4FFNA

Pylc in complex with d-ornithine and amppnp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
363
structure length
353
Chain Sequence
b'MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYGLEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVLKERFGAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PylC
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase/substrate
total genus 116
structure length 353
sequence length 363
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ffnA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ffnA01
5HV6A 1BHSA 2NTNA 3EZYA 3RBXA 3K8ZA 2W71A 3LC2O 3OETA 1ZK1A 2VYVD 1ID1A 3DDNA 1FDVA 4MP6A 1Q1NA 3RUAA 3JQEA 3S2GA 3V5NA 2VR1A 3F3SA 5IXSA 1WLYA 2LDBA 4BMSA 3JYQA 2VTDA 1JKJA 4MV4A 3UUWA 1ENOA 3VKUA 2AE1A 3M1AA 5BSEA 2PD3A 4PZDA 4B7XA 3JQGA 5GONF 4DC0A 5L7WA 1B8UA 4DBZA 3DOCA 2AHRA 4WLVA 1Y8RA 3A4VA 2C00A 4RPJA 1YO6A 1KIFA 2H63A 4O1MA 1P1JA 5TC4A 2V58A 1OC2A 4YR9A 3IC5A 3ZV5A 4CM9A 3QQPA 5C8YF 3CKYA 2CDCA 5I7EA 4E2ZA 1WP4A 1P1KA 5L53A 1Q0HA 3D7LA 3K6JA 2F1KA 2YZLA 4CLHA 5CDSA 2IYOA 2X5KO 1T36A 1ZK2A 4IMPA 1Z2PX 5T67A 3KRTA 4O6VA 4NHEA 3LDHA 4MIYA 4WKGA 4ALIA 3NRCA 4QECA 2OORA 2PKQP 1GUFA 3I9JA 1A7AA 1CQIA 3MCVA 3PFFA 5COAA 7MDHA 1JA9A 1JW9B 1T2AA 4IINA 4R16A 1BVRA 1YBMA 2Y99A 4XKJA 4AJJA 2VCYA 3WGHA 2GN4A 4QEDA 2GUGA 3BMOA 5G0SA 3STHA 3TZKA 4RO0A 3UXYA 2ZB7A 4GKBA 3LK7A 2GERA 3VH1A 3M2PA 3VA7A 3EYWA 1Y5MA 4GX5A 4OKNA 3VZQA 1MFZA 4IPTA 3AU9A 3JQFC 4GAEA 4EEXA 1WVGA 4D44A 2QRLA 4AJ2A 1MUUA 1O5IA 1P31A 2HRBA 2P5UA 5G0TA 4E2YA 1E6UA 1PL7A 4D3DA 4R9RA 3L77A 1P1IA 1PGPA 4Y67A 2R2GA 1UJMA 2W6MA 2GNAA 4L4SA 4RL6A 3G0OA 5FWNA 3Q6IA 2C7GA 2J3KA 2P9GA 2PNFA 3QY9A 4A5OA 3GDOA 4D41A 1VKOA 2AQHA 4CLOB 3HG7A 4J16A 5CEEA 1ZH8A 4MKZA 3R1IA 4OKIA 3HJAA 3U0BA 5LDHA 6LDHA 1C3VA 2Z02A 3DZJA 4M8SA 1DSSG 2HMSA 5DZSA 4E6PA 4HNGA 3RBVA 4EJ6A 4YJ3F 1X0VA 4BQRA 3ZNPA 1E7RA 3F4BA 3COSA 3IUSA 4PIVA 4E5KA 1OI7A 2YV2A 3ZHYA 1HETA 1C0PA 4B3JA 4D45A 4EITA 4MA5A 1VBGA 1JDJA 3BMQA 4WLUA 4BO4A 4O0LA 3L9WA 3FD8A 4D43A 3K5PA 2EKLA 3B6ZA 2IEBA 3WICA 2RIRA 3PIDA 4AJHA 3FWNA 1WMAA 3WQRA 3Q11A 5T5QA 1SO8A 4O2BF 1HE4A 3U5TA 2O50A 1OZAA 4B7CA 2DVMA 2PVPA 3JQBA 1PJBA 1ZFNA 3QWBA 4J1SA 1VSUA 1EUCB 2PD4A 4Q3CA 4QO7A 4BNIA 2YYYA 5CPBA 4Z0PA 1J5PA 5ENDA 4E4YA 4TUYF 3AK4A 2C20A 3E03A 4ID9A 1ML3A 4XDZA 4FGRA 2HUNA 4XQGA 2IRWA 2D8AA 1A4UA 4PLWA 2YQ4A 1KY5A 3GR6A 4MVJF 3WB9A 3GZNA 2VQDA 1UDBA 1ADGA 3ZWNA 3V1YA 2G76A 3C24A 2DTXA 3IOYA 5T57A 4CLXA 4O4JF 4IM7A 4HKTA 3OEWA 3OJEA 3U49A 3V1TC 1FDSA 3BZUA 3JV7A 3KYBA 2VHWA 2VHXA 3QP9A 1PR3A 4GH5A 4K1LA 3CUKA 3BMCB 2EW2A 5THQA 2X23A 2Q46A 2WM3A 2WE7A 4JK3A 1PR9A 1H6BA 4RVFA 3QVSA 3AOGA 4RVSA 1AUVA 4O83A 1E1KA 3MJVA 3SX2A 2QQ5A 1GCUA 2EF1A 5THKA 4UEJA 2P0AA 4MVJD 3ONEA 4TWRA 1O8CA 2NM0A 5F5LA 3WGIA 2LDXA 4O7RA 2DKNA 3KREA 1H9BA 4RLSA 3ZU4A 1WPQA 1MXHA 2V6MA 3QJ5A 3EAGA 4J2HA 3VPHA 2PGLA 4HNUA 3KVOA 1P9LA 3KYDB 3VVBA 3ZN2A 4DLKA 1PS0A 4ZQEA 2WYVA 2YY7A 2ZDQA 4OJNA 5DCUA 1IHYA 2FPIB 4L74A 1HSZA 3CINA 4YB8A 2VYND 1KERA 3PZRA 5EMHA 1TXGA 3N74A 4J1TA 2UAGA 3VPBA 1R4NA 3DB2A 1YDWA 1DJQA 2D4AA 2GRAA 4N7RA 4PRLA 3WTBA 5C7LO 3R23A 2DC1A 4L75A 4PG7A 4D7AA 4O7VA 3EC7A 1NQAO 4EUFA 3KM0A 4XB2A 1FDUA 2BFAA 3RFXA 3MJTA 3H8VA 3O03A 3FNFA 4O4IF 5K6AA 5EIOA 4MV1A 2PD6A 4DIBA 3QV1A 2R87A 1TI7A 1GV1A 3E48A 3LVFO 1ZEJA 1K2WA 2PGDA 3PGJA 4NPCA 1Q2XA 3PHHA 4IDDA 3H3JA 4LW8A 3FSRA 2JAHA 4XJSA 1Z75A 1H0KA 1W0CA 1XQ6A 3KYCA 3M1LA 3VPSA 3WLFA 1FMCA 3F4LA 3W4IA 3OA2A 3OHSX 2QHXA 3RFTA 4PLHA 3WSWA 2ZTLA 1ZIDA 1HL3A 1P0CA 4A2CA 1H6AA 3K2EA 3PQEA 4MVJG 1XCBA 3DBLB 5IDWA 5BPHA 3ETGA 1N7HA 3MZ0A 1XYGA 2Q45A 2W90A 4U0JA 2ZDHA 5IDQA 2AQIA 4QXMA 4DYDA 5L51A 4CLOA 3S55A 4JGBA 2TMGA 4GLOA 1I3LA 3GHHA 5FYDA 4NFSA 4FBGA 4OQYA 1M6VA 1BVUA 2C7VA 1BXKA 3TDKA 1HSOA 3DZIA 2RBEA 3CZRA 3F47A 1B8VA 3CH6A 4NJOA 3PJEA 3ZV4A 2GGSA 2DZDA 2GF2A 2FRDA 2HMUA 3T7CA 3AU8A 2X86A 5LP6F 1JN0A 5JY1A 4E5PA 1U28A 1QG6A 5G4LA 2GPWA 3GNSA 3WNZA 4YAKB 1W4ZA 3LZ6A 2VNSA 1AE1A 3D3WA 1PK8A 2IXAA 3GDFA 3HN7A 4HBGA 1TVEA 4P4GA 3VZSA 3RKUA 2Q1UA 3DBHB 4RF3A 1U3WA 1HYHA 2OL4A 4JXKA 1YB1A 1C1XB 4ALNA 3ETEA 1NASA 1EVIA 2AA3A 1R66A 3BXXA 2JD2A 2R00C 1I01A 2XD4A 4R1SA 1NQ5A 2PZMA 1VJTA 3WGQA 4ZQIA 4DQVA 3V2UA 2J3IA 3WGZA 4UEKA 3AI1A 3DMTC 2R82A 4MV7A 3V1UA 3JYLA 3INRA 2Y05A 5A02A 1YQGA 1X7GA 2X58A 5KX5F 1GEEA 1LXCA 1D1SA 5GZ3A 5JE8A 3WNVA 5JAIA 4PG4A 3PHGA 1V0JA 2EERA 4AL4A 4YTEA 4IUYA 4QX6A 2C54A 3VHRA 2O3TA 3H9QA 1GY8A 1LDBA 1S7CA 5KVVA 2FOIA 1UR5A 2J5QA 4J7CA 4BO5A 4OXYA 1F14A 1R4MB 1NBOA 2I76A 4JLWA 3FWZA 3AY3A 1AUPA 4OOFA 2PA3A 4DIFA 3T4XA 1MFPA 1CEQA 3ZDFA 3LF2A 3PXXA 3R3SA 3DAFA 1DRUA 1ZMOA 1PJ3A 3KOUA 3C7CB 5EINA 4ALKA 3X2EA 4P4LA 2R6JA 4BNZA 3ETJA 1GDHA 3AY7A 5AXAA 5ICSA 2PFGA 2Q1WA 4CL8A 4DMLA 2O3SA 3BHJA 3JTMA 1DFIA 3GEDA 3PLNA 3QVTA 4KUHA 2BELA 2VWPA 1ZBQA 1ZK4A 4LVUA 3ZWWA 4B4OA 1YL6A 2EJVA 1A48A 3AOEC 3I3OA 3VH3A 1DC4A 1JAXA 1KVRA 1C1DB 1GEGA 3HO8A 1L7EA 1V9LA 1P45A 3GG2A 4KUEA 1L7DA 2ZTMA 3JQFA 3W1VA 1E1NA 2D1YA 4MV3A 1GSAA 4XYGA 1LLCA 3GMSA 3VTFA 