA 1JWBB 3HMKA 3OLXA 4RVFA 2Z8ZA 5IC6A 3TDNA 5JXHA 3EFOB 4A16A 1YAJA 1XE3A 1Z4JA 2JW5A 3QWHA 4KUEA 4DA6A 3QJGA 2QX8A 1WQ3A 4MGEA 4ZYYA 4RIFA 2ZSJA 3IGFA 4G81A 2JI7A 4NZZA 5AM5A 3NC4A 4GGPA 3CZCA 3LP6A 4C30A 3R0IA 1TAHA 2CLDX 4KAFA 5HMMA 3WI7A 2AJLI 9GPBA 1E1RA 2O8DA 4JC8A 1LPMA 1L4YA 1QS0A 4WT7A 1J2RA 3UT5A 4BKOA 4ZO8A 5LJIA 1ZJ6A 3KKNA 3MJRA 1E8NA 2O8VA 1L3IA 2WTAA 4YJ2A 3TN7A 1NMEA 2HUPA 1NBMD 4MH0R 1US8A 2QL9A 4LDRA 4ZVOA 2ZDHA 1AF4A 1DV1A 3AMVA 4WDRA 3T5PA 3ZI0A 5MHTA 4DZTA 1CY7A 4S1TA 3ND6A 5JVDB 2OWEA 3P9PA 2O2HA 3Q88A 3A0UA 1IM5A 2IY9A 2PYIA 4BO2A 4D5GA 4K46A 3LC2O