4FFNA

Pylc in complex with d-ornithine and amppnp
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
363
structure length
353
Chain Sequence
MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYGLEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVLKERFGAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase/substrate
molecule keywords PylC
total genus 116
structure length 353
sequence length 363
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ffnA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ffnA01
1F8GA 3NUGA 3TOXA 4ND3A 2CNBA 2AEFA 3AY3A 5IDYA 1Z2PX 2PN1A 3E5NA 4MVJD 4YVFA 4BKPA 4B4OA 1JDBB 3HN2A 3B1KA 1HLPA 4HX5A 2W2LA 5GMOA 1F12A 3G3EA 3HWRA 3U9LA 5JO0A 3AU8A 1ISFA 2DTEA 3PHIA 1BDMA 5AXDA 4FDAA 1LDEA 4NNJA 4MKXA 2PNFA 2JCYA 1I5RA 2G17A 4YJHB 4BGIA 1MC4A 2I3AA 2NU7A 2AQKA 4E5YA 7MDHA 1A4UA 3HNPA 1YL6A 5KVSA 1GQQA 1IB6A 2YWVA 3AUAA 2I67A 4D46A 3FNGA 4CL8A 2GF2A 2YUTA 3C7CB 4C7KA 1ZVMA 3H3JA 3W6ZA 1JU9A 4J2HA 1QV7A 3M2PA 2PZJA 2YZGA 2FMUA 3HFGA 4NBUA 1UP4A 1XU9A 4EDFA 1EK5A 2HO5A 1CF2O 3BXXA 3VPHA 2W6NA 2JHGA 3JD4A 3PYXA 3OMLA 3GDFA 1PJLA 3PHHA 1EE2A 4U0KA 3PIIA 4WCFA 1PK8A 3ZU4A 4JJIA 3RUPA 2Q4EA 4BNVA 2HRBA 4QUKA 1YDEA 1E7YA 3JTMA 2DIKA 2HCTA 1I3NA 2V6FA 4IY1A 4RPKA 1B6RA 4IDCA 5FI3A 3VA7A 1EFLA 3ZZNA 3N8DA 3OICA 4D41A 2R7NA 3N58A 1RPNA 3INTA 3VOTA 3AM3A 1Z75A 3OQ6A 3VAZA 3W8FA 3DZJA 5I7VA 1BHSA 3FHLA 1MLDA 3QJ5A 4P4NA 3JYNA 5KVVA 4XJTA 3P5SA 3VVCA 3TL3A 2X0JA 4MKZA 4QSMA 3I9NA 2NVUB 5THQA 1YS4A 2ZCUA 3ZHYA 2AQ8A 3JZFA 4CPDA 3OEYA 4DPMA 1NQTA 4E4TA 1KEEA 1R0SA 2DPGA 2NM0A 4IBOA 2HMTA 3AJRA 3TJRA 1OBGA 4FJ0A 1MGOA 3H8VA 4DLAA 3CKYA 3JRWA 5CAEB 5JCJD 1ZMTA 2NQ8A 4AJ1A 5G0WA 2A92A 4S1VA 4YRBA 1ARZA 3O4RA 4BS9A 1E6EA 2V6BA 3RFCA 1B8UA 2VT3A 2Y68A 3WB9A 4CLXA 1KVTA 4FFPA 3V2GA 1NVGA 2X0RA 1U4OA 5L7TA 4ND1A 3KV3O 3U9TA 3GVCA 1H93A 4IIVA 5TT1A 3DONA 3EYWA 3VZRA 2FY8A 4MINA 2YZLA 2O23A 2Q4BA 4BQPA 2C59A 3HBLA 4Y6SA 4N5LA 4CUZA 3RKRA 5L51A 3GUYA 2PV7A 4NH4A 1P1RA 1ZIDA 2PH5A 4TV8F 1B7GO 3KXDA 1Y7TA 1DB3A 1KVUA 4PZCA 5DBGA 1EBFA 3ZHBA 4ALLA 3NJ8A 2ZKLA 3MCVA 5ICMA 5TGDA 1T2FA 1ZUD1 4H7PA 2Q2QA 1A48A 4YJHA 5IDQA 3R5HA 1VPDA 4ND5A 4A5OA 1SOWA 3TQTA 3ZU5A 1HDYA 4CMKA 3CH6A 3AW8A 4IS3A 4B8WA 1KYQA 4BMVA 1UDBA 3BMNB 1WPQA 4LSMA 4U5QA 4BHTA 4AVYA 3KHUA 1LRLA 1GADO 1AXGA 1DIHA 2GN6A 2F1KA 3L9XA 4EZBA 3KSZO 1R4NB 4J2OA 4D0RA 5B4VA 2W4QA 4XYGA 4O86A 1B3BA 1I3MA 1VJ0A 3AX6A 2ZTMA 1PGNA 1A5ZA 2Q1TA 1EUCA 1GL3A 4MV9A 3BTOA 3UGKA 5I9LA 5JFOA 2Q1WA 4DC0A 3IL2A 1E5QA 4NPCA 3IJPA 1LTHR 4JN6B 3B1JA 3A14A 4RF5A 5JDCA 4OHUA 1LEHA 1PR9A 4GKVA 2VHVA 4DVJA 2W6ZA 4YAKB 2WDZA 1G1AA 2ZTVA 2J5KA 4BKRA 4PIVA 5DCYA 1R15A 5JNLA 1EUDB 4NJOA 1I3LA 2WSBA 4ZRNA 1RKXA 3DC2A 2UV8A 4NIMA 3JD0A 2Z1NA 2W2KB 1YDWA 1XDWA 1I32A 2OL4A 3ONDA 4DREA 4WLVA 3NX4A 1M76A 1OC2A 4GI2A 4IDBA 5F1PA 1BMDA 4DYDA 4NK4A 4MPDA 4UUMA 4Q3DA 4HUJA 1Q1NA 1MXHA 1ZMOA 4XQEA 3IQDB 5KKAA 7ADHA 1U5CA 4RVUA 4ME6A 3JQGB 3KAKA 1I2CA 4CQLB 3GGPA 2BFMA 1MFZA 2LDXA 1YGYA 3L6EA 4JBIA 1XR3A 4J9VA 1XU7A 1Q2XA 1KEUA 2I5PO 3KZVA 4FFOA 3A28A 4PG5A 3NDIA 1ULUA 3FR8A 1U3VA 3AY6A 4PRLA 4TRNA 3U49A 1VRWA 2UAGA 1V9LA 3DDNA 1P1FA 4U0JA 5A9SA 4AJLA 1QP8A 3D3EA 2J5QA 2HLPA 5A1TA 2R82A 1G0OA 1N2SA 2ZYDA 3B20A 3JQ8B 4YT2A 5TSDA 2Q46A 4L9RA 1EBUA 3VH1A 3Q2OA 1DEHA 4F46A 2NWQA 3KBOA 4XDYA 5DT9A 4PZDA 4HFJA 3EVNA 3K96A 3UUWA 5CA1F 1IPEA 3OUZA 5DF1A 1J6UA 3WBBA 3E5RA 2GZ1A 3VZQA 2YHIA 4XB1A 2P5YA 2C00A 4CMAA 1XLTA 2CVQA 2BF7A 3FF4A 4FGSA 1R4NA 3PLNA 5DOZA 5H80A 3EMKA 4GSKA 4Q3EA 1ULSA 4O7WA 2YZ7A 1IYZA 3SBOA 2NVUA 4EJ0A 1JKIA 2BI8A 3H65A 1OFGA 5A04A 1HEUA 1UAGA 4XIYA 3TINA 2BGMA 4C4OA 4W9NC 4YJDA 1BXGA 3BG5A 1H9AA 2QRLA 2IEBA 4L8VA 1P1KA 4YT8A 4PVDA 2HMWA 1DHTA 1SOVA 4CM5A 1U7TA 1R16A 1K0UA 2AW5A 2NTVA 4OO3A 3EW7A 3BMQA 3FCOA 4RL6A 1VKZA 4WASA 1XELA 3ZHZA 2I9PA 4EUHA 3HDJA 1W6UA 4HFNA 4J0EA 3ZWBA 1LDGA 4YAGA 1LI4A 1F14A 1M67A 1M0WA 3DTTA 4CM9A 2X9GA 4L4SA 1NFRA 2OORA 3CINA 1DIAA 3UCFA 1E1MA 4AJIA 4O4IF 3TIGA 5JY6A 1LXCA 2BRUA 4IIUA 1KJQA 3WO1A 1SO8A 4L1KA 3JQAA 3OECA 2POQX 2NU8A 2UDPA 2NADA 2P5UA 3NKLA 2YDXA 3KTDA 4F45A 1GYPA 4J1TA 1C3OA 2PY6A 1LRJA 1DRVA 1YOVB 1H6AA 3GDGA 2PZLA 4FGWA 4OMUA 1JAYA 1JDEA 4FFLA 3I83A 1X13A 2JD1A 5T8KA 2J3KA 5DNAA 2W2LD 1K3TA 3DFUA 4RZIA 4RPHA 4CM6A 3WGIA 5IZ4A 4ZQHA 3FR7A 3UKOA 1PX2A 2NV6A 4PLGA 3QVOA 3TSCA 3DBHB 5IF3A 3JRXA 5ER9A 1O5IA 3QQPA 3ST7A 3VPGA 2VN8A 3VH2A 4AJ2A 4TQGA 3MWDA 1PIWA 4WCFB 1E7WA 2UUOA 5LP6F 1E3EA 5J2UF 4IJWA 4KQXA 1PZGA 1WMBA 2G5CA 1W93A 1EFKA 2O2SA 2WYWA 3I9LA 2WYVA 3F6YA 2WWRA 2X22A 4GX1A 4WNIA 3NUAA 2EGGA 5CDUA 3EY4A 5A5FA 3CIFA 4JBGA 5CDSA 3AK4A 3GA0A 5TLSA 3A4VA 4XA8A 3GNTA 4B3HA 4O4JF 3DZKA 4GVLA 1N9GA 2VYNA 2D8AA 2DBRA 1X0VA 5HM8A 2CVZA 4WLFA 3F46A 1DOHA 2EEZA 3QVTA 1GCUA 4JCOA 3JD1A 3NEPX 1X15A 3T4EA 4RDIA 3W6UA 3AUTA 4FW8A 4BNXA 3IUPA 4PGFA 2GLXA 4WGGA 5IG2A 3ZWOA 3JQBC 1NX6A 3HSKA 4XCVA 3OETA 1R0KA 1CJCA 4CM3A 1HYHA 1P77A 2EJVA 3FWZA 1PS9A 1SCUA 4FU0A 2YDYA 1MUUA 4E3ZA 2Z95A 3NAQA 4KTTE 3GAFA 2V59A 2RBEA 2DTXA 3CMCO 1A71A 4DPKA 1P74A 2GN9A 