4ZICA 2P91A 2RH8A 4M55A 3CMMA 1U7TA 3DEYX 1KJ9A 1U3TA 1QYXA 3S2FA 1J0XO 1RPNA 4DUPA 4BNXA 1V3UA 1F06A 4YT5A 5L4NA 3QVXA 1I33A 1WNTA 1TEHA 1X0XA 1VL8A 3LT2A 1GD1O 3HFGA 2NUAA 3TQHA 1E92A 3ROKA 2EKQA 4K6CA 1ULZA 2VZ0A 3BMNA 1Z2NX 3H9GA 4LSMA 3IKTA 3LU1A 5JQGF 3DZBA 4CQMA 3TQTA 1Y6JA 3FCOA 1B7GO 2GQSA 4P8RA 1HDOA 4NI5A 1I10A 4NJMB 5H80A 4MKXA 2YZMA 2WD8A 2DBRA 3C85A 1M67A 2X9VA 1GCOA 1OAAA 4HFRA 1Z73A 5HBRB 4BNJA 5JCXA 3RUEA 2JFHA 3D4NA 5JO9A 2C2XA 5CHEA 1EDZA 5CEFA 1I2CA 1SZJG 1WWKA 1SNYA 3RU7A 1NFFA 1ZK0A 4N5LA 4CV1A 3OQ6A 4JN6B 3RI3A 3DAGA 1A71A 3KHUA 2YS6A 1A9XA 3BHIA 4Y8VB 3R9RA 2PZLA 1U9JA 2HMWA 3ETHA 1ZK3A 3IS3A 4FDAA 5KKAA 3Q0EA 5KVQA 4KUGA 3OJ0A 3RC7A 5FNVF 4HQ6A 4N5MA 1WW8A 2X5JO 4FJ0A 4TRNA 5CB4F 5DNAA 3WO0A 4GGOA 3ZV6A 4W7IA 1T25A 4XYLA 1YKFA 5U4QA 2V5AA 1E3WB 2CVOA 2ZATA 3ZGYA 4BO2A 4C4OA 4YT8A 4UVHA 4MV8A 3KETA 3H2SA 2BI7A 3LLVA 4YEDA 4GMGA 3UKOA 1VE9A 2O4UX 3TFQA 2BFOA 3AI3A 3V2HA 4B4UA 2YFQA 2DLNA 2VOJA 1PTJA 4ITUA 1U5AA 2WEKA 3WJAA 3ORRA 4YAKA 2DBZA 2BFPA 4HY3A 4RORA 1KJ8A 3L9XA 2NTJA 1E7SA 4K6FA 1GPDG 4E12A 4YCAA 1Y9EA 3ASUA 3ZZNA 7ADHA 2IODA 4BO0A 2EG9A 2BH9A 4RF2A 5JYDA 4CL3A 4CMBA 1F8GA 3DHNA 2CNUA 2YUTA 5CAEA 2W4QA 2GO1A 4HADA 1PGNA 1ZO8A 1VSVA 4K9DA 1QP8A 3JQGB 5EL0A 5ER6A 4G65A 4Y98A 1A4IA 5LXTF 3GFBA 3G1TA 3ZCXA 4MV9A 1Y8RB 1MXFA 2GR9A 5TX7A 3NT2A 1OBGA 4J43A 2AE2A 1T26A 4ZI7F 2DUUA 1SAYA 1WDLA 3ZU2A 1NWCA 1HDGO 1P77A 5H83A 4FFPA 3ORFA 2DUWA 4PRKA 3RC2A 2IP4A 3R5FA 2XF8A 2NVBA 1CF2O 1A72A 1D4FA 5JFOA 1I7LA 1TLTA 4OSOA 1RM4A 3A06A 1PU2A 3I23A 4NBUA 1CQIB 3RAJA 3P2OA 4DC1A 2OZPA 5CP8A 5LCXA 2ZQYA 2OP1A 1I3MA 3KEQA 3MJ4A 1PJTA 4ZD6A 5JCJA 3BMOB 5G2OA 3IUPA 4ZQFA 4I55F 3KB6A 3AJRA 3EY4A 1LQTA 2Y1GA 2NU8B 2J8ZA 2UUPA 1W6UA 3H2ZA 2GN9A 1OBDA 1EUDA 2FZEA 4XIYA 4R4JA 1EFLA 4BNLA 2OGUA 1E6WA 1N7GA 3RIHA 5G0WA 4I1IA 5ITWA 5MDHA 2QF7A 3LWBA 4J1QA 3MJSA 5CDUA 4UREA 2V65A 4W4TA 1SOVA 3TPCA 1VBHA 5EJ2A 1BW9A 2BD0A 3PHJA 5IFLA 4BO7A 1DXYA 2VZ8A 3ZWAA 1KC3A 2I66A 4O7SA 2NACA 2VTEA 4MKRA 5FEUA 2HMTA 2EP7A 3UOGA 5BNIA 3FTNA 1ZJZA 3WS7A 1YGYA 3VPXA 4GX0A 2W2LD 4IDCA 1Y8QB 4UUPA 2OO5A 1B26A 4ND2A 4XX0A 1OFGA 2PH3A 3PWZA 1UAYA 4CMEA 2P9EA 4J2OA 1JVBA 5L95A 1NQTA 1QYDA 4EGQA 4E4TA 2PK3A 3ZU5A 4W9NC 1U8FO 3BMQB 1I8TA 5HWSA 2W6QA 2Z1NA 2FP4B 1DBVO 1NWHA 1ONOA 4HXYA 3K5IA 1QYVA 3ONFA 1LBEA 5CPFA 4Q39A 4I9UA 1RM5A 3WDSA 5TJ9A 4CUZA 4AJOA 1VJ1A 3Q2OA 2XAAA 5HA5A 3JYNA 2HKIA 1VJ0A 1EVJA 4DPMA 2RAFA 2DAPA 4O5OA 4ZU3A 4IHJF 3GAFA 1EEHA 1XELA 1YL7A 3Q1KA 4PLCA 3LSYA 1KEWA 3D5QA 3I1JA 4DLBA 3U9SA 2R00A 4Y6SA 3DZHA 3UN1A 3O38A 1E3JA 4R69A 3U9LA 3RC9A 3V8BA 4TSKA 1ISFA 1SMKA 2JD1A 4J0FA 4U6SA 2NTVA 3GDGA 4BO6A 4HP8A 3G3EA 4B3HA 4CM6A 2ZJ0A 4ZVVA 4KQXA 4YQZA 3GZNB 3HDQA 3PDJA 5I7SA 2JHFA 2ET6A 5JAMA 2JCVA 4U6QA 4WCFC 3H9JA 4DVJA 5A3VA 3CTMA 1ZCJA 2C29D 1EQ2A 3OBBA 3LT1A 1ZVMA 4HFNA 4CV0A 3KAKA 1CDOA 4CPDA 1RJWA 1FDWA 4CMAA 4ZGWA 3F5QA 3RWBA 2CDBA 2PLAA 5ITVA 2GYYA 5DP1A 3JD2A 2QW8A 1N1EA 4RVHA 2X8LA 2YJZA 1JU9A 2PZKA 1N92A 2ZTUA 4CM7A 4IZIA 2NQTA 5JDCA 2D5CA 1HDRA 1WXDA 4FQ8A 4PVDA 4YRBA 3OSUA 1ISIA 1H5QA 3TW6A 2P4QA 3P5SA 3WJ7A 4CMJA 4Z9YA 3HUDA 4MVJE 5AXDA 4WEQA 2X1HA 3FTPA 4YJGB 1ORRA 1UDCA 4IDBA 2AG5A 3D1LA 3KSZO 1M0WA 4UAGA 4MVJP 2X9NA 3F46A 1C3OA 4KTTE 3DTTA 2FHSA 4YB8B 5KIAA 4C5CA 1E1LA 1ONNA 1HDXA 4UUNA 1R4NB 3LC1O 1A9YA 3D64A 2X5OA 3EW7A 1IL0A 1DV2A 3DHEA 4XB1A 4IIUA 2VRCA 4BNNA 4TV9F 5AQ1A 1HYEA 1YS4A 1XA0A 4IDFA 2R86A 1U5CA 4XGKA 2EV9A 5BQFA 2Q2VA 3WYEA 1G6KA 3ENNA 2ZQZA 4BKOA 3GT0A 3ADPA 5FI5A 1E7WA 3DQPA 2VPQA 3H5AA 5CA1F 4YJHB 1CS0A 2PY6A 4WJZA 3WWYA 4OQZA 4AG3A 2ZYGA 4LMRA 1E77A 1XU9A 2IZ0A 4J7UA 1UH5A 3GG9A 4NH4A 4NZ9A 3D4PA 3ZWMA 2W6OA 4WLOA 5COQA 1LLQA 4UVDA 4PLZA 2H9IA 2OOSA 1Q0QA 3CIFA 1T2EA 3F5SA 4RPGA 2NU8A 3ZNQA 2ZKLA 1QSGA 3KYCB 1LX6A 5AOVA 1UP6A 2W6PA 4JP3A 3WR5A 1PEDA 1YONA 4BMNA 4NR0A 4R3WA 3GPIA 3CXRA 3ONDA 4GL4A 3ZNOA 1WZIA 3CE6A 4M86A 2DU8A 3G8DA 1DIHA 4H3VA 4MVJI 4XCVA 4OXNA 3ZWPA 1KEPA 2DM6A 3QWHA 3C7AA 2YZ7A 3TL3A 4BNTA 4Q9NA 2B0JA 1H2HA 1U3UA 3ANLA 1YWGO 1EQUA 3PPIA 1N1GA 1Y8QA 2IYPA 4AICA 4YVFA 3BYZA 3H7AA 2DTDA 1UXKA 4JJFA 5CEJA 2O2YA 3E5NA 1YXMA 4Q3NA 3TZHA 4WNIA 1DIKA 1LSOA 4Z9FA 4XYMA 5FF9A 2VT3A 1EVZA 2DIKA 4DQUA 3F9IA 4R54A 3NUGA 4J49A 2ZK7A 4B8ZA 3ADOA 2FP4A 2GN6A 2PKRA 2R7LA 3L6DA 3D3WB 3OJFA 1KVTA 3RVDA 1X1TA 1PZFA 3BAZA 3PRJA 3U4HA 1LSJA 2EKPA 4YYZA 3SJ7A 2A35A 1PWZA 4E2WA 2Q4BA 3VPCA 4S1VA 1VRWA 4CLDA 1KJJA 1B3BA 1O89A 1XG5A 4ND4A 4WLFA 3NX4A 1ADBA 4MVJH 3VPFA 3DZFA 1SB8A 2C5AA 1PGOA 3GVPA 1DRVA 2Q1TA 3GUYA 2VQ3A 4TMFA 5LDGA 3GLQA 1AHIA 1VI2A 1XIVA 4IMRA 4B4VA 2BLLA 1A5ZA 1ZUD1 2O3JA 4P4NA 4NQZA 4XYBA 2P2SA 4PLPA 4HWKA 1DLIA 5TQVA 5JDIA 2BFMA 2I5PO 4IJWA 4UEOA 1HE5A 5JMWA 2QYTA 3IDSA 1YL5A 3R5HA 1E3LA 2OLSA 1UZLA 4UUOA 3VDRA 2Y1FA 3ZWBA 3RCBA 1EYZA 2CSUA 2I3GA 3NEPX 2RH4A 4IQ0A 4R3NA 5HRUA 4PZEA 3Q9UA 3A28A 4LVCA 4D0RA 3PDUA 1WAMA 4YAGA 4CQLA 1ENYA 2HJSA 3EUWA 3WMWA 1E3IA 2EWMA 3GVXA 3H5RA 1K6XA 2Y68A 3KBOA 4PG6A 1I2ZA 2EEZA 4CM4A 1L1FA 3DOJA 4I5EA 3ABIA 2E37A 4TKMA 3ANNA 3QVOA 1DC3A 4Z0TA 8LDHA 