4FFOA

Pylc in complex with phosphorylated d-ornithine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
363
structure length
353
Chain Sequence
MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYGLEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVLKERFGAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PylC
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase/reaction intermediate
total genus 118
structure length 353
sequence length 363
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ffoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ffoA01
1OZAA 1H0KA 1W6UA 3L0DA 4WK6A 3ZU4A 4FU0A 4M86A 3N74A 3UXYA 2WYWA 3FHLA 2FR8A 4JBIA 4TRJA 2GRAA 4XRGA 4OXNA 1E1KA 5B1YA 4K6FA 1R0SA 3GAZA 1SO8A 4W9NC 4Y6SA 4YAKA 1T4DA 1ZMOA 3KYCA 1BNCA 4D0RA 3JYPA 5JVLA 3INTA 3JQ9A 4MVJF 1C30A 1EQ2A 3KRTA 4QXMA 4BMSA 3HDQA 4B3HA 1JQBA 3EW7A 3DFUA 2JCXA 4BS9A 3AFMA 4BIIA 1SMKA 2YZ7A 3B1FA 3KEOA 4I50F 1E1LA 1RJWA 2FP4A 3MJSA 4KZPA 1A48A 4L0QA 3FI9A 2Z02A 4IJWA 1GCOA 1LDMA 3ZWBA 4U6QA 4XQGA 4FFLA 3R5XA 1HYHA 1ZNQO 3ORRA 1BG6A 4NHEA 2BFAA 4X54A 3FF4A 3QY9A 1S6YA 5I9LA 3HQ4O 3GNQA 1B14A 5H83A 4B7CA 4PZCA 5ER9A 5EL0A 3TRIA 2D0IA 3TZHA 3UCEA 3U0BA 4W7HA 1LLCA 3VH1A 1N9GA 3IDSA 5IF3A 2B37A 2EERA 2C7VA 2CVOA 4KUHA 4NG5A 3QE3A 3KALA 1QYXA 2Q2QA 3GAFA 5FYDA 1LC0A 3FNGA 4JIGA 5BSHA 1F12A 1Y8QB 4NMHA 4BL5A 2I5PO 2BELA 3JQAA 3PWKA 1VL8A 4Y8VB 4WLEA 1EMDA 3BTVA 3JD0A 3UHAA 4AJOA 2J3JA 1B6RA 4CV0A 4WGGA 1JAXA 4HADA 1E3JA 3GA0A 1JDJA 5DULA 4IMPA 1OAAA 4OKNA 3WYCA 4Y9DA 2VYND 3T7CA 3TINA 1K6IA 1XHLA 3S2EA 1G6KA 2FPPA 3PFWO 4IUYA 5CDSA 2PVPA 1NM5A 2WD8A 2Q1TA 3GN2A 3WBBA 3TOZA 1LDEA 1RKXA 2FSSA 3W8DA 3HG7A 3ZHZA 1PL8A 1WNTA 4IBOA 3WWZA 3WX0A 5H80A 3K5HA 2EJWA 2IRWA 4QFCA 5ER6A 3UFXA 3GVXA 1HLPA 4JNKA 1DLIA 5KKCA 5A9TA 5T5QA 2PD6A 3DBVO 4K6CA 1ZSNA 4UVGA 5KTKA 4BO5A 1IZ9A 4WCDA 1AGNA 4ALNA 4BGIA 3DEYX 5CDYA 3OBBA 4F6CA 5L7TA 4BMVA 2VT3A 3JQDA 4E3ZA 1EVJA 3GOHA 4Z9XA 5JLAA 3QVWA 4S1VA 1Y6JA 3WG9A 3RFCA 3Q6IA 5U4QA 4RVFA 4XGKA 2OL4A 1GPJA 3E18A 2W90A 3PQFA 3K6JA 2BF7A 4NH4A 2OFPA 5COBA 3OJLA 1GEGA 4OHUA 1A72A 1I10A 5AXCA 3FPLA 2XXJA 4FOSA 4MVJD 2ZB7A 3ZWWA 3ANNA 2D5CA 5IFLA 2CDCA 4WLUA 3VKUA 1UJMA 1KYQA 5I7FA 3TPCA 1LSSA 2BMAA 3CZMA 4NNJA 4RF2A 2J5KA 1F17A 2YYYA 2R82A 3K2EA 5AVOA 4P22A 1YGYA 1Q7BA 2W70A 4TUYF 5A02A 3AJRA 3TZ6A 5IDQA 1TXGA 3I9OA 4RLHA 5JCJD 4PGFA 2EP7A 4MPDA 2XCLA 2OZPA 2PWZA 4CV3A 4MV8A 3PGXA 4MA0A 2NVUA 4YJFA 2X8LA 3CMCO 1OFGA 1DFHA 1NR1A 4L4SA 1SZJG 2X9VA 2X86A 3RUIA 1JKFA 5DP1A 4O7VA 3HJAA 4OXKA 5A5EA 4TQGA 2V6GA 1L1FA 4AL4A 4YB8A 2X4GA 1JN0A 3GEMA 4YJGA 3WO0A 2ZATA 3C1TA 3W6ZA 4NJMA 3H5NA 2NU7A 4ILKA 