1HWYA 4IDDA 4DBVO 3DZBA 3PHLA 2HRZA 2O3SA 3LZ6A 1Z45A 1I30A 2HSDA 5EMHA 3DEYX 1GSAA 1CS0A 1QRRA 1ZKMA 3TZCA 2XCLA 4FBGA 2PD4A 3D0OA 2VNSA 4ZQBA 8LDHA 2NTJA 1ISJA 4MVJG 4P22A 4I50F 1E92A 4URFA 4DIFA 1ZW1A 4L76A 3U5TA 3ULKA 3D4NA 2D5CA 3INRA 2B35A 3S2GA 1PZHA 4CMGA 4OOEA 1GEEA 4BL5A 4OXYA 1NVTA 2PKQO 2GZ2A 3GGGA 1EEHA 3DF7A 4ZQIA 3I4CA 2RAFA 1T1SA 5G0TA 4I9HA 4YR9A 2Y05A 3E18A 3ZV5A 3LT4A 4O1MA 5DBFA 4E4YA 4EYEA 5BQFA 1NYTA 3QLJA 5EPOA 3E9NA 4GVXA 3PTZA 4A03A 3RU7A 4JP3A 4II2A 2WMDA 4O4HF 2FP4A 3P19A 4B4UA 1HZJA 2PA3A 1GSOA 2PKQP 1AUPA 4XJSA 5GZ6A 4TRJA 4YRAA 4NBVA 5KCZA 5L7YA 1R37A 1D7OA 2QX7A 2ZCVA 1ZBQA 3MOIA 1HRDA 5CG2A 2GUGA 1ISMA 3ZW9A 1EE9A 1O8CA 4CQMD 2DBVO 1H6DA 2AG5A 4RPJA 4EJ6A 5IDWA 4BNHA 4INAA 3ZWPA 1Z2NX 3HO8A 1ADBA 2IEDA 2R6JA 5C7IO 1JA9A 2YYAA 5DCWA 5JMPA 1WW8A 4YPOA 1JN0A 2W6MA 2W70A 4PG6A 2NVWA 4Q3AA 4WCFC 4E5NA 3ZWCA 5CA0F 4NU6A 2R85A 1HE5A 5L3ZA 4PLCA 1ZEJA 4J49A 4MIYA 3OF2A 2O3JA 3QSGA 4XYEA 5JDIC 1NHWA 3S2IA 5TS3A 3K73O 3VH4A 4C7JA 4PRKA 3L07A 3C1OA 2EW2A 1UZLA 3PRJA 2VWQA 4OSPA 1E7MA 4XR4A 4CLRB 5G4KB 3QW2A 2DFDA 3MJTA 4Y8VB 3O8QA 1ENOA 1ZZEA 2J3JA 4CMEC 1XQ1A 4IGFA 3FNEA 5BNIA 2WYOA 2QRJA 2PFGA 3AI3A 2ZQZA 1BXZA 4D0SA 3WMWA 4YJGA 4WK6A 5A5EA 3I5MA 4UREA 3ON5A 4NHEA 3WGOA 3I9KA 3UXYA 4BV9A 4BNUA 3QWHA 1HZZA 5ILOA 1HE2A 3L4SO 1M2WA 3BTUA 1YBAA 4FQ8A 5A9SB 3V2HA 2B4TO 1E1LA 1HKUA 3PGXA 5BSGA 1ML3A 3G17A 2CD9A 3TZQA 6LDHA 2DQ4A 2E4AA 1ZXBA 2YL2A 2PZMA 3GF4A 3RV3A 1FDWA 4RQTA 3GNSA 1FDUA 4C5BA 4K6CA 4MA0A 1HL3A 1S6YA 2WD7B 3D4OA 3OH8A 2GN8A 2I65A 4QFDA 4IJUA 3VTZA 4CLOB 5MDHA 1BW9B 3SXPA 1W4ZA 4OIMA 2EV9A 2HJRA 3BMCB 5F3RA 3U9SA 3O03A 3R6DA 4MVJI 4FFMA 3MWEB 4KWHA 4MIEA 3WQSB 4O7ZA 5IZCC 1GPDG 1ZCJA 3BTSA 3GVPA 4LSWA 4J90A 1BSVA 5K6AC 1P44A 2D2IA 1X1EA 2Z1MA 3IJRA 2D59A 1U4SA 2ET6A 3GFBA 3RFTA 2PVPA 4CUKA 4N54A 1BVUA 1TI7A 2BLLA 2P0AA 3H4VA 2GNAA 2PBZA 1YE3A 3RAJA 4Y6PA 1KJIA 3D5TA 2O4CA 1Y5RA 1YB5A 1E7QA 4HNVA 2YRWA 1MB4A 3WMXA 1KERA 1FF9A 1NPTO 1PGPA 2EKQA 3ZWMA 3F1KA 1P0CA 3TFOA 1OMOA 2ZIZA 1LLUA 2OUIA 3GR6A 3N74A 3NDRA 1C0KA 4DGSA 3E8XA 1P0FA 1CQIA 1D1SA 1HDGO 2W6PA 2BELA 1HSOA 3BHIA 4UUPA 2Y66A 3DAGA 4XYLB 3A06A 4QT0A 4QQRA 3I23A 5CPBA 4R1TA 2NU6B 1ORRA 1WXDA 3K5PA 1U28A 3AOGA 3VPXA 4LMPA 2ZDQA 4BNLA 4XZ3B 1DXYA 1E6WA 2P9EA 3DOCA 3H5RA 4S3MA 4FR5A 1MXFA 3LYLA 5JDIA 3NT4A 4E6PA 1KEPA 1PWXA 4TSKA 1ISHA 3D1LA 3ONEA 5T5QA 1DLIA 1AUVA 4NI5A 5FEUA 3QE3A 4FC6A 4UUNA 3AUSA 1DAPA 5KVCA 4RLHA 2GQRA 1KC1A 3LC2O 1WDLA 3RFVA 3EC7A 4XRRA 3DMYA 3UCXA 4O7NA 3EUWA 4A27A 4UEKA 3ZWVA 5CAEA 4IMRA 5L40A 1JKJB 1ENYA 2DFVA 1T25A 4JBHA 1UDCA 3S8MA 5I7EA 4LVUA 4ALJA 5IDXA 4E13A 5DZSA 3X2EA 2QIOA 3PZBA 1O95A 1S7CA 3GRKA 4IXTA 4NU5A 5F21A 5FNVF 3V1YA 3U4HA 3TN7A 4RZQA 4CV1A 4Y9DA 4Z3DA 3RJ5A 3GLQA 1JLLB 4DMLA 1SAYA 3H9QA 3FNFA 2RHCA 4TVOA 3RASA 2PR2A 4TROA 3PIDA 5C5IA 3G49A 2CF5A 5A9RA 5U4QA 3QP9A 1PQWA 2FSSA 3KALA 3R5FA 4YDRA 4YAKA 4WBNF 3DXFA 1A9YA 2XOXA 4IMPA 1CE8A 5GZ1A 2J3HA 3BMOB 4J7UA 3ORRA 3AI1A 2GPSA 1E4EB 3I6QA 3OM9A 3S2FA 1NWHA 3DBHA 4XDZA 1EQ2A 3K8ZA 2EP7A 2DVMA 3HB9A 1HTBA 1IHYA 2VYND 3LLVA 1HE4A 2GSDA 3V1UA 3DMTC 4ZOLF 3LQFA 4BO1A 1LU9A 3I9OA 4XYLA 4BNZA 5CHEA 4N7RA 4YA6A 5JDCC 2J9GA 2CF6A 2Y1CA 4CM1A 3L77A 3PK0A 2JFGA 1DLJA 2FR1A 4GPD1 1P45A 1QYXA 1Y1PA 1KVSA 1IZ9A 3PWSA 4HBGA 3KVOA 4L74A 3PP8A 4TUYF 1UZNA 4GBJA 1OAAA 4W4TA 1ZK4A 2EKPA 3KSDO 2H63A 4IGEA 3JQ9A 1R12A 1F06A 1KIFA 1Y6JA 3KYBA 1E3IA 3LDHA 5JYDA 3F3SA 3AOEA 3RUDA 3JD3A 3TW6A 2DZDA 2DUUA 4RVFA 3CEAA 4TWRA 4EGJA 4KMSA 1MFPA 3DBLB 5CPFA 1VKOA 2A94A 5LA6F 1EQUA 1ZK1A 4IINA 2RH8A 4YQZA 4LK3A 2NUAB 3WXBA 3MJ4A 5J23A 4D43A 4M89A 3GGOA 4LRTB 5A3JA 4PG7A 2GDZA 4HNGA 5G4KA 2VQ3A 3OIGA 3GPDG 1VSUA 3AU9A 4GMFA 2CSUA 1T36A 3QVXA 1BW9A 4E2XA 3RC2A 1QSGA 1EVJA 2FOIA 5KIAA 2HMUA 3LVFO 3C7DB 4ND2A 3LP8A 3DHNA 2FSVA 3PJDA 1B3RA 2QQ5A 3WG9A 3UOGA 3ETHA 1ISIA 3TWOA 4R4JA 2DKNA 3ORQA 2X23A 3AY7A 1DRUA 2JAPA 1ADFA 4ZICA 4J0FA 1WWKA 2XAAA 1BXGB 1Y5MA 2UVDA 2DAPA 5ITVA 2YQ5A 1SCUB 2DU8A 3E82A 1WAMA 1X1TA 2VZ8A 4WNCA 4B7XA 4PG8A 1GYQA 4TRRA 3VTFA 3EVTA 4FFNA 1Z82A 4GSLA 4GMGA 1ZFNA 2QZ9A 2X5OA 1IY8A 2EP5A 4AJNA 1E3JA 4PN3A 2CFCA 5JE8A 4BO3A 4EGFA 2DC1A 5JYEA 2V7PA 4Z9YA 2RHRA 1AHHA 4WCDA 4DIMA 4J3FA 4TVBA 3LWBA 1TVEA 2ZJ1A 1B16A 1Q0LA 3HHPA 3RSHA 4BNYA 3RV4A 4HXYA 4IJVA 1OZAA 3RBXA 3SJUA 1WVGA 4NYEA 1GEGA 3NDJA 1NQAO 1XKQA 3WR5A 3L0DA 5L45A 1U2DA 2NU6A 3A1NA 5AQ1A 2R00A 4OXKA 1R4MB 4MIOA 1B6SA 1GZ3A 3QVSA 2Q50A 2HQ1A 3WGZA 4CJXA 1GTMA 1GCOA 3INGA 4CMBA 2DT5A 4E2WA 3GT0A 3V5NA 4YAJA 1U3UA 4KOAA 3PYMA 4YEDA 4R5HA 5A05A 1KUTA 1RM3A 1SMKA 4MV1A 1SBYA 4L4XA 3FPCA 3OUUA 3NT5A 3HE3A 4OH1A 4BO8A 1HDCA 5JS6A 1HLDA 2EGHA 3JQEA 9LDTA 3ZI0A 1LSOA 3WOHA 3ETGA 2HAEA 5C1PA 1K6IA 5I9NA 1K5HA 1M0TA 4Y67A 1MV8A 2X5JO 1V35A 1MA0A 3DB2A 3LT0A 4O0LA 1GLVA 3TZKA 1KBLA 1J5PA 4JP2A 1N5DA 1UH5A 3JQ6A 2FB9A 1OI7A 5KJFA 5GONF 4ND4A 1IOLA 3MJFA 4RJTA 1I36A 4RV9A 4LCJA 4Z0HO 5L7WA 4M55A 4ALNA 1JQBA 3I12A 2PGJA 2OBYA 3JQGA 3H2ZA 3GC6A 2C0CA 3MJCA 3MTJA 1NFQA 1K6XA 3PJGA 5A03A 1U2GA 3K92A 2PD6A 4BNKA 4E2YA 