4MA0A 1LDMA 5JH7F 5F3RA 4FFMA 1UP7A 1K6IA 4MDHA 4YJGA 4D79A 1M6WA 3TZCA 1CQJB 1HZJA 1MG0A 4YXFA 1ISMA 1PWXA 4UVEA 1DIGA 3LF1A 1RM3A 5JC8A 4I4TF 3ROMA 2YZGA 1Q0LA 1YBAA 3HB5X 1WDKA 3E5MA 3RROA 1E3SA 1XKQA 4IDEA 4XYEA 1LI4A 1H93A 4BNHA 4FB5A 1LUAA 2B5VA 1O9BA 4RPKA 3P2YA 2YV3A 4L9RA 4FU0A 2NUAB 4PLGA 3SE7A 3B70A 4I50F 1U4OA 2GZ2A 5ER9A 3BMNB 3HHPA 4RLHA 4CQMB 4YJHA 4O84A 4DPKA 3BA1A 1CETA 4YWJA 3WXBA 1D7OA 5I7VA 4BGVA 1DEHA 3LQFA 4J4HA 4J91A 1AUXA 4ND1A 3JQCA 2IEDA 5F21A 5KCZA 4W9NA 2CNQA 5A4DA 3TZ6A 1NM5A 2PKQO 3Q2KA 3T7EA 5T8KC 2OBNA 2DT5A 2CVQA 1PS9A 4RGBA 5C1PA 1BG6A 1LLDA 1J4AA 2J5RA 1BSVA 5L45A 2Y93A 2RHRA 1Q7CA 1PJCA 2FWMX 2C82A 2D0IA 2NVUA 4RQUA 4GVLA 4DLLA 1PZGA 4MO2A 3DWFA 3A9WA 2E4AA 5L7TA 4FFOA 3BTSA 5IXYA 4C5BA 1YJQA 1EK6A 1BRMA 3NGXA 4XYLB 3CMCO 1BXRA 3C7DB 5LOVF 3Q2IA 5IZCA 1J49A 3VDQA 5AYVA 5JQWA 1E4EA 5I8ZA 1LC0A 4GPD1 3Q1LA 3AWDA 1LRKA 4WCFA 3RASA 5CDTA 5EN4A 5JW6A 1R6DA 5JVDF 1WZEA 2EJWA 3DFUA 3KUXA 3KZVA 2QZ9A 3ULKA 1PGQA 3WWZA 2P4HX 1IB6A 2BGMA 4LMPA 3TRIA 2IZ1A 2XXJA 3TJRA 2HGSA 4BVAA 1A27A 1E5LA 4NFYA 3RUIA 3JQAA 4CLEA 5JBIA 2B36A 3ICCA 2WYUA 4IS2A 4WLEA 2W70A 5BNTA 1DIBA 1GUZA 3E9NA 2OHXA 3NTQA 1CWUA 3UGKA 3DBVO 3OECA 4YJ2F 4TV8F 5CAEB 1UXJA 2OFPA 3PHIA 4O86A 1ZSNA 4FJ1A 3RUHA 3PJDA 1C0IA 4IIVA 5HS6A 1C0LA 4O7ZA 4GX2A 2O23A 4JCOA 5GZ1A 2B5WA 5KJEA 4DGSA 1VL0A 4XD2A 5LYJF 2I8CA 4H16A 3AUAA 4RDIA 5D8DA 3HFSA 1DV1A 4GWKA 1H9AA 2GPTA 4GGPA 1IPFA 1JKFA 1N8KA 4FIZA 3SXPA 3GRPA 3KEOA 4E5YA 2DQ4A 4OO3A 5A05A 2G0TA 4AJEA 4ROSA 5L40A 1C0KA 1BDMA 4CM8A 4CMGA 1U1IA 2YW9A 1DJNA 3WYCA 3N7UA 4XJTA 3AFNA 3AW8A 4R51A 3KLMX 3QWFA 3LT4A 3Q9NA 4CUJA 4MJLA 1RYEA 3ITDA 2YWVA 3WGTA 4E0BA 5ICMA 3IKVA 1DFGA 1E7MA 3NT5A 4OH1A 4R68A 3PFWO 4CM9D 3PZBA 5A9TA 4EYEA 2YHIA 5C7IO 1HF3A 3FNGA 4RVGA 5F1KA 4DQXA 2X7HA 4DYVA 1KVQA 2V7PA 4Y6RA 3MJFA 2VYVA 4B7UA 1GQQA 3E82A 4BGIA 5C3MA 5TIIA 1HE3A 1EUDB 2A4KA 3K96A 3QWAA 3SC6A 1VC2A 3FPLA 1NYTA 2JFGA 1HLPA 1ADFA 4BKRA 1CQJA 3QW2A 3SLGA 4U5QA 1KEEA 3ZV3A 3OUUA 3C3XA 3U4DA 2CY0A 4BGUA 4KP7A 3WGGA 3KALA 1BW9B 4ND5A 1QMGA 1S6YA 3I6IA 1JWBB 1MB4A 1HZZA 3PHLA 2ZYAA 3GFGA 3QSGA 2C07A 2HJRA 2NU7A 2UYYA 3VZRA 4DMMA 4Q3DA 2J6IA 5COBA 4MIEA 1GADO 5BPFA 3UF0A 3RBZA 4XX0B 1UXIA 2IE0A 3G17A 3GMDA 5I7FA 4N5NA 1TA4A 1T4BA 3I5MA 1DRWA 4MINA 4WEOA 4FPXA 3BTUA 4FN4A 2PGJA 1GFSA 4JNKA 3OJLA 4K26A 4J9VA 4XR9A 5L3ZA 3WFIA 3ZWXA 3GGOA 3OM9A 4CMIA 1WR2A 1ZXBA 4BNWA 5HTOA 1VM6A 2YFHA 3WQSB 4FGWA 2X9GA 3TIIA 1LDNA 4O7WA 3GVCA 1HWYA 2W98A 3CSDA 3GH3A 1NAIA 2E6UX 3DR3A 2YS7A 4WE3A 4ESOA 1KVSA 4EJ0A 5JS6A 4BL5A 1FK8A 4BKQA 3CZMA 4J9UE 2PV7A 4UVGA 2FR8A 4AVYA 2YW2A 3E8XA 2OUIA 4BKUA 3TF5A 4QTZA 2NU9A 2OP0A 2PH5A 3MEQA 1GR0A 2VUSA 2RCYA 4LRTB 5KJ6A 3NGLA 2I99A 3WFJA 2VT2A 3GGGA 5EQFA 4TRJA 2AEJA 3IP1A 3GY0A 1JDEA 1YQXA 2P68A 3QLJA 1KEVA 2IXBA 2X0JA 1SC6A 1LSUA 4BV9A 1GTMA 2CMDA 3OICA 4J7XA 4BGEA 4CR8A 4DTIA 3DBRA 4EUEA 2C59A 3DO5A 1DLJA 2GSDA 1UXGA 1CJCA 2YRXA 1NX6A 1YDEA 4L4XA 2FPPB 1TT5B 4S3MA 2XCLA 4IXTA 4YACA 4YAJB 3JQ6A 4YDRA 3DXFA 3UW3A 3GN1A 1DC6A 4O4LF 1HKUA 4CM5A 4YAIA 4O59O 1NNUA 3U09A 5IG2A 3PQDA 3HN2A 2HDHA 5JAQA 1X14A 1NPTO 2NVWA 4MVJM 3DONA 3FNEA 3B20A 5T64A 4M89A 5BT9A 4BNMA 4CUKA 2NWQA 2JJYA 3KSUA 3OP4A 4DIOA 4F46A 1Q7GA 3AFMA 1VPDA 3SLKA 1A9ZA 1N2SA 3HWRA 3SC4A 3VH2A 4QFDA 4R5MA 3I9MA 2X22A 5TT1A 2QX7A 5JC1A 3WLEA 1ISHA 3GIDA 2QZZA 3B1KA 3NJ8A 4FR5A 3JYOA 2HRZA 4PLFA 4BO9A 1CIVA 1H94A 1R37A 5A9SB 2TMDA 1DIRA 2O7QA 4ZHQF 1H2BA 3WBFA 1M66A 2G1UA 4K28A 4F3YA 2I3AA 2WD7B 1QXSA 3U54A 2Q50A 1TB4A 1P1RA 2BKAA 5DCYA 3U55A 1YVEI 2D2IA 2DBVO 4LRSB 4U8GA 4XZ3A 3VZPA 2AEFA 3EHEA 3HB4X 1ZSYA 4I9NA 2Q2WA 1JTVA 3KSDO 2E82A 4IJUA 4NIMA 4LGVA 3JQBC 1IOWA 4IZHA 1LTHR 4G5HA 5KJ1A 1MP0A 1W8DA 3GEMA 4QO8A 3MWEA 3WMXA 3M2TA 3WGYA 1Z74A 1T2FA 4KZPA 2WDZA 5DDIP 1UDAA 4ALMA 4BMVA 3AM5A 5J2UF 1BMDA 5A04A 4BO8A 5A5FA 2BHLA 4EW6A 1P33A 4AFNA 2PWZA 1N9GA 2QIOA 5ILOA 4I9HA 3OMLA 3NUAA 3UICA 5ES3A 2BRUA 4OGWA 3JQ7A 4CR6A 4E13A 1DO8A 3F1LA 4OYRA 2YZNA 1NXQA 1Z2OX 4I5DA 5BMVF 1BGVA 1HDCA 4QT0A 1GYPA 1P1FA 3QHAA 3I9OA 4MPDA 4MVJA 3W4JA 2Q49A 4IIJF 4ZRNA 1T1RA 2R7MA 3PLRA 3ZNNA 3MJEA 3P19A 4RZIA 2FMUA 2XOXA 3NT4A 1SB9A 1LLUA 1RYDA 2OXIA 5T8KA 5I9NA 3MTGA 5I9MA 3FN4A 3ASVA 3GEGA 4M49A 1B6RA 4TZTA 4H15A 2PZJA 3F6YA 1XWFA 2X0NA 4II3A 5JAZA 5CA0F 1GZ6A 1T1SA 5ENVA 1UUFA 1NFRA 1M76A 5JLAA 2VYNA 3ITKA 1IULA 3D4OA 5TJHA 4PLYA 2CUKA 1EDOA 5DF1A 3UAGA 1MV8A 5JSFA 4RDHA 2WE8A 4XGIA 5DCWA 4NBWA 9LDBA 3Q3CA 4WLNA 2HQ1A 1LDGA 5U1PA 2DFDA 3WTCA 1HE2A 1YOVA 2AQ8A 2Q4EA 3PP8A 4EJMA 1NVTA 5A9RA 3PYXA 1Z7EA 4XYMB 1VL6A 3JZFA 3GA0A 1B3RA 4I08A 4KWIA 4W6ZA 1GZ4A 3QIVA 1U2DA 5EQDA 5KOIA 1PL6A 2VUUA 2W8ZA 5G0VA 4BO3A 4FSHA 4HNVA 2FPGA 2NLOA 1YH3A 3CPSA 1Y81A 1EBFA 2JL1A 3NV9A 1V3VA 1I0ZA 3W8EA 4XR4A 3SBOA 2H6EA 4H7PA 1R12A 2HSDA 2I67A 4GSKA 1EBUA 2Z04A 3E9QA 4L73A 1TT7A 4NNJA 4FFLA 3RJ5A 4U7WA 3SJUA 1MGOA 3GAZA 1JQBA 4OMUA 5U9CA 2GZ3A 4UULA 1DAOA 3ZHBA 3I9LA 4Y6PA 4IZOA 1HTBA 1GQ2A 3DMTA 1SCUA 1KOLA 3AUTA 3EZLA 4LCEA 1PS8A 3FBTA 1R0LA 1UZNA 3HDHA 4WOKA 3UHAA 4B79A 