4ALMA 4J43A 3RVDA 6ADHA 4GWGA 5IN5A 2YV1A 1CQJA 3TL2A 4FOOA 4E2ZA 1PJ2A 3KYCB 3X2FA 4CM4A 3PJFA 3S2EA 4H3VA 4R1NA 4P4GA 4TV9F 3ZV6A 4WEOA 3WJAA 4L0QA 4W99A 1VJ1A 2R00C 3OJLA 4AJHA 3ZW8A 2E49A 5CEEA 3JQ7B 3I6IA 3NT2A 3DBRB 4R16A 1H6BA 3N6RA 2AG8A 3ANLA 3PQDA 1MP0A 5I9MA 1N8KA 1ZO8A 1UXJA 4KZPA 3RFXA 1LLCA 3GQVA 4HNHA 3VKVA 1UAYA 4GKBA 5BSEA 4EEZA 2X4GA 1H0KA 4FCCA 1LQTA 4YCAA 2FPPB 5JH7F 2BFOA 1KEVA 1NQOA 3PZRA 1YVEI 1M75A 3CZRA 2VWGA 3DZGA 3FRJA 1QYWA 3MJVA 3ROQA 4I8XA 2BMAA 3FWNA 1LLQA 3DBLA 1WR2A 1B8VA 1E5LA 5FFFA 2X0NA 4A0SA 4JGBA 1H94A 5DP1A 3PXXA 1HYEA 2E48A 4PLYA 3WNQA 4PCVA 4WLOA 3SC4A 5KTKA 1VL8A 4FGRA 1P1IA 3GEMA 4ESOA 1JW9B 3SX2A 4DRYA 4BNJA 4JK3A 3GVXA 4ROSA 3RUHA 4I5GA 2EKLA 2V58A 3AUUA 1KC7A 2CUKA 4I9UA 2JKVA 2J8ZA 3HZZA 4W7IA 4K6FA 3K2BA 3ROKA 3CUKA 2BGKA 3F5QA 3IIEA 4QO8A 4PLTA 3RUIA 3DZHA 3ZWXA 1EHIA 3UF0A 4BIIA 5TIIA 2CDAA 3Q0EA 4R9RA 1NPYA 5CEJA 1DIGA 5HA5A 3WQQA 3BYZA 2FR0A 1WDMA 1NR1A 2VRCD 1GDHA 1KY4A 2O3QA 3RBZA 1GGOA 4PG4A 1EUZA 2FP4B 4DMMA 1P33A 3KYCA 4LRSB 4E5KA 4CM8A 2ZYGA 2X0IA 4MV8A 2TMDA 2ZDHA 2V65A 5COAA 1VSVA 4CMIA 3U54A 2YW2A 2AE2A 2Y0DA 2Z04A 3P7MA 2VUTA 4MOWA 4OKNA 5T64A 3WQRA 2CVOA 3GH3A 5DN9A 3A9WA 4BO4A 3QIVA 1AGNA 3PHGA 1XQ6A 3OJOA 4C5AA 4CV0A 4JJFA 2B0JA 1U5AA 3QWBA 4GLOA 1ENPA 5ADHA 1I01A 1ID1A 3V1TC 4DQXA 1BRMA 2OGUA 3U62A 2IRWA 2OMEA 3C3XA 3W4JA 4ONEA 2R7MA 2W90A 1PWZA 1PJQA 3OA2A 4IHJF 2RH4A 4NZ9A 4D45A 3G0OA 3ASVA 4WKGA 5JVLA 4P38A 5EL0A 1KVQA 4XGNA 3W1VA 1R66A 3KOUA 4QSHA 2DTDA 2BHLA 3DAFA 1GY8A 5TQVA 1MG5A 1RM4A 3ANMA 4W7HA 2DPHA 3MJEA 2D3TA 3RKUA 3PFWO 4O7LA 1ZSYA 2VHWA 4FJ2A 2AMFA 1JKFA 4M1QA 1IUKA 4M86A 1G6KA 3KO8A 1DSSG 2VOEA 3G8CA 3GVIA 1R4MA 2Y0EA 5HWSA 1PTJA 4FN4A 3ENNA 2Q1SA 3WLEA 4BQRA 2YZMA 1GZ6A 3UW3A 3WO0A 1C14A 3F4LA 5JMWA 4CR7A 5FI5A 3WTBA 1LQUA 1NWCA 3RJ9A 3IDSA 3HDHA 4EUFA 4Y6RA 3DHYA 3L4BA 3V2UA 4CM7A 3ZN2A 3G79A 3U4CA 4M8SA 5JBIA 1GR0A 2X8LA 3SJ7A 2HMVA 3I9JA 3G1UA 4PLFA 3NTOA 4FPXA 4HQ6A 3BZUA 5L4LA 1DBVO 1EZ4A 4D3FA 1IOVA 2YQ4A 5TNXA 3ICPA 2XD4A 4CLOA 4CM8B 4HNTA 3WDSA 5LC1A 1D3AA 1GAEO 4BO5A 1J4AA 2P9CA 1PQUA 4XQCA 4WOKA 4AJEA 5L4NA 1I24A 4FIZA 3GIDA 2D1YA 2DUWA 3PLRA 2R84A 3R9RA 4OSOA 4O7TA 2QK4A 1J49A 5FF9A 1A27A 2QYSA 2ZJ0A 3P2OA 1NM5A 4ID9A 4FB5A 3GOHA 1DFGA 1U8XX 3ZNPA 3DR3A 4JIGA 1ONNA 4ZQGA 5ICSA 3U3XA 3WIEA 2IXAA 3DBRA 3PVZA 3D64A 4CQMB 2GQSA 1B14A 4D42A 5F5NA 1CDOA 1AE1A 2NNLD 1KEWA 3PDUA 5GZ3A 1EVIA 2AEMA 1NVMB 2C07A 2JFHA 3CPSA 1XA0A 4MAMA 2AA3A 2EXXA 2EERA 1YO6A 2Q45A 4R51A 3S1LA 3H5NA 4HWKA 2FRDA 1T26A 1CQJB 4DLKA 4ZHQF 2AQHA 3H7AA 3BMNA 3STHA 4AL4A 2R87A 4WUVA 1GQ2A 1X7DA 3JYPA 4J6FA 5G0UA 4DL9A 4PZEA 2X6TA 3VZPA 1LC3A 1E0DA 1XHLA 2FPPA 3EZLA 3BMQB 4ZJUA 4MV6A 4CMEA 4Z9XA 1NXQA 5A02A 4XQ9A 5TJHA 3VPSA 4AICA 3E03A 1PGOA 5IAAA 1YWGO 4XB2A 5LOVF 1FDSA 2DBQA 1VL6A 2I76A 3E9QA 3LT1A 5KJ6A 4E32A 4PFJA 2SCUA 1A9ZA 3O8QB 3R0IA 3DMTA 4OKIA 4A10A 5C37A 3KETA 2YFHA 3NTRA 3T4XA 4YAIA 1YONA 4EGQA 5AOVA 3GLKA 1C0PA 1M66A 5EINA 4BNNA 4CR6A 5BT9A 5G4LA 3E9MA 1QLHA 2YRXA 2YS7A 1EMDA 1XCBA 2OOSA 4BO2A 4EW6A 1IULA 3EHEA 4I4TF 3R5XA 2H1SA 4ZVVA 1C1DA 4N5MA 1YKFA 5TF4A 2J3IA 1GPJA 3HDQA 5CEFA 3ROMA 5U9CA 4Y8VA 1D1TA 1OC4A 4AJ4A 1X7GA 3U4DA 1DC6A 5K0ZA 1BXKA 1WLYA 2R2GA 2D5AA 1NTOA 5EERA 1ISGA 4H16A 1JVBA 3T7EA 1R6DA 1XGKA 3JV7A 1Z7EA 1Y8QB 4O5OA 3BTVA 4R1SA 2VWPA 2PGDA 4J9UE 1JVSA 4JROA 2DM6A 4XKJA 1P31A 4I5FA 4O2BF 5JQWA 4O63O 1VI2A 3GK3A 4NBWA 3QWFA 2WYUA 5JC8A 1KY5A 3U55A 5JCXA 1UJMA 4L4RA 1ZJZA 2OBNA 4ZQEA 3AI2A 4O83A 4MVJF 1XEAA 4EEXA 2Q1UA 4J4BA 1PL6A 1WP4A 3U09A 3HB5X 1YL5A 3W8DA 4D3SA 1PZEA 3WNZA 1E3WA 1U3TA 1LBEA 3L4BC 4DIOA 3QRWA 1R0LA 2QZZA 3WSWA 4FD3A 4O6VA 1OBDA 2F00A 4J7CA 3G8DA 3GRPA 3O38A 3U0BA 3DO5A 1E77A 4O7RA 4D44A 1SC6A 4TMFA 3QA9A 1KETA 5HRUA 4O84A 1V3UA 1YL7A 3TNLA 3SVTA 1QV6A 4BO7A 3RC1A 2XXJA 4D79A 1O9BA 1VC2A 5C7OO 3V4ZA 1UP6A 3F47A 1I33A 5LDGA 3DQPA 4KDFA 1T2DA 3VDRA 4IPTA 5CB4F 5C3MA 1DIRA 2BFPA 3UFXA 5HBRB 2W6OA 2ZB7A 3CTMA 4IQGA 1JKJA 2E6UX 5ITWA 1T24A 1HSZA 1QORA 3FI9A 3SC6A 1L1FA 4DA9A 1RWBA 2VNAA 1PSDA 1HE3A 2OP0A 2OP1A 2Q3EA 3E48A 4BGVA 4BUCA 1HDZA 1PJTA 1RYEA 3B70A 3IMFA 3PEFA 2QG4A 4I5DA 4L75A 1B2LA 4RPGA 4Q39A 5C7LO 1GV0A 4II3A 4P4LA 4XIJA 4EJMA 3D3WA 4Y98A 5KWEA 4HFRA 1PEDA 2OFPA 3KLPX 1ONOA 1TEHA 5KX5F 2GRAA 3GZ4A 1N7GA 1TB4A 2C20A 2VOJA 3PHJA 4BKOA 4BNTA 2YV3A 3P2YA 3LF2A 2I87A 4MA5A 1D4FA 1DAOA 1CYDA 3GAZA 4MP6A 2YW9A 3JZIA 2R7LA 3KAJA 5BPHA 1UXHA 2OO5A 4PLVA 5JAQA 4B7UA 4O81A 2QF7A 4AJKA 3NYWA 2HJSA 2IODA 3ZCXA 4R54A 2QHXA 2ZYAA 3TFQA 2PD3A 2I80A 4JLWA 4D7AA 4BNWA 4ZGWA 4CQMA 3OHSX 5F5LA 5CDYA 1I7LA 3WICA 1W73A 4ILKA 3MTGA 3JD2A 4J91A 1EK6A 2O7SA 3CMMA 5A3VA 3JQ8A 1IPFA 2YZNA 4O59O 3HQ4O 1DO8A 2ZTLA 3QFFA 5KJ1A 2JCVA 2WD8A 5THKA 5C1OA 2GO1A 4PLZA 5G0SA 1PU2A 2GR9A 1T4BA 2GN4A 1QYVA 5JLAA 1B15A 4BB6A 2I8CA 3R3SA 2G76A 3WTCA 3WGHA 4XZ3A 1HF3A 4Q3BA 1ADGA 4R5MA 5ILGA 5G0VA 2H6EA 4C5CA 4WE3A 1LSJA 4AJOA 4GGPA 4OGWA 4D3DA 3DOOA 1P1JA 1Q0QA 2EWMA 2QYTA 1F17A 4R3NA 3WFJA 4RVDA 4MV4A 2Q2WA 4QEDA 3ORFA 3UFXB 3KB6A 2E37A 3IP1A 4FS3A 1VE9A 3K9QO 1V8BA 1ZSVA 2NUAA 4B4WA 4YB8B 2RCYA 5EQFA 3H9GA 1XSEA 1VBHA 4I5EA 1C1XA 4IM7A 2H9IA 1TT5B 3VZSA 3JQAB 1W8DA 2UYYA 3V8BA 3AFNA 5T8KC 3GHHA 4AFNA 5CG1A 3SLGA 1P9LA 2O50A 2VZ9A 3RCBA 3FSRA 4XX0B 1CERA 1LDNA 1PJBA 3RI3A 4HV4A 4JQCA 2O3TA 1Y9AA 3O9ZA 3M2TA 3KYDB 2YY7A 5AVOA 4BV8A 3QWIA 1NFFA 4YJGB 9LDBA 3GDOA 1YJQA 2D4AA 1KC3A 4GX5A 3OJ0A 3T7CA 4I55F 5BMVF 1Z7BA 3KREA 3WGYA 2VHXA 4ZD6A 3MWEA 3W4KA 3I3OA 5IYZF 3H5AA 1ZEMA 5A06A 5AXBA 1UDAA 4GWKA 4RQUA 4TKLA 2Y0CA 5B4TA 5F1OA 2VQDA 2JCXA 2O48X 4Q3NA 1I0ZA 2J5RA 2ILTA 3SE7A 2Y1DA 3MJSA 4MV3A 4A2CA 3IP3A 5JAMA 3CXRA 3JQFC 4GAEA 1GFSA 5COBA 2X9VA 5JCJA 3H9EO 4CR8A 2ZTUA 1A72A 1YB4A 1VJTA 5G2OA 1CIVA 3AM4A 5KOIA 4LMRA 2GPWA 1FJHA 1DV1A 5KVQA 1WDKA 2NQTA 1XYGA 2IE0A 2Q2VA 2EIHA 3IUSA 3L9WA 4E31A 2W6QA 3GY0A 3LC7O 1D8AA 1F8FA 3AW9A 2NSDA 1LX6A 4G65A 3ZWNA 2HU2A 3D5QA 4I1IA 1YQDA 2Z5LA 4IXWA 5ENDA 2CNUA 3HB4X 4I9NA 2I3GA 3CZMA 1UP7A 3Q9UA 1GUZA 3IKVA 4CV3A 4IIJF 3V4SA 5L4SA 2Q99A 2FR8A 2X7HA 1X14A 4CM9D 4MVJM 1SB8A 2NVBA 4OL9A 4ZQFA 1ZK0A 3DZIA 3H3FA 3LF1A 1E7SA 1WZEA 3WNVA 4YT4A 2FPIB 2YYYA 2ZATA 5JQGF 1VL0A 3DL2A 4MO2A 1LJ8A 4ZRMA 4DYVA 4W6ZA 5BSFA 1UR5A 3VPCA 1PJCA 1WMAA 4MVJA 2ZB4A 3AWDA 3TIIA 4QXMA 4RF3A 1JDJA 1LDBA 1G0NA 1YQGA 4GH5A 5EJ2A 2IYOA 1C1XB 2ZB8A 2C82A 2O2YA 1LA2A 1KOLA 1FDTA 1Q7GA 3PWZA 2VPQA 2B5VA 3HADA 4OXNA 3KYDA 5HS6A 3ADOA 3R23A 2G1UA 1GUFA 2I6TA 4HADA 1T2AA 2IZ1A 4E0BA 2BI7A 4RPLA 1Z6ZA 1DDOA 3PJEA 3GZNB 2ZK7A 2H5LA 3NRCA 3PI7A 3TDKA 2OHXA 3K30A 2FZEA 1QYDA 4L73A 5KKCA 5JO9A 3GPIA 1PGQA 2VZ0A 1I7NA 1ZK3A 3KRTA 1M6WA 2BD0A 2X86A 3ANNA 4HP8A 2HMSA 1VKNA 3DBVO 2HK9A 1E4EA 1Z73A 3I4FA 1W96A 1WNTA 1YQXA 3MWDB 3TPCA 1YOVA 1YBMA 1PZFA 1N1GA 1TXGA 1O94A 4UVEA 5JAIA 1TLTA 4BKQA 4CMHA 2P68A 2IZZA 4PLPA 4A7PA 5B12A 4U7WA 4Z0PA 1BG6A 1GQYA 2B83A 2VYVD 3AFMA 3UVEA 1LRKA 1Z2OX 1LDYA 3TQHA 5FWNA 4NJMB 4WJZA 4E21A 2HGSA 5C8YF 3OQBA 3KLMX 2CNQA 2YFQA 1JLLA 1CEQA 1V3VA 4OM8A 4CMIB 4HFMA 3OEWA 5BPFA 3ZNNA 4E5PA 4PLHA 3BIOA 5T67A 4DUPA 2GCGA 3OIFA 2JD0A 1JAXA 4AG3A 1KJJA 4Q3CA 3KM0A 1Y8QA 2VR1A 4GLLA 5HTOA 5KJEA 3KEQA 3K2EA 1QLJA 4RGBA 3WIDA 4ZHSA 5IXSA 3TRIA 4YAEA 5J2TF 4KUHA 1U9JA 5DBIA 3PFFA 5I8ZA 4R69A 3F5SA 3RUFA 1LLDA 1EZ1A 2AE1A 1PS8A 4YJ3F 2I99A 4KUGA 2ZB3A 1X7HA 3EGOA 4IS2A 2Y1GA 4X54A 5CFZA 2Y1EA 1EVYA 1YRLA 1HDRA 4IZOA 3VVBA 3UN1A 4MP3A 1HDXA 2O3RA 4PVCA 5IN4A 2GERA 3DOJA 1EUDA 4NFSA 4NQZA 3CSDA 4BB5A 3LT2A 3GNQA 1NAIA 4DC1A 4IZHA 1VM6A 1T4DA 3PQEA 1E3LA 1ONPA 2P4QA 1QXSA 1DC3A 1QR6A 3WYEA 2IYPA 1BVRA 2Y93A 3WYCA 4ALKA 2G0TA 3LSYA 1HYGA 2AHRA 2BKAA 4YJFA 1B8PA 4RLSA 5HS4A 4YACA 1IZ0A 4E33A 5DULA 2X1HA 4QO7A 1CWUA 3QWAA 4YJFB 4J4TA 4BO9A 1KJ8A 3ZHXA 1PQPA 4H15A 4RF4A 2WTBA 1Q7BA 3EDMA 1ZK2A 3WBFA 4K28A 4J1NA 1ZSNA 4WLNA 4GX0A 4U6QA 4M54A 5CDGA 3Q2KA 3OIDA 3K6JA 5EN4A 4NG5A 1U1IA 4BO0A 3FBGA 4HY3A 1NBOA 1HETA 2VUUA 3ABIA 2YJZA 3FNHA 1N1EA 1P3DA 3BMOA 2Q49A 4XWYA 2DLNA 4MP8A 2AQIA 4UUOA 3ZNQA 1AHIA 3HUDA 3JQAD 1I3KA 1RYDA 2PGLA 2VRCA 4BNGA 2J6IA 2W71A 2W8ZA 3WX0A 4BOYA 3JQ7A 1Q7CA 3IAHA 4IJKA 2NTNA 1GD1O 3WWYA 1H9BA 3IOYA 4UULA 2TMGA 4B4VA 4OQYA 4Z6KA 4CLEA 2GD1O 3Q9NA 3QV1A 1J0XO 1BXRA 4RVSA 5T6BA 4CM4B 2GYYA 4U6SA 5EZYF 1OOEA 4M87A 4TRMA 1E7RA 3B6ZA 3UH1A 2BGLA 1GUYA 1NASA 4IDGA 1BDBA 2GASA 1L7EA 3G1TA 5MGBA 2FN7A 2O4UX 1I8TA 2ZQYA 2EG9A 4YT5A 2CY0A 4CUJA 4U8GA 4Z3KA 3ETDA 1GSHA 4CMCA 4O7VA 2NLOA 3ETJA 4XGKA 1KVRA 3B1FA 1MG0A 4AJPA 4WLUA 5KNLA 4UAGA 1PR3A 2B37A 3C1AA 2YS6A 3PQFA 5CP8A 3ETEA 4CLRA 1DFHA 1M6VA 5JVDF 1C3VA 1GV1A 2CMDA 4UEOA 4JNKA 5H82A 2SCUB 4JX8A 5TT0A 3GMDA 3WYBA 5AXCA 4BMNA 2FWMX 4LW8A 2HK8A 5JY1A 2YHUA 3WLFA 4N18A 3SEFA 1EVZA 3I52A 5AXAA 5GY7A 4K26A 3RU9A 4O2AF 4IQ0A 1PJ4A 3IS3A 4QTZA 4E12A 2G82A 5DCUA 4QFCA 1XWFA 3HFSA 3VPBA 3GN2A 1JWBB 1K6JA 1WZIA 2B4RO 2B5WA 1E3SA 4MVJP 4OOFA 5H81A 2PLAA 3NGXA 1KBZA 1BTOA 2RIRA 4OJNA 3ZV3A 1RM5A 3OA0A 2YV2A 1IOWA 3DZFA 3F1LA 4FJ1A 1K2WA 1DFIA 5I7FA 1EYZA 3E6AA 4NR0A 5CDTA 4DTIA 2ZDGA 2NU9A 1IE3A 2VCYA 1MX3A 3GG9A 3PGJA 5L95A 3TF5A 5DMXA 4R41A 2HDHA 4BNIA 3WJ7A 3ITDA 1ULZA 4XD2A 3HJAA 4WEQA 3ROPA 4NFYA 3PPIA 2A4KA 3KUXA 3M1AA 3JQ9C 4XR9A 2Y99A 1SNYA 3AOEC 1YBVA 3Q1LA 1JWAB 4YB8A 1DV2A 1E1NA 4IUYA 4UVDA 3ZH2A 3K3PA 4B79A 2JJYA 1CETA 1TA4A 3OBBA 4GL4A 3OJFA 3FD8A 4XGIA 2PKRA 1CRWG 4O7YA 2C7GA 4UVIA 2FZWA 1V6AA 4XYMB 5TRTA 4A73A 4F6LA 5U1PA 2HK7A 1Y81A 1EDZA 1E1KA 1V0JA 2PTGA 3C7AA 4BMSA 5JSFA 3VMMA 2FPIA 1KS9A 1PJ3A 8ADHA 3U4IA 4TZKA 4J1SA 1TT7A 3Q6IA 5AYVA 4MV7A 4YAJB 3C1TA 3H9JA 3L6DA 3UAGA 1DIBA 2WJPA 2JFFA 3CE6A 4IDAA 4KP7A 5EQDA 4UEJA 1SEPA 1TT5A 4BGUA 5ENVA 3ZV4A 4DWVA 2A9FA 4EUEA 2V6GA 4OAQA 1UXGA 1ADCA 4TKMA 4Z9FA 4AJJA 1E6UA 5JPIA 4NBTA 4NDNE 1BWSA 1GU7A 4FFRA 2P2SA 1SPXA 5KJCA 2OXIA 1HXHA 1NAHA 2X58A 1BNCA 4GX2A 2EF1A 2PK3A 3ZNOA 4R1UA 4LN1A 3ADPA 2JAHA 2E82A 3D4PA 3RC7A 2WD7A 3FN4A 2FHSA 1IL0A 1YXMA 1AUXA 3H9UA 1HT0A 1GZ4A 4YTEA 3QVWA 4OYRA 4RORA 4YBZA 3EK2A 2P9GA 3R3JA 3VHRA 3DWFA 2FPGA 3JQDA 3OFSA 4J7XA 3RROA 3BAZA 3DAPA 4EBFA 3N7UA 4O4LF 4WECA 3VDQA 4J4HA 5JC1A 4WLEA 1F0YA 4I08A 4HR7A 4O82A 2C5AA 2HUNA 