1IZ0A 5A1TA 3NAQA 4WECA 2AXQA 2SCUA 2B4RO 2GCGA 5T6BA 1TT5A 2FPPA 5DP2A 4ALJA 4YAJA 3FI9A 1F17A 1GZ3A 3AX6A 4AJIA 3GPDG 3GLKA 5H81A 1NHWA 1M0TA 2A92A 3UH1A 5A06A 4W7HA 3GZ4A 3FR8A 4NG5A 1HYGA 4BNFA 3VVCA 2ZB8A 2P5YA 3ETDA 3K3PA 1QV7A 4O7NA 1I7NA 4TKLA 4BNYA 4CQLB 3INTA 4XQEA 4CM4B 2HU2A 1DDOA 3PYMA 1XGKA 4EEZA 4NFHA 4JJGA 4CR7A 4D3SA 1W96A 4R5HA 4ZHSA 1CYDA 1YBVA 2EP5A 5A9SA 3UFXA 4BO1A 4F6CA 4L0QA 4PFJA 3AOEA 2E49A 1YB5A 3H9UA 2WD7A 3LYLA 4MIOA 1P1HA 5C5IA 1K0UA 2NU6B 3OIFA 3JRXA 3G49A 3EMKA 1JLLA 4TRRA 1I36A 2CFCA 3L4BC 4INAA 3H65A 3OFSA 4RZHA 3HB9A 4DIMA 1G1AA 1T2CA 2YYAA 2QK4A 3GHYA 2JKVA 1OC4A 4RF4A 4EZBA 3U9TA 1NQOA 1Z6ZA 4GKVA 4KDEA 4E32A 3NDIA 2JD0A 3C8MA 3DZKA 1ZSVA 2YQ5A 3OJOA 2AEMA 4PG5A 2GD1O 3MOIA 4E5MA 2W2KA 3RFVA 3JD0A 1ZW1A 2QRKA 3GGPA 4EG0A 2IZZA 3R0IA 1XU7A 3AM4A 3JQ8B 2BGKA 1QLHA 1IY8A 3M6IA 4ZOLF 3G79A 5H82A 3JQDA 3I52A 3OEYA 4MOWA 2GDZA 4FW8A 5BSHA 4FFRA 1FF9A 3FNHA 4CQMD 2O3UA 1Z82A 2VN8A 2WSBA 4FGSA 1QYCA 5CG1A 1IYZA 1NR1A 2WJPA 1DAPA 4XWYA 2J3JA 4I5FA 1Y5RA 4ZA2A 3HQ4O 3W6UA 3ZHXA 4WCDA 3NDRA 3DTYA 4ILKA 4XEHA 2NVUB 3L0DA 1PZEA 3EVTA 5AVOA 1ENZA 5FI3A 5K6AC 5KWEA 4OL9A 1KETA 3WO1A 3GQVA 3GVIA 1R16A 1O6ZA 1RWBA 4GVXA 3D5TA 5EPOA 3B1FA 4IGFA 4URFA 4C7KA 1X15A 3GNQA 3VAZA 5JY6A 2B37A 5CDYA 3QA9A 1QKIA 1V8BA 2Y1OA 1E4EB 5IAAA 1KUTA 6ADHA 4O4HF 5J23A 1QRRA 3NKLA 4TZKA 3QVWA 4WCFB 1JWAB 3WNQA 1F0YA 5K0ZA 3DFZA 1PJQA 2DPHA 5IJZA 3ZWVA 3ZH2A 3RD5A 5IDXA 3KLPX 1XQ1A 3KXDA 2V6BA 4RPHA 5TS3A 5B4VA 5DBFA 2WMDA 4YPOA 4WASA 4AJPA 1PX2A 4CLRA 4HUJA 3W6ZA 2G17A 3JQAB 4R1UA 1D3AA 5DT9A 3ORQA 4XA8A 4NBRA 4WOJA 1B0AA 3BHMA 4FOSA 5KNLA 4ZQBA 3TN7A 1I5RA 1EE9A 4WK6A 5L7YA 2V6GA 1P0FA 5BSFA 1UP4A 3EVNA 3LC7O 1YB4A 2Q2QA 5DOZA 5EZYF 1Y1PA 4LN1A 3H3FA 4YT2A 1BDBA 1GV0A 3IMFA 3BTVA 3NYWA 2NADA 1PJSA 4GI2A 5AXCA 2HK8A 2D3TA 4JBHA 3NTOA 1P44A 3OQBA 3P7MA 2Y67A 2VNAA 3RSHA 4L8VA 4A03A 3D3EA 2CZCA 1IZ9A 1GYQA 4O81A 2Y1EA 4HX5A 3U4CA 4BOYA 4FJ2A 3ENKA 5A03A 4CV2A 5C1OA 5IN4A 4OOEA 2A94A 1CRWG 3MWDA 3INGA 3NJ4A 4CM8B 3GF4A 4CM3A 1D8AA 3AUUA 5I8WA 5KKNB 3RJ9A 3GK3A 1Z45A 1LNQA 5CDGA 2HO5A 3RFCA 1ISGA 2OBYA 2X0IA 4X54A 2FR0A 3H5NA 2QRJA 5B37A 3AW9A 4L76A 4DPLA 4UUMA 3FR7A 1PX0A 4YT4A 4TROA 4WPGA 2VHVA 4YBZB 2YHIB 5G0UA 2B69A 1HEUA 3V4ZA 1DIAA 2CNBA 3F1KA 4ND3A 5GMOA 1E1MA 3IJRA 1GL3A 2VWHA 4LSWA 1SEPA 3RQSA 9LDTA 4J3FA 1UXHA 5IYZF 3QWIA 4E33A 3GOHA 4YRDA 5DULA 5B12A 2PN1A 2Q1SA 1LQUA 5TSDA 4KOAA 1I2BA 5C7OO 3TOZA 4DREA 4MP8A 3ZWYA 1H6CA 2FSVA 2FZWA 5JCJD 3JSAA 2PBZA 4B8WA 3TNLA 2NU6A 1F12A 3QE3A 4TVBA 4EUHA 1EUZA 2FB9A 2NU7B 2W6ZA 4W82A 3DF7A 2F00A 3OIGA 1CE8A 1B16A 4AJKA 4PVCA 3L07A 2O7SA 4PN3A 4Z3DA 4XIJA 2Y1CA 4II2A 1A7KA 4JIGA 1VKZA 5FFFA 4RQTA 4E21A 1VKNA 1IUKA 4XGNA 4AJLA 5EESA 4NBTA 4IQGA 2YDXA 3I6QA 4CMKA 2DBQA 5LA6F 1GUYA 1U4SA 1P3DA 4A0SA 4CMIB 1V6AA 4DXHA 3UCEA 4PLVA 4Y9DA 1LJ8A 3RU9A 3PWSA 3V4SA 3OA0A 3WGOA 1GSHA 4Z9XA 4JBGA 1ADCA 3T4EA 1PSDA 2A9FA 1LRLA 1YJ8A 2QYSA 1KBZA 4CMCA 3JQ8A 4FS3A 4WUVA 4A7PA 2FSSA 4CJXA 4KTVE 4GMFA 2RHCA 4Z6KA 4P38A 1K6JA 3DMYA 5TF4A 4JBIA 3K5HA 3PIIA 4U0KA 1WMBA 1LDYA 2UVDA 1X7DA 3GNTA 1M6HA 4YJDA 5MGBA 4KDFA 4B3IA 1E3EA 5K9ZA 4D42A 1HLDA 1YRLA 1K5HA 5GZ6A 4OHUA 4ZRMA 5JMPA 5IDYA 4LCJA 3BG5A 5TT0A 1JAYA 3WIEA 3LT0A 2BI8A 1EZ1A 2NU9B 1OMOA 4BV8A 2C5EA 2I65A 2QG4A 2Y1DA 5AXBA 3ICPA 3KV3O 4NBVA 1Z7BA 3TIGA 1PGJA 1NVMB 2ZB3A 4IJVA 4AJ1A 4RZQA 3VPGA 3O4RA 1C14A 4AJ4A 4BHTA 1E6EA 3IAHA 4R1TA 1SOWA 1G0OA 1XSEA 3DBRB 2R7NA 3RKRA 4FCCA 2EGGA 2CF6A 1HDZA 5DN9A 3VMMA 1GQYA 1W93A 1GU7A 1DPGA 3PTZA 2W2LA 4J1NA 4M54A 4FC7A 4GWGA 2V6FA 4GBJA 2YRWA 2Y0DA 5BNFA 3TZQA 1R0KA 5TNXA 3KTDA 3L6OO 3TSCA 3K31A 1GLVA 4DBVO 3N58A 4Q3EA 3E6AA 3HNPA 1D1TA 1PIWA 3N8DA 2BMAA 1ISJA 3UVEA 3JQ9C 5B4TA 3OQ1A 3PGXA 4OAQA 1PQUA 1MLDA 4MV6A 3FRJA 4E2XA 2JCXA 2OMEA 3HSKA 3S2IA 4CMEC 1O94A 4UVIA 4NDNE 1SPXA 2X4GA 2Y66A 5IZ4A 2DWCA 3PWKA 3DC2A 3PVZA 1AGNA 2H5LA 4QUKA 3WSVA 3ROPA 3E9MA 2VOEA 2FR1A 3ST7A 2EXXA 5C37A 4XRGA 3FBGA 1QYWA 1NR7A 5F5NA 1KC7A 1M75A 3WBBA 4R01A 2EHDA 4EBFA 4J4TA 3H6KA 3HBLA 5ADHA 1J6UA 4RVUA 1XDWA 4XZ3B 1LC3A 2EGHA 2ZIZA 1K3TA 2JHGA 4D46A 2ZDGA 1NHGA 3RUPA 3R6DA 2GQRA 4IY1A 1JKIA 1MC4A 2HCTA 4ONEA 3WG9A 1LRJA 3H4VA 3KO8A 3MWEB 2ZJ1A 1R0SA 1KBLA 4B4WA 2I6TA 1MX3A 3OF2A 3L4BA 1ARZA 1EUCA 1MA0A 1U3VA 3ZU3A 1WDMA 4NK5A 1DB3A 1EZ4A 2JAPA 3UCFA 1N9GB 1NP3A 4I5GA 4PGFA 4QSMA 3X2FA 4C7JA 1PQWA 2D59A 1HDYA 2DLDA 1PJ2A 4KWHA 3OUZA 2X0SA 2G5CA 4PZCA 4BNKA 3JQ7B 1DOHA 1YQDA 2B4TO 2B83A 3BIOA 4Q3BA 1F8FA 3W8FA 2VRCD 1EVYA 4YBZA 3WIDA 4A10A 2DPGA 3PQFA 1JVSA 4WBNF 1KY4A 1Q7BA 3HZZA 4IBOA 1FXSA 4O7YA 4J90A 5HS4A 3JZIA 3WX0A 1I24A 3VOTA 3K2BA 4EGFA 4IQ8A 2Y0EA 3EK2A 3PI7A 4WGGA 3BMCA 3QRWA 1QLJA 3PJGA 4LISA 4PLTA 3I83A 1Y7TA 3H9EO 5JDCC 1PJLA 3IP3A 1NFQA 4RF5A 3PEFA 4ZQGA 2HK9A 3AUSA 5G4KB 2X0RA 4AJNA 1HRDA 3VTZA 1W73A 5IN5A 3S2EA 4I8XA 4ME6A 2CZGA 1KYQA 3W4KA 3R5XA 3ANMA 5B1YA 3PK0A 2O4CA 1YOVB 2ZTVA 1I3NA 4NMHA 5TLSA 1PL8A 3G1UA 2ZB4A 3GUCA 4LK3A 3U62A 1IOLA 3RUFA 3KYDA 4HFJA 4PG8A 5ILGA 1LDEA 3TINA 1FDTA 5JVLA 1H6DA 2O48X 4R1NA 2HLPA 2FY8A 4A73A 1BTOA 2FPIA 4TRMA 5DBGA 3S1LA 3ZWOA 1ENPA 1X1EA 1I3KA 1MG5A 3DZGA 4JP2A 2P9CA 1UAGA 3RUCA 1ZMTA 2ZCUA 4J4BA 2FPGB 2J9GA 2VZ9A 4N54A 1U7HA 3E5RA 4RVDA 2DFVA 2I9PA 3IIEA 2Q99A 2JCYA 5JYEA 1R15A 5KJCA 1LU9A 4NK4A 4JX8A 2Q3EA 1XEAA 1BXGB 3IQDB 4RV9A 3ZHZA 5HM8A 1I32A 4TVOA 3U4IA 5JNLA 5KTKA 4G2NA 1GGOA 2X6TA 4M9UA 4OIMA 1DHTA 5L4SA 3I12A 1IPEA 3DAPA 3EDMA 1FJHA 4YJFB 1M2WA 3PYLA 5TRTA 4FE2A 1LSSA 3U3XA 3ROQA 1QV6A 1EE2A 2Y0CA 3AM3A 3HDJA 1ZNQO 3HADA 3MJCA 1SCUB 2EW8A 1B6SA 1OBFO 2AG8A 1ZKMA 4FFNA 3RV4A 3N6RA 1B2LA 5J2TF 4IS3A 4JQCA 2SCUB 3MTJA 3K92A 1AHHA 4M1QA 1E7YA 2Z5LA 2B35A 5JXWA 1T24A 2JFFA 5A5EA 3DBLA 3O26A 2GASA 5A3JA 2I87A 4GX1A 3ZWCA 2HAEA 4Z0HO 4BNUA 5BR7A 1GPJA 3O8QB 1EK5A 1IOVA 2WYWA 2CVZA 4NU5A 2AQKA 4BNGA 3K9QO 3RUDA 1B15A 1G0NA 2NSDA 2CF5A 2POQX 1BNCA 3ZW9A 4GQAA 1ZJYA 2O2SA 2GPSA 1KJIA 4HNHA 4IJKA 1B8PA 2BF7A 2VWGA 4O63O 1BWSA 5DMXA 1CERA 4A26A 1ZXLA 4GSLA 3JD3A 2NQ8A 3ZW8A 4ALLA 3UFXB 4EDFA 1AXEA 4BUCA 4DL9A 1XLTA 3OIDA 3JCZA 2UV8A 4O7TA 1AXGA 4N18A 3TFOA 3KAJA 3PJFA 3W8DA 4OM8A 2XPCA 1ZEMA 3JD1A 4D0SA 3DBHA 1JLLB 2NNLD 4HFMA 1C1XA 5DOVA 5IF3A 3L4SO 4DRYA 2J3HA 3FHLA 1X7HA 2YV1A 5B4UA 2GLTA 1JKJB 3DHYA 3I4FA 2ILTA 4D3FA 3IL2A 3WQQA 1PJ4A 1T2DA 1NPYA 1Y9AA 2FN7A 2XXBA 3VOSA 2B4QA 4TQGA 3I9NA 2W2KB 5F1OA 3WOHA 1NVGA 1T4DA 1EHIA 3E1KA 3BTOA 5L9AA 3GVHA 4YAEA 4PCVA 2DTEA 2I80A 2NV6A 5JDIC 2O3RA 5I9LA 3LLSA 2BGLA 3S8MA 4EI2A 4RJTA 2HJWA 1PZHA 4HNTA 1BXZA 2GN8A 4HR7A 4Z3KA 4RCVA 2PTGA 4RPLA 4YQYA 1JDBB 1X13A 1R4MA 1IE3A 2E48A 2CDAA 2PR2A 3FPCA 4JROA 4CMHA 2WYOA 4Q3AA 4BQPA 2C2YA 4ZJUA 1LEHA 4J0EA 4XQ9A 5DBIA 3ZI0A 3E18A 3I4CA 4XRRA 1O95A 5G4KA 2VUTA 4C5AA 1P74A 2UUOA 4KQWA 3B1JA 2ZCVA 4FC6A 2UDPA 1GAEO 3FF4A 1DHRA 1C30A 3R3JA 1SBYA 4NYEA 5JPIA 3ON5A 3EGOA 1DFHA 1KC1A 1PQPA 4GLLA 4R9SA 4FD3A 4WNCA 5KVSA 4JJIA 1EMDA 4ZN6A 2YHUA 1KVUA 1C1DA 1XR3A 2VHZA 4FOOA 1O0SA 3K30A 1YE3A 4DLAA 2YL2A 4L1KA 4M87A 4OSPA 3D0OA 4E5NA 4IDAA 4YA6A 1NPDA 3VH4A 3JD4A 4ZQHA 1AN9A 1ONPA 4J6FA 5GY7A 1NAHA 3DL2A 1KEUA 5EERA 2CD9A 1N5DA 3C1AA 3IJPA 4O2AF 2G82A 4CLRB 1OOEA 4DA9A 1VLLA 4IDGA 3HDYA 4IXWA 4QFCA 2VHYA 2Z1MA 1KS9A 3VC7A 1E5QA 3JQ9A 3QFFA 1ZZEA 3NTRA 3TOXA 4BIIA 1I30A 3OH8A 1V35A 1HT0A 5CG2A 1MC5A 4DWVA 4R41A 4MP3A 3SEFA 1BXGA 2AW5A 3NDJA 3C1TA 2Z95A 4O7LA 3JYPA 2HK7A 2IDZA 1KJQA 2WTBA 4IGEA 3A1NA 1QORA 3HE3A 2GLXA 2VWQA 3L6EA 3G8CA 1IHXA 5BSGA 4E31A 4NU6A 4QQRA 4NJMA 4YJFA 3LP8A 3JQAD 4E3ZA 1U8XX 4QSHA 4EGJA 1E7QA 5HBRA 4CODB 3C1OA 2YDYA 4CV3A 2CNVA 4XDYA 3A14A 2J5KA 2VRBA 3RC1A 3GC6A 3UCXA 4F45A 1NTOA 3MWDB 3CEAA 3WYBA 1XHLA 2R84A 4KMSA 8ADHA 2O3QA 3VKVA 4W99A 1V3TA 4CM1A 3GN2A 1QR6A 2V59A 1DC5A 2GZ1A 3DOOA 3GRKA 4Y8VA 4YRAA 1GYRA 5LC1A 1E0DA 4BB6A 3MOGA 2ZYDA 2EIHA 2WWRA 1SEVA 4G81A 1GSOA 3O8QA 5JO0A 1U2GA 4BNVA 1LA2A 1RKXA 3SVTA 5IZCC 1UZMA 4O82A 3K73O 4E30A 4L4RA 1HXHA 2HMVA 1B14A 4OXKA 3JRWA 4BB5A 1E3WA 4A27A 1RM0A 2C0CA 2H1SA 4HV4A 3AY6A 4P22A 4XQCA 2W6NA 4BKPA 2R7KA 1ULSA 1K89A 2AMFA 3AI2A 4MAMA 3TWOA 1EFKA 1ULUA 3TL2A 5TGDA 3V2GA 3I9KA 2R85A 5KVCA 3O9ZA 5KJFA 4F6LA 5CFZA 5L4LA 2D5AA 5KKCA 3RV3A 5F1PA 4BS9A
chains in the Genus database with same CATH superfamily
5HV6A 1Z47A 2NTNA 3EZYA 1REQB 3G0GA 2HMAA 4LJYA 2GQ0A 3UHOA 4UCSA 1T6BY 3RVLA 3OETA 3IV7A 2HTEA 3TNYA 4DMGA 3TB4A 4MP6A 3VISA 2QX6A 3S2GA 1CE8B 5IXSA 1XRRA 3UAZA 2IW1A 4LECA 3JYQA 2VTDA 3P27A 4DIDA 3UC5A 4EZEA 3ZDBA 1TPZA 4DSUA 4MV4A 3UUWA 1ENOA 2F48A 2X6RA 1YZLA 2RKOA 3TQFA 2YZKA 1PNOA 3PRYA 2PD3A 3MRSA 3JQGA 5KZMB 1S2GA 1MB2A 4WN9B 4UBIA 4DMHA 3EZ2A 2QNRA 1Q0PA 3DOCA 3OEHD 4OA8A 4BP9A 3A4VA 1VCNA 5DNYB 2E1PA 3IIIA 1L5LA 2H63A 2OAGA 1P2GA 3NM6B 1RBZA 1EFCA 4ZEVA 1OLUB 5DHQA 3PBKA 3QQPA 5C8YF 1GR1A 1CUCA 2FUCA 5L53A 1N75A 1Z3IX 1CP3A 3KKEA 5FQOA 1QH9A 2F1KA 3OE4A 2YZLA 4A8HA 1N25A 1X77A 4IMPA 2UYGA 4X7PA 2X0FA 2ERYA 3RVJA 4BQIA 4DNFA 2R8PA 1XRQA 1MABA 1QAQA 2AC4A 3OLCX 3K70B 1YUNA 4ALIA 1LTQA 4UFZA 3B1WA 3NRCA 2PKQP 3O8LA 5EQJB 1ZJ4A 5TQ0B 3SIWA 3TBFA 3PFFA 1JMVA 3BREA 2W7TA 1TL7C 1EZZA 3CZ9A 5CLFA 2Y99A 1YBMA 3M4XA 3N5CA 5BVHB 3MRVA 1AS3A 3W1GA 3UAYA 4ENWA 1F2UB 2FEWB 1E4OA 3DKRA 3Q3GE 2ZB7A 3X1MA 4GKBA 1GTJ1 5JNTA 1SQ6A 2OG2A 1TOAA 2ZBEA 3HO6A 4GE0A 3G2KA 4PBSA 2NAPA 2QJOA 3VA7A 3L4KA 2FLWA 4LDQA 1CUBA 4EPRA 4CE5A 5T7BA 3BXZA 3P4YA 3AU9A 4V1CB 2VTBA 2X5NA 3M6FA 3UKDA 5FD8A 4D44A 1OASA 2RBKA 2QRLA 3K0HA 3GUHA 4MWDA 2JIBA 4JNCA 3KPVA 2X14A 2D54A 4AYTA 5C51B 5JNRA 1PL7A 4G84A 2Q4DA 5JATA 4R9RA 2GA9A 3L77A 2B4KA 1XZLA 2WPDA 2FW8A 4PCUA 1UJMA 4UTZA 2GNAA 4L4SA 4ND6A 1A76A 4HLUA 2DY0A 4MICA 5C4MA 5JJ5A 5JFTA 2C7GA 3FWKA 3QY9A 3LLUA 5DM4A 3U37A 3K9BA 1R4ZA 4CLOB 3HG7A 5CEEA 2C4MA 2DEUA 1ZH8A 3ROFA 1BS2A 1BMFA 1G8PA 2REXB 3HJAA 5KS8A 1BA2A 5LDHA 3WQHA 6LDHA 3R09A 2XNHA 1TECE 3FSJX 1TUBB 1R5BA 3DOEA 3OD1A 5FOSA 4KFCA 1OVGA 2CYCA 5FL7D 4IMJB 1DBWA 3ZS8A 2XTZA 3OX3A 1FJGB 4G6ZA 1E7RA 2QDKA 3Q0IA 4DAOA 2ZJYA 5TVKA 4E5KA 1BDJA 1OI7A 1AV7A 2VKQA 2YV2A 4KIFA 5AOCA 2MSKA 3K2IA 4QYWA 5FHQA 3QMWA 1RKQA 3GA5A 1DT3A 4MA5A 4J3JA 1KOFA 3FOAA 3MG9A 4EITA 1SKYB 2FUKA 4OHFA 1XDSA 