2PZKA 2EHDA 2A35A 3GFGA 3GHYA 2VYVA 3Q11A 4KQWA 3EZYA 1H2BA 3Q1KA 1QG6A 3TOZA 4R9SA 1NR7A 3COSA 3HDYA 2VTDA 1QYCA 4UVGA 5IXYA 1DIKA 3D3WB 3ASUA 2GGSA 3AM5A 4W9NA 2C2XA 4IDFA 4CQLA 1FDVA 4MDHA 2B36A 4YWJA 3RBVA 4DBZA 5ER6A 1LDMA 4O7SA 1T2CA 4OQZA 4Q9NA 2NACA 4BGEA 1U3WA 1FK8A 3JCZA 2R7KA 1X0XA 4CV2A 2JL1A 3LU1A 4B3IA 1A7AA 4NMHA 3OJEA 3NV9A 4JXKA 1UZMA 3E5MA 1Y8RB 3JYLA 3LC1O 1V3TA 1SB9A 2W98A 3OSUA 3RQSA 3VPFA 1CQIB 2R86A 1LSSA 2QRKA 2OZPA 3JQFA 1N92A 2WE7A 1RJWA 1U8FO 2IP4A 2WE8A 2Y1FA 2GZ3A 3UICA 5L9AA 1IHXA 2DWCA 3WGQA 1DC5A 2VHYA 5DDIP 3NTQA 3JQBA 4EG0A 4CL3A 5HV6A 2DLDA 1ZH8A 4B8ZA 2BH9A 4XRGA 1DJNA 4LCEA 3PYLA 4K9DA 1VLLA 3RIHA 1A9XA 4CMJA 2W2KA 1EUCB 1ENZA 3HN7A 2HJWA 4GGOA 2IZ0A 4F3YA 4A26A 3BMCA 1DJQA 2WEKA 3VH3A 3DFZA 4NJMA 5K6AA 3M6IA 4IDEA 4RCVA 5IJZA 3QY9A 3MZ0A 5H83A 1PS0A 3D7LA 4HKTA 5IZCA 3M1LA 4F6CA 3ZU3A 4RVHA 1P1HA 1FMCA 5ES3A 3ZWYA 4M9UA 1PL8A 4LGVA 5A9TA 3K5HA 5EIOA 2XXBA 3WSVA 4DQUA 4E30A 3WFIA 4KUEA 3F4BA 2B4QA 4BKUA 1XG5A 2NU7B 3VC7A 1I2BA 3WGTA 5A4DA 1VBGA 4QECA 1E3WB 3ENKA 2HKIA 4ZU3A 1LUAA 1U7HA 4XEHA 4JJGA 2C7VA 3KEOA 2Y1OA 2FPGB 2C54A 4RVGA 4TZTA 3WGGA 3E1KA 4RDHA 1NPDA 1UXKA 1KJ9A 1AN9A 1QMGA 3NGLA 1LC0A 4XYBA 4BNFA 1T2EA 3H6KA 1Z74A 3ZWAA 3W8EA 1N7HA 3ZDFA 1MC5A 5FYDA 1NHGA 4IQ8A 4IZIA 3ZGYA 4ZI7F 1SEVA 1LSUA 4NBRA 5B4UA 2GLTA 4KTVE 3IC5A 2QW8A 4RF2A 4NK5A 3MOGA 4MVJE 4NFHA 4DPLA 2BFAA 3JYOA 4QX6A 3BHJA 1YJ8A 5BNTA 1GYRA 3JSAA 4CODB 4B7CA 2UUPA 2XPCA 2D0IA 1L7DA 5JW6A 4ITUA 3GMSA 4R68A 4UVHA 1EDOA 4MVJH 1QKIA 1Y8RA 3NJ4A 4J16A 4KWIA 3GN1A 3PDJA 4E5MA 4N5NA 2I66A 3F9IA 3UHAA 3FTPA 4FSHA 3I1JA 2PWZA 1A4IA 4BVAA 4G81A 1JTVA 2EW8A 2VHZA 2V6MA 3C85A 4WOJA 3DTYA 2C2YA 4PLWA 4EITA 1C0IA 4YQYA 2NU8B 2VT2A 4R3WA 3TZHA 2Z02A 2VTEA 4KDEA 4LVCA 2CNVA 5LDHA 1I2ZA 5DP2A 3OP4A 3UCEA 2WM3A 4MJLA 1A7KA 3JQCA 4CLDA 4YXFA 1O89A 4YJ2F 1RM0A 1XIVA 1H6CA 4XYMA 2AXQA 4RZHA 5F1KA 3RUEA 1NP3A 2AEJA 1ZNQO 1H2HA 2V5AA 5TX7A 4LISA 5JAZA 1NNUA 4GQAA 3GEDA 3Q2IA 5EESA 2B69A 2CDCA 4W82A 5IFLA 3K5IA 3RWBA 2JHFA 2JD2A 5D8DA 5HBRA 3L6OO 1LNQA 3FBTA 4DQVA 5COQA 3W4IA 2P4HX 1PJSA 1FXSA 1UUFA 1O0SA 1UXIA 2VRBA 4B3JA 4CLHA 5B37A 1C0LA 3BHMA 5T57A 2DBZA 1BGVA 3MEQA 3ZU2A 5DOVA 3QHAA 3WWZA 5K9ZA 2O7QA 1N9GB 1DRWA 3Q3CA 5BNFA 3FPLA 3FTNA 4XX0A 3VOSA 2C29D 3I9MA 2X5KO 3K31A 3GVHA 4HNUA 3RC9A 3TZ6A 1W0CA 4YRDA 5TJ9A 3OQ1A 2EJWA 4DIBA 3WS7A 3R1IA 5LCXA 2IXBA 2O3UA 1NQ5A 3GZNA 3LK7A 1B0AA 3PWKA 1PGJA 4RO0A 4ZA2A 5KKNB 1OBFO 2P91A 3C24A 2PH3A 3ZWWA 1B26A 4YBZB 3IKTA 2OLSA 3RD5A 1HDOA 3H2SA 4G2NA 3VKUA 2YHIB 4K1LA 1YB1A 4P8RA 4Z0TA 5B1YA 4FOSA 1O6ZA 2NU9B 1YH3A 2C5EA 3ICCA 3HG7A 3ITKA 5JXWA 5BR7A 1I10A 4MKRA 5BSHA 5I8WA 1H5QA 5TC4A 1DPGA 1K89A 2CDBA 4WPGA 5L53A 4XQGA 1T1RA 4R01A 2LDBA 3S55A 4DLLA 1PL7A 5LYJF 3BA1A 1DHRA 3DHEA 4FC7A 1M6HA 4ZN6A 1AXEA 3LLSA 3GUCA 1Y9EA 2VUSA 3EAGA 3O26A 4FE2A 2GPTA 3KSUA 4G5HA 2X0SA 1PX0A 3RUCA 1DC4A 2XF8A 2X9NA 2IDZA 2CZGA 1Q0HA 3JYQA 3RUAA 3GG2A 4BNMA 4DLBA 3GEGA 4J1QA 4DXHA 1ZJYA 4YYZA 1ZXLA 1C30A 5I7SA 3ONFA 2CZCA 3C8MA 3SLKA 5LXTF 1C1DB 4EI2A 4ALIA 2VWHA 2Y67A 4M49A 1SZJG 4BO6A
chains in the Genus database with same CATH superfamily
1F8GA 1RQPA 3S7TA 5G40A 5KYUB 5BURA 2CLKB 3KR0A 1NR5A 1D07A 1F8UA 1N2IA 3AY3A 4UHBA 5JSYA 2C78A 3U0VA 2PN1A 4MVJD 3E5NA 5I5GA 3GJZA 1V95A 3KKLA 5EWMA 2QTFA 1E9AA 3B1KA 3HN2A 1VSQA 2V8OA 4HX5A 4X00A 4E09A 3U9LA 3HWRA 2A9OA 1SG6A 4LX0A 4A2WA 5JO0A 1X7ZA 4UHCA 1I5OA 1MW8X 1BDMA 1ZRSA 1NJ2A 1CFZA 1Z26A 2ENWA 1BEEA 5J59A 2GBLA 1E2QA 2JCYA 1PNOA 4PNPA 1T5DX 1TM5E 5DYYA 4EG4A 3JAKB 3UJ7A 4B34A 1NXTA 2ERYA 1Z4NA 1KMNA 2NU7A 3Q6MA 1KHHA 1FYVA 1R3DA 1TM4E 4EFDA 7MDHA 4F12A 1QHIA 1GQQA 1YTLA 1IB6A 1JHVA 4D46A 1P9RA 2JIPA 4FSDA 2LCIA 5LM3A 2NO6A 2NZ2A 5TF0A 4C7KA 5K4GA 1IJEA 3H3JA 2BIFA 3ZHQA 1JNYA 3I04A 1QV7A 3LSTA 5EP3A 3IDAA 1E2EA 3ER8A 5EFOA 5F9FA 3A26A 1PFQA 2WSSA 4WW0A 2PNJA 3P4UA 4KQJA 2QJRA 3WL8A 4IKEA 3HH8A 5IXJA 1PJLA 4WCFA 2AFHA 3PIIA 1GGVA 1PK8A 5GJBA 3JRNA 3ZU4A 2VDPB 2Q4EA 1WZCA 4PXAA 4BNVA 3OQMA 2LUOA 2YXNA 4ZJPA 1TPZA 1MH1A 5HIAA 3C3BA 4RPKA 3ETNA 4IDCA 2Q5QA 3R3WA 5FI3A 1JG2A 1RYHA 4TTRA 3ZVRA 3AIOA 1FYDA 1RKVA 3N8DA 2K4MA 4D41A 2R7NA 3OCVA 1FVIA 4PNZA 3G7NA 3AF1A 3INTA 2WICA 3VOTA 2MSNA 2Z4SA 4P3KA 4CL2A 3AM3A 2A1TS 4LDRA 4C0LA 4MGZR 4DJ5X 1SM4A 3SGIA 5E1DA 5C1BA 4CKEA 2J09A 3QJ5A 2A5JA 2CBGA 5AKXA 1IY2A 1IHUA 4MGYR 4H17A 2AUTA 3EFOB 3KVVA 4XJTA 4MKZA 4QSMA 3S70A 3HVKA 3ZDQA 4AECA 1RJ9B 3EJ6A 2VKQA 1Y3AA 3KVRA 4PYMA 1PR4A 4W8HA 4Y3UA 5THQA 3VKFA 3JZFA 2O2HA 3WIOA 1Z08A 4DPMA 1ZUNB 2VJQA 1NQTA 4K6OA 1Y1TA 2PWYA 1FYWA 4WOCA 3HRIA 1VCMA 3CEMA 2AXPA 4C7VA 1NZFA 3H4TA 1YC5A 3H8VA 4MWDA 2OV2A 4RZXA 3CKYA 1Q14A 3JRWA 4EFNA 3USCS 5JCJD 1YFJA 2NQ8A 1D09A 5KX5B 4H1VA 2A92A 1YZTA 3PC4A 4PGMA 3O4RA 3LGXA 2NAPA 3HGMA 4MUFA 4RKQA 3KP1A 4W5WA 3L6RA 2Y68A 1QU3A 3VHQA 5CLIA 1KVTA 1E69A 4LDQA 3TLXA 3WK7A 2V96A 2Q0SA 4YO7A 2MU1A 4QYSA 4PSDA 2L69A 1ZA2A 4LYAA 5F52A 1JSLA 3EYWA 1VRVA 1NLZA 4MINA 5B5SA 3JSXA 3PE4A 1K9SA 2HA2A 1AS0A 2J0UB 1NKTA 2A9QA 3R0JA 3SS9X 4BJ5A 4DZRA 3D0RA 2YNMD 2GEUA 4BXOB 4FFSA 3AEUB 3QPCA 3LX6A 4QDKA 1W59A 4BFXA 2V7QA 3GYGA 3PXDA 3TCKA 3Q85A 4R3UC 1T3ZA 2GEJA 1F7VA 3KXDA 1B7GO 2FGJA 1DB3A 1KVUA 4PZCA 3LY5A 2YHBA 5G1PA 1NT2A 3KOMA 3ME5A 4L9AA 1T8SA 2HWYA 3I2KA 3UJPA 2FPSA 5TGDA 1G6HA 1K3UB 2RB4A 3TG8A 4TLAA 4LJAA 4YJHA 5EIHA 3R5HA 1G60A 3EWNA 3ZHUA 4A5OA 1FU4A 1SOWA 3PXAA 2ZIXA 1HDYA 2FLVA 3MILA 3I8XA 3NTVA 1NG1A 4Y2YA 3G5TA 4U5QA 1FFSA 4LSMA 1Q17A 3B9PA 3H9BA 3KHUA 1RI4A 3BF8A 1DIHA 3H5LA 3Q3EA 1IYEA 3PX3A 1UL1X 3CUTA 2C9YA 2YXLA 4XJXA 4S1TA 4D0RA 1I6MA 3KT6A 1WBBA 1SVNA 2X19A 4NG4A 1CS4C 1L5GB 4XYGA 4O86A 1IMJA 1VJ0A 4WKNA 5ADVA 4YCNA 2AN1A 2W6CX 2XYVA 3BTOA 2LPMA 4MV9A 1TQ6A 5DHUA 3UGKA 2Q1WA 3OTQA 4QDZA 4BVHA 1AXRA 2JASA 5T3YA 1P6UA 5EJ8A 3OE1A 4ZJZA 1E2HA 1G3UA 1DQYA 1FS4A 2LXNA 3DAHA 1ZGJA 4GKVA 3R3UA 1GPWB 2AX4A 2KE5A 2VHVA 5DU2A 5E4YA 3S4YA 3U1VA 2IELA 4ZAWA 3FCAA 1HO3A 3O2JA 2VEOA 3ENWA 4MUJA 4F2PA 2GJSA 2GBCA 5DCYA 1R15A 3DQQA 1Y4SA 1RTKA 3VO2A 1I3LA 1G8JA 2XIJA 2WHPA 1SHZA 1VS0A 1XZFA 1U0BB 2R8EA 1Z0IA 2QRMA 3JD0A 1IJFA 1NLMA 1WMEA 3QXXA 4NOJA 2VJOA 1IEVA 1XDWA 4KVAA 1I32A 1GPUA 1NMYA 2WF9A 3M4NA 4KITB 1NJ6A 1SHLA 2CXTA 3AF0A 1EESA 3FYUB 1MNQA 1E60A 5F1PA 1BMDA 1XD8A 3OQIB 5KYWA 4P4UA 4NK4A 4F3NA 2VDLB 3GJSA 2XYRA 2WP0A 1V16A 4MW4A 4BX3A 4AMUA 1ULAA 3CLUC 1MH9A 4UUMA 1KYXA 2G9VA 1HBJA 1V8FA 2SKCA 3UXMA 4C4XA 5DBOA 1VIYA 1Y4UA 5BW5A 2GOYA 1U5CA 2GKOA 4RVUA 4ME6A 1ECPA 4PPYA 1I2CA 1JTFA 1NQXA 4NS1A 1F0NA 1WCV1 3QV2A 5DV9A 2X1VA 2BFMA 1MFZA 2B7CA 3GBSA 3DAAA 3GJ4A 3NHBA 1W88B 3L6EA 3U3OA 4OHKA 3I5UA 1GL6A 3MM4A 1XR3A 2PYIA 2JBHA 2VKTA 4GXNA 1KEUA 2I5PO 3KZVA 4PG5A 3A28A 3AY6A 4D99A 3UK0A 1ECJA 2UAGA 1V9LA 4I1YA 1FQOA 3D3EA 2J5QA 4DCMA 2QAJA 4M7OA 2VH5R 1G0OA 3IFSA 4JB8A 4AP5A 2OCBA 3JQ8B 4JEIA 2GM3A 1WUTA 4L9RA 5B55A 1KAQA 3AO0B 3GRFA 3VH1A 1C9DB 1G2OA 3Q2OA 1DEHA 1WUIS 2QAIA 3K9HA 3NH9A 3KBOA 4F38A 5DT9A 4PZDA 1XZAA 2X5RA 1EFDN 1JH8A 3MQ4A 4NOKA 4AUNA 2O8FB 9MHTA 1J42A 2OZLA 1GFWA 5CA1F 3P9SA 2HSZA 5BYAA 1J6UA 1M8JA 2G67A 3D1VA 3OQHA 4QUHA 3WP0A 5DK4A 5HSGA 2BP7B 4EJFA 1NXSA 3FGOA 4MWSA 1GDDA 1EINA 1VPTA 4KZKA 1XLTA 2RONA 3JWIA 4OP2A 1AUQA 4RLQA 3H13A 4BN0A 2BFEA 3N28A 5LN1A 5DOZA 3CVVA 4GSKA 3LUHA 4Q3EA 1NN0A 2IZ6A 3LW8A 1IYZA 2H1CA 5DPMA 5IT4A 2IYYA 2ZJFA 3IAM1 4EJ0A 1FYFA 5EJGA 1S3FA 3W7AA 1QOPB 1O7JA 1USVA 1OFGA 1W52X 2BI8A 3BWVA 3H65A 1HEUA 3MBOA 3OPVA 1CY8A 2Q5IA 4PZYA 4QM7A 3TINA 2BGMA 1RAFA 3DCYA 3CZPA 3KJNA 4KV9A 2IEBA 3K0CA 3NBUA 4O2LA 4RACA 5KNDA 3KSAC 2Y6VA 1D1QA 2DE0X 3VTAA 5EEGA 4YCJA 3X43A 1M7GA 1YZVA 4K9KA 1U2PA 4MS4B 3E9DA 3A4LA 2Q9UA 5DKFA 1GGNA 1R16A 1TVCA 2AW5A 4XJVA 3VQTA 1TU4A 2CEKA 3BMQA 4FM9A 1DBIA 2L82A 1XELA 1GPAA 3L18A 1SKQA 3NETA 4GXQA 4KXUA 3HDJA 3QE4A 4G5SA 5BWTA 4ID3A 2RKWA 3VSAA 3ZWBA 1F14A 2ZQ5A 4DAOA 3WYNA 4B71A 3SZOA 3USES 4L4SA 4UAJA 4Q9IA 3UCFA 4EEKA 5EKSA 2H0AA 2IY9A 2VJBA 3IA2A 1CB0A 2NN3C 4HLDA 4PPGA 1PSWA 1QANA 5I5SA 3JQAA 4IO0A 2H1WA 3UK1A 1C2TA 2Z57A 1QKJA 4AP9A 2GZMA 1W4AA 2EQ5A 2YDXA 5KSYA 2HV9A 1RRKA 1M5TA 5JCPA 1YOVB 1DRVA 1NQWA 2FRXA 4MWEA 3GDGA 2ZJBA 5IYZA 4OMUA 5CW2A 2PGAA 3AVOA 3FMPB 1N8TA 2WM2A 3MD0A 1AKQA 5T8KA 1OH7A 2J3KA 3M3HA 1MBZA 3DFUA 2WPDA 3U0GA 2V0CA 5LBUA 2R8YA 4RWEA 3UKOA 3AUYA 3ET4A 4AY5A 2P1DA 4IWYA 2IHVA 3DBHB 4L16A 3ST7A 1DG1G 3T1TA 3QQPA 3PQCA 5T4FA 3DS8A 1BH2A 4JOBA 5AKKA 2JFPA 1NVWQ 1J56A 1PIWA 1Y1QA 2UUOA 3JX9A 1I9CA 2ALJA 3MF4A 4IJ5A 1DX9A 1S3GA 1PZGA 4L2IB 1QCDA 5TDHA 1OX6A 2WYWA 1T1GA 1W93A 2ZTSA 3I9LA 1RJEA 2EGGA 5ALLA 4DCJA 4FDVA 4JX9A 1Y1SA 2J5XA 3CIFA 1P16A 1U0NA 5E3JA 4D4LA 3OWHA 4DM7A 4E46A 2W42A 3GNTA 4HTFB 4N3BA 1MW9X 4QXAA 4DRZA 5BQ3A 4PY2A 3V80A 4KWTA 2X9LA 4GKKB 2X8JA 3HSSA 1T6BY 3MTQA 5HM8A 1REQB 4BAZA 2HHJA 2CMKA 2HJHA 2C57A 3MWJA 3NONA 2OB2A 1CKOA 1GCUA 2HM7A 2X13A 2IUFA 4AZ3A 4ZYXA 3JD1A 4LZZA 4C3OB 1OXTA 2V9ZA 2X15A 1VPLA 3AUTA 2RIPA 5TGTA 4BNXA 2D2XA 3LUPA 3OX4A 3QSYA 4DF3A 1NRWA 2ZRKA 3EQZA 3JQBC 4JLDA 1Y6FA 4FYWA 1TEZA 3OETA 4I99A 1R0KA 1MVOA 2FCRA 4JI7B 2BFBB 3A2NA 2XUQA 2Z95A 3NAQA 2V59A 2HIXA 3ZHOA 3EVCA 2XWJI 5DM70 1WKVA 4IDDA 2ZE8A 3ESRA 4DBVO 2F43B 3PHLA 3A6LA 4Q1AA 1EI9A 1EVLA 2X5XA 4O4HB 4YJ3B 1QE0A 5K0NA 4F4CA 1NY6A 4KXLA 1DMSA 3W3AH 5HNEA 3KL4A 2HSDA 3DEYX 3TQQA 1JQAA 3BOSA 3OZSA 5DBEX 1H66A 1MQ9A 1ZKMA 3BGSA 3F97A 1DAGA 2V7BA 3TZCA 4BECA 4UFOA 4RTSA 4FBGA 2PMEA 3HY3A 3FYSA 2IPMA 1D0SA 1V16B 3PC8C 3ZCSA 3RAFC 2XMDA 4C7OB 1GU1A 2NTJA 4KVFA 3NNDA 4MVJG 4P22A 2FW6A 2G6TA 2ES4A 4I50F 1KHTA 2G71A 4BBAA 4L76A 5ITSA 3U5TA 3QJYA 3D4NA 2D5CA 1KFEB 2QTHA 3FPEA 3GLUA 4D3ZA 4DR1B 3INRA 5FTJA 1MTOA 3FUUA 3RSLA 3HABA 1GEEA 4KMRA 5AUNB 4OXYA 1ZISA 4M0DA 1RRFA 1TF2A 1G5PA 2CDNA 2GZ2A 4OQEA 4Z9AA 5KC8A 4ZQIA 4NU8X 1W4BA 1ST2A 1GA1A 4L3WA 2V3VA 3E18A 4M46A 2FX3A 1XO1A 3ZV5A 1K63A 4O1MA 4E4YA 5BQFA 5M2QA 4CIBA 1NYTA 4GOMD 3E9NA 2JDIA 3MWLA 4QLOA 1X7WA 3OVMA 1C2YA 1RJGA 2LZ0A 4LV6A 4P0TA 4A03A 5LMCA 3NDBB 1PV1A 4GM4A 3FYDA 3VOAA 3GLIA 2MIIA 4JSYA 4B4UA 1HZJA 4AO6A 2JA1A 2GAAA 4XJSA 5BN3B 2BONA 5MN5A 2X0FA 2IP1A 2GLUA 4ZCIA 5KCZA 3QWUA 1N3IA 3E23A 1R37A 1D7OA 3CVWA 5HZGA 1GXSB 1RRVA 2QX7A 2ZCVA 4AS3A 