2FPSA 4UOEA 4HDKA 4K8OA 4QNMA 4BO4A 5I51A 4GICA 3L9WA 3FD8A 3E3OA 2BCJQ 4AYXA 2HOQA 3OC0A 4AY2A 3P2KA 1O6CA 3B6ZA 3ZWDA 4AJHA 1KYIA 3RSQA 4ZVMA 1WMAA 2YC4C 2G6BA 1NVXQ 4L8WB 3WQRA 4CU5A 3ACBA 2FR8C 1JP7A 621PA 1OZAA 5AKJA 3F2IA 4EPYA 2QTZA 3C8DA 4J1SA 4HDSB 4E09A 4EJSA 2XVMA 4Q3CA 4BNIA 2ZYUX 4Z0PA 4CG0A 3C3EA 4HBZA 4OHWA 3TR5A 1USKA 4GP7A 2CNKA 1DG3A 2JHPA 3AK4A 1BD3A 1YI8A 2O14A 3E03A 3E53A 2ERXA 1G3RA 4ID9A 3HI4A 1ML3A 4UEQA 4XDZA 4FGRA 2HUNA 5KPJA 3RIEA 1KFJB 2WWIA 1KBOA 4R40A 3MFQA 4BX9A 4J94A 2XCTB 2YQ4A 1B6GA 3N0WA 4ZCQA 1KY5A 1T13A 3NHAA 5CB4A 3EPHA 4LH7A 4Q4CA 4GLJA 5LFAA 4PXYA 3WZ2A 2VQDA 3E3NA 2PZ8A 1RWNA 1ZL2A 3LPLA 2L19A 3N5KA 3QXXA 4B2PA 3ZWNA 4DDHA 3V1YA 4MYTA 5AW0A 4IM7A 3OFKA 2CHVA 2QYOA 2QU8A 3PNSA 4REOA 3SK0A 3OJEA 5HIAA 1H8ED 2VHWA 3D81A 3LO8A 5C8VA 2VHXA 3VR5D 1H8HD 3P9QA 4GH5A 5ALOA 3WKAA 1O0BA 1UCFA 2X1MA 3IFSA 4C7OB 3C4JA 1TUIA 1JR3E 1UMBB 3N87A 5D1OA 4JK3A 1PR9A 4ZV9A 1OI3A 4O4LA 3M5CA 3QVSA 3AOGA 4Q7MB 4EB6B 5D1HA 2QL6A 3AJ8A 1CZLA 3QKRA 3LVRE 2PIDA 2MR5A 4OXRA 1ZCBA 4BFWA 5EFZA 1MF7A 4UEJA 2P0AA 3AZQA 5F2EA 4KMMA 5B58T 5F5LA 2DULA 2LDXA 1RRKA 2DKNA 3KREA 3IHTA 5A4JA 1YNSA 4RLSA 1YK0A 4KQHA 3UBTA 4TX1A 4C7BA 4P98A 4QOGA 4O0MA 3DCJA 1U7PA 1GTZA 4HQKA 3VPHA 4CT5A 1GM5A 3P9IA 1WL8A 2PGLA 2WILA 3BJZA 1PZXA 1F8UA 3KVOA 1U90A 2P65A 1N6RA 2V8OA 1P9LA 2YY5A 4HXGA 3VVBA 3QPBA 1JFSA 4COKA 4HYQA 4EATA 4EMTA 2WYVA 2PX5A 3TIXB 2XMPA 5DCUA 4L74A 3B8EA 3L46A 4IP0A 4B2YA 2F64A 3CXUA 1J2JA 2VJKA 1L8XA 1WIWA 2UAGA 3VPBA 1R4NA 1TFUA 3DB2A 2GRAA 3FWPA 4N7RA 4HL6A 1RHJA 1RU3A 3L93A 4X92A 1L9XA 5C7LO 2HHFA 1YE8A 1QQ5A 1Y63A 2DC1A 4IH4A 4L75A 2RG7A 4ZI7A 4NS1A 1A9QA 3EC7A 2JKYA 2ZW9A 4COOA 3ZDEA 4EUFA 4TV9B 1GO2A 3KM0A 4XB2A 1FDUA 2BFAA 2J31A 3DBIA 5FPQA 5TR9A 2FDXA 3LKBA 4MS3A 5F7ZA 1ETUA 3RFXA 3RJMA 3FNFA 5HVNA 1E2NA 3UAWA 2Q6VA 5EIOA 4DA6A 1QG2A 2NYVA 3NBUA 1F0NA 3CLUD 3O8DA 3QV1A 3E8SA 5KTSA 4F9FA 3TVTA 5JSUA 4Z1MA 1K2WA 5DJ5A 1XZBA 2A86A 1QTQA 5MFPA 4ZK6A 4BU0A 1T1EA 3PHHA 5DHTA 2MSCB 4MRVA 5DLPA 3K05A 2F1IA 1VMAA 1ZU5A 2VO1A 3FSRA 3GPLA 4UHHA 2RJOA 4XJSA 3UMCA 1TAUA 4I55A 2R11A 3A36A 1FP6A 4UBMA 3RRBA 1L4EA 4B3RB 3KYCA 3M1LA 3PC4A 3D59A 2QGNA 1FMCA 3WLFA 2PYDA 3K94A 3L4JA 3OA2A 3RAPR 1JG1A 3VKWA 3VYRB 2SBTA 5TS2A 3WSWA 3ABRB 4Z4CA 1TCAA 3MTIA 5DYTA 3HZHA 3SYRA 5GVSA 4PC3A 4RUKA 4ED9A 4YRIA 4CVNA 3HMQA 1SXJE 2ZJ5A 5BQPA 4MVJG 1XCBA 3GRZA 4KI0A 4A82A 3NAGA 1FTSA 1WOYA 5CLHA 4QLAA 1X70A 3TPFA 3WJ1A 1XYGA 1DWQA 1CEEA 4DUYB 3ONVA 3BN3A 4KPFC 2AQIA 4QXMA 4KQJA 1B1CA 3QFHA 1P9RA 2VP5A 1GPWB 3G2LA 2WJJA 1PW7A 1BXKA 1TAGA 1HSOA 2FHPA 2W0MA 3AESB 3AHIA 3HVHA 5H3CA 3CH6A 2XSZA 2GF2A 3PFHA 2PX4A 1F38A 3T7CA 1TIPA 1XVTA 5LP6F 3AIOA 3QU4A 3EWNA 2P4SA 4OP2A 5G3YA 3EHDA 4OQPA 2C96A 3ZCPA 2GPWA 2ESRA 2O2IA 4RYDA 3HJBA 2WUVA 4CRWB 3Q6NA 2VNSA 3B82A 4ZO6A 4KAFA 5TEVA 1HLGA 1PK8A 1AX9A 1KAMA 2IXAA 3B85A 1TVEA 1ZHHA 2NQ2C 2QPAA 3R3UA 3AEQB 5E1MA 2Q1UA 1NW8A 3RIXA 3VC2A 1W59A 4QRHA 1Q3KA 4JXKA 1ANKA 1N2XA 1YB1A 5DM1A 3VC3A 2RGNA 4MR9B 1GGMA 2AA3A 4MRMA 4AO7A 3B1XA 5DISB 2FZ5A 2PWPA 2WV7A 2ZUSA 1G8JA 2LXNA 4U7TB 1I01A 4R1SA 2PZMA 3WGQA 3MMXA 4Y0NA 1W44A 4ZQIA 2IQ5A 3KQTA 4IHJA 4KXNA 3TECE 2B7LA 3DYIA 3URMA 3OZ7A 4NOLA 3HXOA 1TKBA 3AI1A 3V1UA 5K8CA 1V1MB 3JYLA 3UMSA 4P3YA 4B73A 1E1YA 1TPYA 4NCJA 2IS4A 1VP9A 3IOEA 4IJ5A 3U40A 1GEEA 2UZIR 3R40A 2DF8A 2FEMA 5JAIA 2OYSA 3C7TA 3CRW1 4K9MA 4CEIA 3JX9A 1T4MA 4GHWA 1GKIA 3QUQA 1Z2CA 4L8FA 1AKYA 3DKVA 4KBFA 2O3TA 4XTRA 2LRHA 3PNKA 4MKFA 4TYYA 4MWZA 1D2EA 4ZIRA 2GXAA 1XTVA 5CCEA 5KVVA 1SIWA 1UFKA 3SSNA 3NKFA 1VLMA 1PBNA 1ABEA 3CX8A 3LMKA 3UM9A 2DSNA 2NXEA 4JLWA 3DP9A 1EGMB 3FNRA 1B0PA 3HN6A 2HNBA 1Q2UA 3T4XA 3V9PA 3BBPA 4NPAA 3OZCA 4LY0A 3ZDFA 3DAFA 3A6ZA 3K6RA 4ND7A 4PGMA 2A67A 4Z5XA 1G8YA 4ALKA 3KNZA 2GEBA 1R7RA 3EUEA 3X2EA 3ICQB 3AR3A 3FVRA 3HKEA 1QF6A 1LNSA 5HF9A 4ZMBA 1Q0ZA 4DMLA 2O3SA 3OQHA 3GEDA 4KUHA 3ZWWA 1H5NA 1XCPA 2VWPA 3CG4A 1F4LA 3CNOA 2D62A 2Z98A 1Z9BA 3NG1A 4IAOA 1A48A 3AOEC 2AS0A 4D8XA 4K6MA 1JAXA 1JBEA 3M34A 3HO8A 5JUWA 3TW7A 2ZTMA 4US1R 4KR0A 4C9BA 4X6UA 4MV3A 4DLUA 1Q6ZA 3KLOA 3K9GA 4YRJA 3E2IA 3LQQA 4ARBA 3SP1A 2Q9UA 4WXHA 3IBCA 4MEJA 2CFOA 1VYVA 4DQNA 3DLIA 2E2WA 3UAXA 4D8WA 3L0IB 1BQ3A 3B9BA 1ZN2A 1J0XO 1MMFB 5J5CA 3GLIA 4LWZA 4BNXA 2QVLA 3SQWA 2GBGA 5U4XA 4A3SA 3QVXA 1TF7A 2WWXA 3PXUA 1X38A 3HM9A 5DH9A 4XM1A 3CNHA 1VL8A 3GLFB 4HD8A 3OM1A 4L6CA 4UKDA 4PNEA 3N0RA 4K2AA 2XT9A 5AW4A 3F67A 5IU6A 5IC5A 1ZMBA 2C5GA 3TQTA 3G0BA 3DGEC 3E7PA 1IHDA 3B6MA 4P8RA 4FHCA 4ZAZA 3CNLA 5K8TA 4IVQA 3NIBA 2GD2A 4GLWA 1RLTA 3BIWA 2Q8QA 4P7FA 5CCXA 1IN1A 3AZPA 5CYPA 3C85A 3I9V6 1HQYE 4BNJA 1Q50A 1Z73A 5D1PA 1M8PA 1X94A 2J9RA 5JCXA 2RBGA 2H2HA 4U02A 3VNUA 1ZNYA 3PNQA 4OPMA 1XZPA 5CHEA 3WWJA 3LCVB 2DUNA 4BWYA 4N3NA 5CW1A 3W6OA 2B2NA 3L8MA 3ZK7A 3KZ1E 1ZK0A 4N5LA 3G9ZA 4URHA 3CLSD 3L1VA 4HVAA 4LE1A 5C5EA 3DAGA 3DFFA 3SKVA 3BHIA 3R9RA 2QE7D 3IRUA 1E5VA 5DEOA 3SS7X 3TPZA 1ZK3A 4RYLA 5JRZA 3Q0EA 3IA7A 4YN3A 3DDWA 1T3TA 2NUBA 1XZ8A 4X1KA 4D02A 2EBWA 4QOSA 5AK0A 1WW8A 2JJ8A 4TRNA 3GLGE 3ZKWB 4IXMA 3WIBA 2Q2NA 1EB8A 4L4ZA 3T4UA 1XAGA 1C4OA 3T7TA 4DANA 1WS6A 3UMRA 4ETNA 3A9TA 3ZGYA 2JPDA 4IOLA 1DQNA 3O9MA 3X1ZA 4K9SA 4JGIA 4MV8A 4MPRA 4B6PA 5B3KA 1HNZB 2HVRA 3GRRA 2I4NA 4LI0A 1SBTA 1FNMA 1K8QA 2AFVA 4GMGA 5AKKA 3SYLA 3UKOA 4NCXA 4CKYA 2BFOA 4B4UA 3G8AA 3ZCRA 5EIWA 4JBNA 2VOJA 1PTJA 2XMDA 1GTVA 4OCZA 3COPA 1L4LA 4PYLA 3ORRA 2Z6AA 4YAKA 4DR4B 2BFPA 2BMFA 1AV6A 5AICA 3CO0S 3T8YA 1KJ8A 3VR2D 3I2JA 1K92A 4LNAA 1JSLA 2IHTA 3EIXA 1VXRA 4H1HA 1AGXA 1GPDG 4ZEOA 2WTEA 3D1VA 2XDYA 2IK8A 7ADHA 1L4HA 1MHTA 3CT4A 5B1HA 4BO0A 3L18A 3I37X 4XSGA 3KLBA 2RGRA 3WKDA 2JGNA 1WP9A 2YYZA 1TJ4A 3OZRA 4CL3A 4CMBA 5A9SB 2C9MA 4DA4A 4BMZA 1UC4B 3H8JA 2FX3A 3KL2A 4Q1AA 1VSVA 4NPHA 1QP8A 3JQGB 5ER6A 1JSCA 3TG2A 3UGTA 3F73A 2RE8A 2Q07A 4X0EA 2X0DA 3UWOA 5C5CA 4G0UA 5LXTF 3LO5A 1ONBA 3G1TA 3IKMB 5M2QA 2QRZA 1MXFA 2XQFA 4KEAA 5LYJB 3UA4A 1KTAA 3UXEA 5FX2A 2PUAA 4J43A 2AE2A 1M5TA 2HXSA 1T8TA 2O7VA 4JWKA 1V8ZA 1R74A 2W2NA 4UHCA 1CV2A 2C58A 1SAYA 4HWRA 4RXMA 3CRZA 5E38A 1J1ZA 1NWCA 2IEYA 5B6IA 1AT1A 3RAFC 2ZIGA 2RAPA 1IXRC 2W2QA 4MUYA 1GZVA 3CS3A 1HDGO 1OXTA 4J2TA 4G1VA 4YP7A 5H83A 4ETMA 4JR0A 2DUWA 2XF8A 1FFHA 1MABB 1CF2O 2IHNA 5JFOA 2AF4C 3QQ5A 3KEFA 2ZSFA 4KG7A 2EJ3A 1PU2A 4NBUA 2F90A 1RTKA 3S8EA 2EW1A 4WW0A 2C83A 3THWA 3LUBA 4ZD6A 5JCJA 2WK1A 3MJ4A 3CRQA 3ZJYA 4NENA 1VRVA 2FSIA 1JEEA 2YICA 3MB8A 3IUPA 4JGGA 2NV0A 3SC2A 5C8DA 1SQGA 4PZLA 3KB6A 2WKRA 4DMKA 2OVBA 1RMQA 1U3FA 1VLJA 2QXTA 1BYIA 2A9KA 3KKNA 1OGIA 5ESWA 4C4RA 4UZEA 2GN9A 2P2GA 1N3YA 1RZRA 1UOOA 2G09A 2YR0A 1W4LA 1X1AA 4MPPA 4AUEA 2PUJA 5G0WA 4I1IA 5IWAB 3CNQS 4J1QA 3TLMA 5CDUA 1GN8A 1QE0A 4HWPA 4OMDA 4UNSA 5JSQA 5IFLA 4G09A 1OYYA 1DXYA 2VZ8A 4D6XA 1KC3A 1NX9A 1NLFA 4O7SA 1NSFA 3AINA 4LXUA 4DLRA 5JFGA 2VAWA 4QAQA 5IF9A 1XRSB 2EP7A 2NO5A 4N5HX 3FTNA 1U2TA 5AHKA 4DV7B 4EPWA 2WQ7A 5ESDA 4FFWA 4GX0A 4PEVA 2PRYA 1IAQA 3O94A 2E4WA 4NCIA 4F8JA 3TK1A 1F6BA 3U4AA 2OO5A 1YMQA 1CY0A 3HB1A 4K9PA 2Z57A 4UZSA 4EUKA 2Q8NA 3TEFA 1ZUHA 4FWBA 3GFRA 2XV1A 4RD1A 1XMQB 4J2OA 1JVBA 4PYKA 5D3QA 4EGQA 1N2CE 3AGPA 1TCUA 2PK3A 4IV5A 5HNKA 5TB5A 3UG7A 4BQNA 3TE7A 4KX3A 3G88A 3JVEA 1NWHA 3FMVA 4HDKB 5EMLA 2PX8A 3ONFA 3VR4D 4JBXA 1CKOA 2JNWA 1LBEA 3K4QA 5CPFA 4Q39A 1CX9B 1O94D 2EOAA 2GESA 2V96A 3DTVD 5KC9A 3WDSA 2FN9A 4CUZA 1FTGA 3KYIB 5HW0A 2C1EA 2YHSA 4HZUA 3UAOA 1R8YA 4K9RA 4FWTA 2HKIA 1SIOA 2VDNB 3L0ZA 3KKMA 2X41A 1YJ5A 2IU4A 4KBYA 2WJ6A 5HQJA 4PLCA 3TXXA 3LSYA 4EJSB 2GBCA 2V7WA 2Q0SA 2W2OA 3I1JA 4N01A 4C0WA 5FV4A 5F9HA 2DH5A 1G5RA 4TYWA 4NAUA 2QD4A 3QEKA 1GTRA 3RSFA 3JTEA 4I1YA 3DA8A 1E3JA 4EJFA 3DDOA 3R76A 4J0FA 1QHEA 5K6TA 1RPTA 3B51X 5IC6A 4U6SA 4B34A 4J0JA 1U4NA 1MEJA 2O1EA 1EXMA 2C97A 2XUKA 4X61A 3HBMA 1CUVA 2A57A 2BGNA 2AR7A 3G3EA 2ZJ0A 3ZR4B 4DSTA 1EB9A 5CB4B 2XWJI 3HDQA 1EVKA 2ZPTX 3R0JA 2QM3A 4P7GA 4CZ2A 1R0ZA 4HN4B 1IK6A 5JAMA 3FFXA 1ESEA 3IP5A 2WIBA 3EFOB 2WG1A 4RKFA 3LT1A 3K8YA 5TE9A 4PONA 4FYMA 3A3PA 1C0EA 2VDLB 4W5HA 3UKJA 1QVAA 3MIIA 3JSNA 1FDWA 4LXQA 3WL7A 5D1OB 5CGZA 3RWBA 3IBFA 4O4LB 1TC1A 5DP1A 1W0KA 2R1VB 4RVHA 5JVDA 2X8LA 2YJZA 1JU9A 3QKRB 2JCSA 4P86A 1GNLA 1GQOA 1YS9A 3QJYA 3W7BA 4OXIA 1K66A 1Y5NA 4CM7A 3KKQA 3BF7A 3HH8A 1WXDA 1XZKA 4GLFA 4LYJA 4YDHB 4YRBA 3F5FA 1VQ1A 3OSUA 4BP8A 4NDAA 4QBIA 3W79A 3BB4A 4PANA 4PZ0A 3N39C 1H66A 2ZBVA 1G3UA 2VSQA 4MV0A 3P5SA 5DM2A 4B48A 3WJ7A 4CMJA 3HUDA 4UXHA 4L9SA 1ZC4A 2X1HA 1CZOA 4YJGB 5CH3A 4Q9LA 4FYIA 1KJNA 3G13A 4IDBA 4ZYVA 1MJGA 4MVJP 1JLHA 2PBLA 2ZRGA 3X0DA 4KTTE 4NJEA 5KYKA 3GLHE 2OV6A 2FFAA 1XFDA 5K0CA 4TXJA 1WV1A 4G4SP 2R1TB 4QJ4A 2WABA 1R4NB 3T7AA 2VTKA 4N8EA 1G8MA 5KOJA 2BGJA 1GPKA 1T9HA 4G0PA 3D64A 2BGIA 2HHFB 3DHEA 4XB1A 5DCLA 3TDNA 4MKIA 4IIUA 2P62A 2OD2A 2J48A 1DT5A 2DR0A 2PWYA 2EFHB 2RB5A 3L1HA 4H2DA 4NONA 4BNNA 4ZI7B 4D4LA 2E5LB 1HYEA 1CUDA 1YQTA 1U5CA 2KS6A 1MO6A 3B3GA 3M9LA 4XGKA 1FYVA 5EXSA 1PDVA 2XUGA 5F35A 3LW8A 1C9JA 5EMKA 3ENNA 3N70A 5BQFA 2BKXA 2C7BA 3HZRA 5FI5A 5ALWA 4KE7A 5P21A 3DM5A 3DQPA 3ESRA 1OQAA 4YJHB 1CS0A 2JI7A 2PY6A 3JZAA 1URPA 3WZMA 2ENWA 4G01B 4RPIA 1RHKA 4E3WA 3ZXIA 5C1IA 4J7UA 3I92A 2L82A 5WRFA 3GG9A 3TLYA 1SK8A 3D4PA 3ZWMA 1WUKS 4EAAA 4R83A 2F8LA 5G1PA 3R44A 4EMSA 1S4QA 1T8SA 1FXWF 2RDMA 5I5XA 4HHEA 4PLZA 5DNWA 4TMKA 2H9IA 2OOSA 3CWZA 3F5SA 1T2EA 4I55B 2ZE8A 4IQFA 1J39A 4GZ6A 1CKNA 2P3LA 4RW0A 1CP2A 1QSGA 2BT4A 3KYCB 2R6AA 3PPVA 3Q12A 1NC3A 3R7LA 3ZGOA 1EFAA 2ORIA 4YCLA 1DOZA 1AKWA 1XEWY 2W6PA 3K7EA 3WR5A 3L7JA 1XZDA 1D0IA 4IL5A 2J0SA 3JZDA 1A7JA 1YONA 4NR0A 4QIHA 4R3WA 4OEHA 3SEAA 3WHIA 5DGXA 2JFBA 2HIVA 1Z0AA 1WZIA 1XHFA 5EJ7A 4G3XA 4LJAA 4E7PA 2HPVA 1Z0JA 2DU8A 4H3VA 4LYEA 3ZWPA 3NS7A 2XB2A 3HABA 5IJWA 1PV2A 3QWHA 2V0NA 3ZJUA 5F98A 4N4AA 1XZHA 2ORYA 4MUMA 5E6RA 5ALJA 2QV7A 4BNTA 1EQUA 3BDAA 3HR8A 2CB9A 1A8QA 1E66A 1AN0A 3G2MA 5JHHB 3NORA 4YVFA 4AICA 2OWOA 1KZYC 3TTWA 2IYTA 2NV2B 1E5DA 4BBAA 3G2OA 2O2YA 1AKTA 1T0UA 2EATA 5SICE 5HKBA 3WDLA 3HV0A 1MRNA 3ES9A 4XYMA 5AVZA 3C14C 1EVZA 3O8NA 4S2EA 3L5OA 2UYHA 3P2EA 3VU3A 1XDUA 2QRNA 1YGPA 3IPYA 3KQQA 2FP4A 2PH7A 1G2QA 2B7CA 1XQXA 3OX1A 1KVTA 4OQNA 1X1TA 3BAZA 2QUBA 4DILA 1LSJA 2C9YA 4L5BA 1UWVA 