2XKAA 3U3JA 2FFQA 4YI5A 3TVDA 5CG2A 2CFTA 2CL5A 5C8YA 3TIFA 5K5EA 4CI9A 4TM8A 1T34A 1Q1QA 5CA1B 1AMOA 4INAA 1ZGZA 1M1XB 3L7MA 2IEDA 4B3CA 1V41E 3IEVA 5C7IO 5C32A 2R66A 3A05A 1JN0A 1TAUA 4GLBA 2W70A 2NVWA 2D0OB 4Q3AA 1QRSA 3C5WP 4TWBA 3N0TA 2MDTA 1ILWA 2C9DA 4Q15A 4QNNA 4KLCA 5L3ZA 1ZEJA 2OHIA 4C0QC 3RRYA 5ESWA 2YJ5A 4XYEA 1DI0A 1ZM9A 1R0XA 3QSGA 4OY3A 1NHWA 4WK0B 1R18A 2VI5A 3C1OA 2PGNA 1MZVA 4OMFG 2QY6A 4CLRB 5FOSA 5TPWB 4YYEA 2JAQA 3OHMA 1RMYA 1Q16A 3QW2A 4D8WA 3MJTA 3D4IA 3RRMA 1ZZEA 2CWWA 3CZ5A 4IVPA 1XQ1A 1EK1A 1A0GA 2WKQA 3V34A 2GAJA 3SF8B 4CDGA 3K4PA 1O95C 2QRJA 4ZCTA 4PONA 4NXMB 3WK8A 3SBEA 3AI3A 1DAAA 1N7IA 4YJGA 5DX8A 1OWNA 3I5MA 4UREA 3UOAB 1Z38A 1ZCAA 3ON5A 4JELA 4NHEA 1UQTA 2AR0A 2I91A 1SC9A 4UZEA 3FROA 1MRSA 4B47A 3A3OA 4BNUA 4LJ8A 3OE7D 3HZRA 4LHVA 3JWGA 3L4SO 4G0QA 3M83A 3V7YA 4FQ8A 2A5GA 3EXFB 4LY6A 3UC9A 2QX9A 3TRKA 2DQ4A 2LNDA 1T6YA 4RQTA 4EENA 3K0FB 4L15A 4RF2A 3COJA 1FX1A 1S6YA 1WUHS 2BDEA 2RCNA 3D4OA 4O4IB 4IJUA 4CLOB 5MGNA 4TYYA 2XBMA 3IAEA 3SXPA 3ESCA 4OLHA 2X14A 4OIMA 4N5IX 1FMFA 4EW2A 1CUGA 2M1XA 5F3RA 4UFPA 3O03A 4TYPA 4RTQA 3LA8A 4Q0MA 4ZODA 3ZZUA 4FFMA 1NF9A 3MWEB 4KWHA 4EHIA 5J1TB 4XPIA 2QL9A 4ZIRA 4ZOQI 5IZCC 2Y4OA 3U7GA 1O08A 2WV7A 2PX4A 3RIXA 2OAEA 1AV6A 2G5TA 2VHCA 3LUGA 4MYSA 1RXYA 4H35A 3RFTA 5BQOA 2ZYUX 5HXAA 1FU8A 3UAWA 4CZ2A 4JYZA 2AUMA 4EVQA 1TI7A 4O8ZA 5AVZA 3OFJA 2PBZA 1YE3A 1ZICA 2QLTA 3OPQA 4HDNA 4Y6PA 3TJZA 3UEOA 3DOFA 4NCXA 5GJWC 5KSPA 4DMKA 3U4QA 4AMBA 3RVRA 1OX4B 2NAFA 3JWHA 3QYPA 3TEMA 2YRWA 3N8IA 2H1LA 1NPTO 1L5QA 3G0IA 4KLNA 3AR3A 1JYSA 3F1KA 4YP0A 4QGSA 3OTGA 1P0CA 4EK9A 1NONA 3STUA 2ZIZA 3KQNA 2YTZA 1IUNA 1LLUA 2CLLB 2OUIA 3GR6A 1AF4A 3KKMA 1AS2A 1IAQA 3JASA 4C43A 4QT4A 1E8DA 4JASB 4GPBA 3RH0A 4DE5A 5HOEA 3A1TA 1HDGO 5L3QA 3T3OA 3HHEA 3PX2A 2G3YA 3DLCA 4UUPA 1P0PA 4WKCA 4TSRA 5AVVA 4MI3A 3A06A 1UT5A 3G0DA 3IAS1 4M60A 5F7ZA 4H7HA 1GM5A 4UCSA 1Z5OA 1WXDA 5LL6P 4PAQA 3IBFA 2X5NA 3L05A 4TT3D 2YIVX 3VAAA 1WA5A 3V1MA 2XY4A 5AM5A 1QUFA 3WY9A 1AZLA 4D81A 4XZ3B 1DXYA 2ZG6A 3H5RA 4N8EA 4EF5A 5JS1A 1ZWKA 1MXFA 4B3FX 1EFPB 3NT4A 1QIIA 1BJTA 1JDBC 1QR2A 5EZ5A 5BSRA 1PWXA 1RJFA 2P7HA 3I5XA 5T5QA 3D1LA 3H8WA 3ONEA 4RPIA 5REQA 5FUBA 1QRTA 3SHVA 3DVAB 5SYAA 4YV0A 4G9EA 2QROA 3QE3A 4UUNA 5FPHA 2GQRA 1CDZA 1NOIA 3BFKA 1MOPA 4O7NA 4DMFA 4BDSA 3NW9A 3PLAE 4TWJA 1C3OB 3A0UA 3ZWVA 3T3HA 1RYFA 2ZLBA 1ENYA 1DWUA 1XTQA 3D6NB 3MUEA 1T25A 3WLRA 1GU0A 1UDCA 3UJ6A 2H51A 2NO9A 4V39A 3IEMA 4LVUA 1TQ2A 1SUEA 4O3FA 4LY0A 5IHXA 2H2DA 3FUCA 3LV8A 4CKBA 1G5RA 5C46F 3GRKA 2R8BA 3E3LA 3V1YA 5E3HA 4RZQA 4CV1A 4G1FA 5CLQA 1UBUS 2VXOA 1PJRA 4RJJA 3N0RA 5E8RA 3UGJA 3K5WA 4UM7A 3H9QA 3GLGA 4ARIA 1YQTA 2G9RA 3GJTA 2YH2A 4LNHA 4TVOA 5JCOC 2A0UA 2PR2A 4TROA 1J8YF 2OD7A 3R75A 5IKMA 3G49A 5A9RA 5U4QA 3QP9A 1PQWA 3R5FA 2YFYA 3GFOA 3PQ5A 4YAKA 3CRRA 2AK3A 3A0RB 3DXFA 4A0QA 4D0NA 2VDOB 3Q3JB 1N6NA 3QENA 3AVTA 5GZ1A 2J3HA 3CB4A 3MC1A 1N25A 2GPSA 4A6XA 3L93A 3EOZA 3FFAA 4A82A 1YFLA 4QOJA 1EQ2A 2QTCA 2ZWVA 2DVMA 3HB9A 3RSGA 4UCQA 2EBUA 2J48A 3O4HA 4HNAA 3SHFA 1XC7A 3P9NA 2VJLA 4OU4A 2RAPA 4UBMA 5FWYB 2V4UA 1HUQA 3FLEA 3OF3A 3Q40A 1NBHA 3QLVC 5DNEA 3VNAA 3L43A 4D4JA 4N7RA 1PR1A 1SRRA 4XYLA 1Q1EA 2WKWA 1RCFA 4CM1A 4ZVPA 2QVXX 4N3AA 1SHTX 5AJVB 4DT1A 4GBGA 1MJHA 4QPPA 3U60B 1X74A 1P45A 1QYXA 1CJSA 1ORDA 4GICA 5HGJA 1XLUA 1Y7IA 3WV5A 4TOIA 5TQ2A 2FX2A 3CIOA 4OHZA 3QFSA 4WOPA 2OPHA 1W76A 3GFFA 3P2EA 1OAAA 1KPHA 3MELA 1IVYA 1UBCA 4RLFA 1DX6A 2E4UA 2H7CA 2PCJA 3BB3A 3KSDO 4IGEA 1QCYA 2FPXA 1KIFA 2W8BB 4ZTZB 1VIAA 4UXIA 3AL0C 3A1WA 4UE3S 4PZUA 1PZNA 2XJ4A 4HLUC 3OBIA 3JD3A 1KFKB 4JD5A 1MRZA 3RO7A 2O54A 1EP1B 5EVJA 3ICQB 4I2NA 4KSCA 2GHTA 3OC6A 1P19A 1R5NA 2MYTA 4Y2HA 3L4KA 1CUBA 3K2IA 3A3NA 2BPOA 1ZK1A 1ZD1A 2EEPA 4LCBA 5CB8A 1HGXA 4H1HA 2N0SA 3ELYA 3WXBA 1E5TA 1OH8A 3KQLA 3RLIA 3MJ4A 4KFSA 4UD2A 3B60A 4UBNA 2I33A 3IUBA 5A3JA 1Z17A 5T41A 1Y4DE 3NBYB 4WINA 5EP2A 4F4HA 4P4SA 1BWRA 5FO1A 5BSVA 1Q6ZA 2RGYA 2RGNA 4RTRA 5CNKA 1H05A 1T36A 2PT7A 3CRNA 3W5JA 4EJSB 4EZIA 1FNDA 3A6HA 5E8JA 5KIAA 8GPBA 2F55A 1VECA 4LTMA 2CLDX 3LP8A 2YZ2A 2FSVA 2GWHA 2I0FA 2JH8A 2O57A 3DHNA 3TTXA 4Z2AA 1TM2A 2XQGA 3OKCA 2DKNA 2X23A 2ZYTX 3AY7A 4L5BA 4UPDA 3MQ2A 1R4AA 4IVNA 3GQBA 5D00A 2OENG 1WWKA 2XAAA 4KPUA 1BXGB 5A9SB 1O03A 5EFZA 5BSKA 2VQFB 1TIBA 3HSYA 4GSYA 2YQ5A 1NBME 2AUNA 3A2LA 2K2WA 3LW7A 2QRUA 2BCGY 4M0UA 1XF1A 1TAGA 1FFAA 2DU8A 1WVMA 1WAMA 1X1TA 2GQ0A 4D80A 3VTFA 4EQ6B 1VMKA 2AOWA 3VR0A 5C51B 4GP6A 3OZ7A 3PR3A 4PBTA 4X45A 2QJFA 1XNRB 2F9MA 1ESZA 4I66A 4GOJA 1KTAA 1VMAA 1V7CA 2ZEJA 1M34B 3EVDA 3HRHA 5CGZA 2A5FA 5JE8A 4PN3A 5HIKA 5THXA 1P5HA 1YR9A 2Z5GA 4HXGA 1AHHA 2HSEA 4EEQA 1TK3A 4ND6A 2QTGA 2JGEA 2OGZA 4R8VA 4WCDA 4DSUA 1WMFA 4GZMA 1W36D 1XCJA 1Q0LA 4DNXA 4G0VA 3CEJA 3H0EA 2YV5A 1E1CB 1OZAA 3L7CA 2OHOA 2DR0A 4U7TB 2J7PA 4NYEA 2O7RA 1VE3A 3FMOB 4AKIA 1NJ1A 4I6GA 5L45A 3RVKA 4Y2GA 3T12A 3OSZA 3M4ZA 1K68A 1AKVA 3U56A 1GA4A 4CJXA 4OXRA 5TMPA 1GCOA 3KDPA 4EB6A 4CMBA 1EXWA 4UNNA 3IBYA 3CSWA 1M6NA 3V5NA 3EBPA 1WO8A 1L4KA 3RTCA 1PZXA 1U3UA 2H00A 4G2TA 5EXPA 4YEDA 