5FI1B 3DDUA 1TGYA 2UZ0A 1SCQA 2JJ2A 4LJ9A 3TYXA 1X6VA 4C14A 4E2WA 4S1VA 4CLDA 4DV5B 1VLZA 1KJJA 1WPGA 5HJ2A 4ND4A 4HJRA 3NX4A 4OYLA 4CF3A 3HO1A 2QRUA 2HF8A 4IHJB 3RK1A 5HKKD 3DZFA 1SB8A 1UANA 2C5AA 2WAXA 1YMVA 1G4UR 2NT4A 2IF2A 2QAGC 4TMFA 2XZTA 3GLQA 1DKNA 4FNGA 4QLBA 3DYBA 3KXLA 1XIVA 2EJBA 2GKOA 4XTCS 2BLLA 3QENA 4AKSA 1AQLA 1JQJC 4CNQA 4DCNA 4CEIB 1P2VA 4H7JA 4Q3LA 1EJ6A 1WW3A 3PCRB 3PGKA 1JFLA 4BWVA 3I3SR 5ICGA 4Y3UA 2A30A 3R0VA 3RTEA 2EDAA 2GAFA 2I5PO 4Q05A 1FY2A 1LLFA 5KUTA 4V0ME 4EHBA 3IDSA 4BDTA 3GFPA 4JWTA 4UPDA 3EZ9A 2ZSIA 2OCGA 3VXKA 3VDRA 2Y1FA 4KXMA 5AI6A 4QC2A 4G9GA 4UAVA 4C3OB 4R3NA 4D0RA 4U7DA 1BDIA 3ZHTA 1S2DA 5DK6A 2QLMA 3GVXA 1PR4A 3H5RA 3GPCA 5AIBA 3HKEB 1I2ZA 1XU4A 2OM2A 4TWZA 2YJ3A 2JARA 3QVOA 1UQRA 1Z33A 1EKXA 3NW9A 1GXSA 4A1OA 3E9YA 1KI3A 5JH7F 1F5SA 5LZ8A 2KE5A 3SQXA 4MDHA 1DPFA 1CYEA 2ZE6A 3HCAA 3M6XA 4Z86A 1KEEB 1I1NA 3H04A 1Y3IA 3AF0A 2BDEA 5MN4A 1IPHA 5FTLA 2OMKA 1O95D 3ZYZA 5JAPA 4OX9Y 1QQTA 2XUJA 2IL1A 4Q4JA 3HB5X 5ALGA 1WMFA 3E5MA 3UMYA 1XKQA 1UEXC 4IDEA 5H3LA 1LI4A 3GLIB 1YF3A 2M98A 1IEVA 2RC6A 4D3XA 2B5VA 4QNRA 3CH7A 3CC8A 1O9BA 4IOJA 4WAUA 3KTOA 4Q9IA 5K7SA 2YV3A 2HLDD 1L6IA 5C34B 5KSWB 4H1WA 2WQ6A 1QAOA 4PLGA 3SE7A 1RHQA 3R75A 4BJ1A 2GZ2A 3CIOA 1TJYA 3CYFA 1P6UA 2V54A 1VCMA 3OFNA 1CF4A 3MAGA 2C3PA 4QE3A 5B1EA 1C7RA 1CKEA 3SHQA 2X8JA 2YJ5A 3BA1A 1RJEA 2H1LA 5DX0A 3VDNB 1YVDA 1TEXA 4FT2A 2X4LA 3R7DA 4BGVA 4EY4A 1NDQA 1V9CA 4OLBA 4DCJA 5DW0A 5C31A 2IEDA 4RFLA 1DXQA 4TSRA 4M0DA 5KCZA 2HCBA 2X4IA 2CNQA 4ZO7A 1UBOS 4QGSA 3NBYB 5BMVA 4UBOA 1GPMA 1MZVA 2PKQO 3I01M 3L6UA 3LY7A 4I1SA 5AHWA 3T7EA 5T8KC 1EP3B 2DT5A 1OTHA 1CVRA 3S7TA 4CF6A 3IKTA 1ZD3A 3QUSA 4IIJA 2CMGA 4WOCA 2BMJA 3T5TA 3ISJA 4ABYA 3KKOA 2WFZA 3E4DA 2IHZA 3UATA 4FLFA 1LLDA 1BEZA 4UCFA 2WWVD 4M21A 2Y93A 2RHRA 2X6QA 2YXDA 1PJCA 4I14A 4RQUA 4XWOA 3EZ7A 4ABTA 2VHEA 3UJHA 3EARA 5E0OA 2QTLA 5K09A 4MK4A 1D6JA 1HEIA 1PR2A 4NYJQ 3DWFA 1F1BA 4X1KB 5HKLA 3IDOA 3QEBZ 3IVGA 5BN1A 3I39X 1J0DA 3LUCA 2KBFA 5EXDA 5CA0A 2BBSA 3R9KA 3RVSA 2BFNA 4FFOA 4RKEA 2WIFA 2I6QA 3G0HA 1YJQA 5KNBA 1G6HA 1EK6A 4IJQA 2AFIA 2QSUA 5IBQA 3CMCO 3C7DB 3I53A 5LOVF 3I42A 3ZUPA 5JD5A 3Q2IA 3FDZA 5IZCA 1EWYA 2J3DA 4MQ4A 4RADA 4RLQA 5AYVA 2SICE 3F7TA 5JQWA 3IAAA 1VGRA 3WICA 1E4EA 2X19A 3KZXA 4Q0MA 1C7FA 3KCNA 4GMDA 3RU2A 4U2BA 1K6MA 1LRKA 5CDTA 4MGHA 2B6HA 4MRPA 3FG9A 1UFVA 3ZQJA 2EJWA 2GBLC 2QZ9A 2VPPA 4P3XA 1BFUA 2P4HX 3ULKA 1SOAA 2JFZA 4LZNA 3O4JA 3H0CA 3U3OA 4L5YA 1UEIA 4FX5A 4PC7A 1E5LA 4B81A 1A8PA 1L3CA 2BR5A 2OILA 4RK1A 3U56A 1ZN9A 2BR4A 3SC3A 1YHNA 2HRRA 4IS2A 3DTVA 1BOFA 4PO9A 5BNTA 2IP1A 4ZPXA 1DIBA 1G8SA 2I33A 2JGIA 2WF6A 1SURA 3E9NA 3MJHA 1U3DA 1CWUA 3EEBA 3NTQA 4Q37A 4R71A 4YJ2F 4TV8F 3W2EA 1UDWA 2OFPA 1QH1A 4UMDA 2CLMB 3WLAA 3CX7A 3BOSA 3GELA 3H6GA 2OV8A 5HS6A 1Z39A 3AILA 4O7ZA 1G64A 3OIWA 2B20A 5GZ1A 4AG5A 2B5WA 4TL8A 3UTCA 2ZYTX 1X87A 2FG6C 4QARA 1NI4A 1X86B 2C9OA 5I6DA 1DO2A 2RONA 5D8DA 4LK2A 3HFSA 1IEXA 3V6MA 3WLPA 3B89A 1SXIA 2GPTA 1IPFA 3DLAA 4FIZA 3SXPA 5KYWB 3GRPA 1IN5A 2ZAGA 3QE9Y 4ZEMA 5JIBA 4OO3A 4HO1X 3SYMA 2WDPA 3NC4A 1VE3A 4RCZA 3WGLA 4CM8A 4L9WA 1V48A 1WCXA 1MOSA 4XJTA 4CDRA 1ZR2A 3U13A 5INTA 1U6IA 3P0JA 1VHQA 3QWFA 4OHKA 1BMQA 5CDHA 1Z22A 4EHDA 2ETVA 1E6KA 3DHVA 1IK4A 1IY2A 2VCEA 4MJLA 5LLTA 4CBVA 1HO3A 1TA0A 3LOQA 4BPRA 3THWB 2JH3A 2YWVA 1QO9A 3U81A 4E0BA 1NVUQ 4E88A 3NT5A 2R9VA 3U3KA 1G3IA 1GWNA 4HX9A 4NENB 3PFWO 5CXXA 4ARSA 1ECJA 3SNKA 2GH1A 3SC2B 5C7IO 1HF3A 1UMCA 4N5IX 4JS0A 5F1KA 2X7HA 2O8VA 1KVQA 1QRDA 2G3YA 2V7PA 1KE1A 1YCGA 3OFVA 3MJFA 4KXQA 4TS4A 2VYVA 1WPXA 1GQQA 3E82A 4XLZA 5CLGA 4P34A 5D3MB 4EQZA 5AVXA 3DFKA 1OZ0A 4O1IA 2P9ZA 2Q1YA 3OPYI 5I7OA 4TTPA 3NLLA 4MW9A 3SC6A 2C7OA 3TAXA 4R0VA 2QTRA 2WSIA 4FI3C 4GWLA 4RAQA 1EM6A 4WMLA 4JLUA 2R62A 5HILA 3LPDA 5KSYA 2CY0A 2VQFB 1P8JA 1XVUA 4BGUA 4C89A 4KP7A 4DA0A 1ES9A 4ZU1X 1TK9A 1WKVA 2QUAA 1ZHOA 4AP6A 1G8HA 1JWBB 2ZYAA 4NMWA 1YRQA 4OHOA 2C07A 1O96A 2NU7A 2NO1A 2UYYA 3E7XA 2YWXA 4DMMA 3EWAA 4RE5A 3ZGXA 5F4BA 3ZXUB 1Z8FA 1PQ4A 3AVUA 2AJDA 1UXIA 3GMDA 3I4LA 1SCDA 1T4BA 4RZUA 4MINA 1ZG3A 5LLDA 1G9SA 1U8TA 1GFSA 2PGJA 1EX1A 2RI6A 4J9VA 5L3ZA 1XEWX 3IAS6 4G5RA 3NM4A 3OM9A 1SULA 1RP1A 2LWIA 5HTOA 2H4JA 3H0KA 1ZXXA 4FHDA 3BK7A 1MH9A 3EWIA 3WQSB 4LHXA 4MMXB 1ORHA 3HFJA 1EA7A 2M6KA 5LZ5A 4PM4A 4ECAA 1AO0A 1MAVA 2J07A 3GH3A 3S2ZA 3V1LA 4K0KB 3DR3A 5C8YA 5KINB 2YS7A 1IEWA 4WE3A 1VZ3A 4HZUB 3EIWA 4QPJC 3Q7SA 4D3YA 1FK8A 3V8NA 5LMNB 1FRVA 4JXJA 4OREX 3COYA 3V80A 3T3EA 4UVGA 1LKZA 2FR8A 2YW2A 2QX8A 2CXXA 1K5DA 5CLLA 4BKUA 3T0IA 4QTZA 3F9CA 3MEQA 4EI9A 2I3ZA 1GR0A 2HL6A 1C7EA 2VUSA 1XTJA 2RCYA 3ADBA 4I3FA 4XWKA 2YFKA 2I99A 4EA7A 2QPTA 1EVQA 4IIHA 2VJMA 2AEJA 2ZT6A 3WRWA 4K6HA 1I6MA 1UK7A 5MN6A 2CLOB 1N36B 1E8NA 1EHCA 3QLJA 3ZZTA 1LSUA 1QCYA 1E2PA 2WHPB 3ILVA 2CMDA 3OICA 3PNVA 3DP7A 3QTLA 2XNJA 5EMMA 1C9DB 4XUGB 3W05A 3DO5A 4C20A 5IXJA 5JCZA 4GOXA 1O54A 4JSTA 5JWHA 3RR2A 2YRXA 3CSWA 2B8JA 2TYSB 4L4XA 4F2WA 4EO9A 2FA9A 1D2MA 1E0AA 3A6HA 5KNDD 1N9KA 2C2KA 3WVNA 2JJ1D 3QOYA 4OBBA 3U3RA 3DXFA 3O82A 3UW3A 4AWAA 1HKUA