1EPUA 2REQA 2ZBQA 2FEAA 4PZZA 4KGDA 1I2AA 4NTZA 4U3JB 3X1JA 2KJQA 3ZYZA 5IHPA 3EPPA 2JCBA 1HDCA 2DFTA 3RTDA 1FTQA 4A9AA 2J0QA 2XLCA 3BL6A 4K9OA 1O0CA 2ZR7A 1KJNA 2JANA 3ETGA 3P71T 4KFUA 4RSHA 4D57A 3FCYA 4PX3A 5I9NA 1QHGA 1LV7A 1F38A 2F3UA 2OGSA 2OQRA 1U63A 1FX0A 1L3CA 1MA0A 4K3UA 2PMDA 1GLVA 3T7TA 2QV7A 3TZKA 4JQSA 4JP2A 3JQ6A 2BSXA 2PHZA 1O4VA 3A4IA 3OLYA 4B6EA 1E1RA 2BMFA 3G85A 3IELA 2COIA 3GD5A 3MGCA 3RGWS 2BM8A 4RJTA 1KIMA 4OK5A 1I36A 2GM5A 3R5JA 4LCJA 4RV9A 4Y6QA 1A4XA 1HMYA 2ANBA 3KBBA 4CFYA 3DLPX 5DGTA 2OBYA 421PA 3H2ZA 3GC6A 4WY5A 5ED0A 1MO6A 5FL7A 3MGKA 4MS3A 4QGHA 4N5DA 2YKGA 1JEOA 1NFQA 1K6XA 5CW1A 3NP7A 1Z36A 2RAVA 4HJRA 4UDNA 4ALMA 5JWOA 2VCHA 4LZNA 4CDNA 6ADHA 5K3WA 5IN5A 4DOMA 4ZVTA 3C74A 1CQJA 1UDXA 3O74A 2I4MA 4E2ZA 1J8VA 1VDZA 2WUEA 4QYIB 3HLTA 4FGLA 3RABA 3UPTA 5LZ8A 4IIFA 1ZAYA 2PUFA 3S2EA 1QTIA 2AOXA 2XUOA 2OCGA 3CX7A 1G41A 4R1NA 4IJQA 721PA 4MRMB 1K92A 3WJAA 1OBVA 4W99A 1VJ1A 2IHJA 3OZBA 4HS9A 3R4CA 4KMMA 4HDRB 5FOTA 5IKOA 2WW8A 2E49A 3UK7A 2UZ0A 3ZW8A 5CEEA 2I9KA 1UBFA 1W0KA 1ESEA 2A9KA 2ZE5A 2ZSJA 3LDUA 2QN1A 4P5EA 4D97A 3KD3A 4RH0A 3DBRB 1E6MA 4P7GA 3N6RA 3TRFA 3ANLA 2OFOA 1MP0A 4U5XA 1ZO8A 4M7WA 4ZI7B 4R1QA 2RD2A 1GPNA 1HFKA 5IH7A 5BSEA 2G5GX 3CZ9A 3RTEA 2BF4A 1H0SA 4Z5XA 5LDDC 3TLCA 1UPAA 1FP6A 2FPPB 5JH7F 3C3EA 3CUWA 3K09A 3KQQA 5CM8B 3SSNA 2VJPA 3UTCA 4F86A 4RKWA 1R6UA 4DMUB 1T9KA 3PZRA 4ZT5A 3SZUA 5E9AA 2WU1A 2P4SA 2GKGA 4M1TA 2IYFA 1PNRA 3DZGA 2HHFB 1SXJE 1QYWA 1DKLA 1RYBA 3EG5A 3FRJA 3MJVA 3GV0A 3OPNA 4I8XA 5HEKA 3T61A 1RFGE 1Z3IX 1J1IA 9ABPA 4P7BA 3HGQA 4P31A 1LLQA 1RZRD 1WR2A 4DFDA 3A6PC 4A0SA 1K5DA 2BUCA 1XXHB 3H75A 2WZBA 3NOXA 4J0IA 1SIBE 4H2DA 3TTWA 2FJPA 3DHVA 4JXXA 3SC4A 3KD2A 1VL8A 2QDKA 1MJFA 2AWOA 3LP6A 3TMYA 1MV5A 5CK4A 5ENZA 3SX2A 4JK3A 4BFCA 2SICE 3GVXA 4ROSA 2P41A 2WA1A 2VZLA 4CKXA 3H1AA 3EA4A 1M6VB 4UJ3A 2VK2A 4FN5A 1H2AS 4WESA 4ZOLA 4EG8A 4W7IA 4DV7B 1A7UA 1NVEA 1QGED 4WGFA 2IYEA 1NDUA 2ODBA 3UMBA 3ZLJA 4R0NA 4WJKB 5L6LB 3E7FA 3F7MA 2AG0A 3RUIA 3DZHA 4K6HA 4QPNA 3WZLA 4C4ZA 4E3WA 4TXLA 3UT5B 1EM8B 4OTZA 1EFRD 1Z5WA 2BDUA 4NYMQ 3WQQA 4IQ4A 1C7JA 1K8XB 1VZ2A 4UC0A 1KFJB 5DHAA 1KY4A 4R2HA 4LOIA 4A8JB 1GGOA 4UBKA 3W7VA 1N0HA 2WABA 3BE5A 4JA0A 3KYCA 4MW0A 4E5KA 4CM8A 1Q95A 1G4HA 1K6EA 2XTJA 2X0IA 4MV8A 4KFTA 4HCJA 4CEIB 2CW5A 3G2QA 3NHRA 3SOZA 2HU5A 5CCXA 1O6FA 4BXOA 2YW2A 3U54A 4G36A 1QZZA 2NO7A 3ESAA 2BMWA 1QGUA 2BW0A 2WJYA 2YIJA 2QTZA 4QXRA 3UWPA 3WDMA 3GH3A 4PHTA 4BLSA 2HT6A 1KE1A 1KI2A 5C53B 4ZDWA 3VRHA 1TJ5A 3HL4A 3PHGA 4NPAA 5HQ3A 2WF6A 3EWSA 3IHLA 2IBMA 4HGOA 4JJFA 1VI5A 4OHBA 4TKUA 5C7YA 3QWBA 2C5HA 4EECA 4YRCA 5AM3A 5IT0A 1KNXA 2Z4TA 3OIYA 3IH5A 4H08A 4RDXA 1XQVA 5ADHA 4KHZA 4DQXA 3UJBA 2OGUA 3U62A 2QV0A 4RK5A 3AF4A 1K5PA 2WAYA 1ZWLA 3A27A 2WFAA 3K0KA 2CUTA 2OYSA 2QTVB 3ZQ6A 4EYSA 4W8GA 3HK2A 1HX7A 4HAVA 2ZVPX 3S2UA 3E1SA 1VE1A 5BWWA 3NC1C 3ASVA 4M8IA 4WKGA 4YRGA 5JVLA 4TMVA 1WRBA 1KVQA 3HVJA 3JASB 5I9TA 1IIRA 1TKAA 1QQTA 2BHLA 3DAFA 1U2SA 1GY8A 2C04A 5F73A 5CVUA 1BC5A 3LX4A 3K09C 3PQ2A 3ANMA 1FFDA 4ZO8A 5FXMA 5DSZA 2C3OA 4LJ7A 2IW3A 2DPHA 3RG2A 2BHTA 3I92A 3PFWO 4K7JA 3WE7A 2Q4DA 4ZDKA 5CDHA 1SQGA 4M86A 3K0AA 1DSSG 5E3IA 1R4MA 4HN2A 2HCJB 4ZEOA 1PTJA 4FN4A 5CCDA 3S27A 4E22A 4AF7A 1YD7A 2BKEA 4X7PA 5AD1A 5CYGA 2JJ2A 5BV1A 3WLEA 1QGYA 2F3PA 3K0EA 3VR4D 5E6SB 5K51A 1A96A 4FDTA 2GAIA 1NI3A 1R6AA 4LYEA 3ZE6A 4IICA 5E95A 4ML3A 2ZBFA 4MPTA 3U17A 4CR7A 5CR9A 1EEXB 5FI5A 1FUKA 1G5QA 1YU9A 4K81B 4POOA 3GFTA 1XT6A 3PTAA 1NWCA 4TTVA 3OURA 4TN1A 3RJ9A 4UATA 1TYBE 5BOVA 3L4BA 1QIKA 5CBPB 1GR0A 1ZOLA 3K9FC 2HH9A 3G13A 3MGAA 4PLFA 5LD2C 3EC2A 1AQLA 4RZUA 3C45A 4RK0A 2DAAA 3R7BA 2H9YA 3VX3A 5B6IA 4D3FA 5CHYA 3N87A 2D2FA 3JXEA 3ICPA 5TNXA 5JBNA 5EIXA 821PA 3HVUA 1PR6A 3JTEA 1P2UA 3PRYA 3STWA 1EIZA 1V2GA 1Y42X 4E1AA 4A8JA 3CLRC 3CJTA 2JLRA 1J4AA 2P9CA 5B58T 2ZI4A 2IYNA 1EX9A 2QU8A 2GHQA 3SZ3A 3GIDA 3KZ1E 3HVIA 2R84A 3R09A 1NBMA 4FW9A 2QK4A 1J49A 5FF9A 4NMWA 5AFSA 2ZJ0A 2J0SA 3NVKI 1SURA 3NBZC 2XSZD 5K6TA 1AB5A 4L07A 3FWPA 5LB4A 1EDBA 2VJMA 4EG5A 3O90A 4DLUA 1M34E 3DR3A 1H2FA 5JECA 5LWQA 2IU6A 1X7XA 2CT8A 1VRCA 2IXAA 2W7TA 3PT5A 1CE8B 4XWTA 3UWMA 4YCLA 1CJKC 4JLKA 4Q4HA 4CQMB 1SQ5A 1G7CA 2V55B 2GQSA 1B76A 1UMBB 2GXQA 1AE1A 1SXGA 2H5IA 2NNLD 3HJHA 3ZPXA 2XCRB 2AEMA 1BHO1 3EZ7A 2JFHA 4MAMA 2AA3A 2EXXA 3GDEA 1YO6A 3FCXA 3HUTA 4AF8A 2JARA 1T9GS 2K6GA 3NKFA 3EXAA 1A9PA 2ECPA 2VT6A 3PC6A 1RBMA 2VLIA 2ZT6A 3GRRA 3O91A 3STHA 3CNQS 2R87A 2K87A 4WUVA 3JYPA 5G0UA 1RLIA 4PZEA 3VZPA 1P8JA 3QGMA 4JUBA 3DT6A 1L5SA 3IEUA 4JKYA 1SC1A 1Z6YA 4EX6A 4RTPA 2IIVA 1I7PA 1Q77A 3LBIA 1R0CA 3ENZA 2ID9A 3PU6A 1SQ6A 2AIRA 1XK7A 4P6VF 4P82A 5CRIA 1KI9A 5TJHA 3VPSA 3A2KA 4XB2A 5BMVA 3HGTA 4Q9DA 2D6FA 1U8AA 1VL6A 2I76A 3QUSA 3WWDA 3IQXA 3J81A 3PNKA 1QP7A 3KETA 4OKIA 4JXUA 4Q4JB 5C37A 1JZSA 3ZX4A 4FYMA 4LJRA 2X0EA 1XRNA 4R0VA 1CZNA 4P3NA 3RE1A 2ZUVA 1QQ7A 2B3DA 5DTJA 4COOA 3BA9A 1JG6A 1QK5A 4LJ5A 1JUDA 1I4EB 3EY9A 1SWVA 1TM1E 5G4LA 4PQEA 5BT9A 221PA 2YRXA 1QLHA 2V4MA 2BFFB 3FLBA 4A2QA 2VUHB 1IULA 1R2QA 3R7WB 4I4TF 3ZE9A </