3PPIA 4RF5A 5IG2A 3GVIA 2R7NA 4IHJF 3QJ5A 3G3EA 4UVEA 1WW8A 2GLXA 4DYVA 2OBNA 4B7XA 2PV7A 4YXFA 2DC1A 3UW3A 2FHSA 3BHJA 4Q3CA 1NQTA 4CV1A 3HFSA 4CM8B 4I5DA 1LEHA 5AXAA 2R6JA 3VZSA 4YJ3F 4DRYA 2YFHA 3I9LA 1GZ6A 2NQ8A 4PG4A 4B8WA 3BMOA 4WJZA 2FPIB 4I5FA 1J6UA 2J3IA 3JZIA 3S2GA 3NUAA 1HDOA 3FSRA 3CTMA 1B0AA 1I2ZA 5DCWA 1ML3A 4GAEA 2YW9A 1BDMA 2DTXA 3PYLA 4PLVA 4AJPA 2CFCA 4PFJA 1PS0A 2W2KB 3NEPX 5BSEA 3INRA 3F1KA 4JJFA 4K9DA 4DL9A 1QORA 1B8VA 2NU9B 4IZOA 2R85A 4XKJA 1KERA 1SBYA 1W0CA 2A4KA 3DBLB 1T1RA 2YDYA 2X7HA 1Z73A 4KWIA 3H9EO 2J6IA 3WNQA 3WTCA 2O2YA 3VTZA 1M66A 3BTSA 3OJEA 1PGOA 2QRLA 4UUPA 4ZICA 1QMGA 2DM6A 2IZ1A 4ZRNA 3LQFA 1U7HA 5G4KB 1HDGO 2NU6B 2I67A 2VWGA 4ZQEA 5FEUA 1GUZA 1DIBA 1J4AA 2D4AA 4C5BA 5BNIA 1IB6A 3U3XA 4Z0HO 3RV3A 1H6DA 1YBAA 1Q1NA 3ZHBA 1HE5A 3LVFO 1ISFA 4OMUA 3JQ6A 2WTBA 3HDJA 2J9GA 3NGXA 4Z3DA 3MEQA 4BGEA 5A3JA 1UDBA 3P2YA 1Z2OX 1N7GA 3F1LA 3L6DA 2B4TO 3DFZA 2PKQP 3DQPA 1Z45A 1Y8RB 3L07A 1LBEA 4M87A 1ZBQA 1YONA 3WJAA 5BMVF 5A9RA 4QT0A 3MOIA 2AMFA 3CMMA 1JKJB 3N58A 3OUZA 4I9NA 3PDUA 3WO1A 1W96A 1KJJA 1Z2NX 5TQVA 4XRRA 3ZWNA 2ZJ0A 4MIOA 3RC7A 1GSOA 1B26A 2X5OA 5T8KA 1P45A 4DUPA 1LQTA 4M9UA 3RQSA 4BNYA 1XA0A 3VVCA 5IAAA 2DWCA 1GUFA 3N7UA 3ZWCA 4QQRA 2FSVA 1HF3A 3GVHA 4J2HA 4BNMA 1DBVO 4CLHA 4R3WA 5JQGF 4YAKB 1VC2A 3NV9A 3CEAA 2YW2A 5MDHA 1U4OA 2OMEA 3OEYA 4XZ3B 2NTVA 2NADA 4BNUA 3AM3A 2CDAA 4EJMA 4ESOA 4R9SA 4E21A 4TRNA 5F3RA 2I99A 1KJIA 3ETHA 2GN4A 2Y1FA 5FFFA 4MV1A 3ROMA 5F21A 4TRMA 1RWBA 2GASA 2FP4B 3I23A 3STHA 1E4EB 3E9MA 4XDZA 1GQYA 4ND2A 3WNZA 3PZBA 3HN2A 3SLGA 1T24A 3ST7A 5JDCA 3A4VA 1BVRA 3DO5A 3QWAA 1EVYA 4J49A 2AEFA 4GBJA 1PZGA 4CMEA 4DLAA 4EUEA 3EY4A 3V1UA 4MVJM 3DZBA 3LT0A 1EE2A 2GGSA 2O3SA 2ZTLA 4R1NA 1VBHA 4O4HF 1QRRA 3IJRA 5KX5F 1V8BA 3JV7A 2PD4A 3PP8A 5G0SA 5GMOA 3UN1A 4A5OA 4OKIA 1C0PA 4LISA 1J0XO 2RBEA 5ICMA 3I9KA 1N1GA 3ORQA 1EUDB 4NYEA 3F46A 1WZEA 3Q0EA 2YRXA 1IE3A 1UP7A 1M75A 2EKPA 3I1JA 4XB2A 1T2CA 1H6CA 4YPOA 2X0NA 1E5QA 3O03A 4CUZA 1XU7A 4YWJA 3VOSA 2AW5A 4JBHA 3R5HA 5F1KA 1AN9A 5F5NA 1GSHA 2PH3A 4OL9A 1O5IA 4WBNF 3GVPA 3IIEA 4AJEA 3BMNA 4YT8A 2TMDA 3KTDA 2C0CA 4NR0A 1BXRA 1WPQA 4M55A 1PTJA 4B79A 2Q46A 4ID9A 1PGPA 2H5LA 1LLUA 1JDBB 2FPPB 3D3EA 3EVNA 4HFNA 4MJLA 5DF1A 3V1YA 4FC6A 2VZ8A 5CEFA 4XGNA 3L77A 1AHIA 3IUPA 4JX8A 1I24A 5AOVA 4DPLA 2GUGA 4B4WA 4U5QA 2A35A 3KB6A 1UAGA 5KNLA 1WDKA 4FSHA 3UFXB 3JD1A 4XYBA 3GZNB 2JFFA 4R69A 3AOGA 4GWKA 4IMRA 2Y1OA 3GG9A 3RUFA 5L45A 1DIKA 4MVJA 3JQ9C 1LX6A 3RD5A 4N18A 5IXSA 1U3WA 3PWSA 3DAGA 1I5RA 4TVOA 2ZIZA 3U62A 4BO3A 2WE7A 4ZQFA 3VPXA 2QIOA 2W2LA 4Y6RA 2BGLA 3K9QO 4R1TA 4WASA 1I7LA 1OBDA 5L4LA 1C0IA 4QO8A 3ICPA 1JVBA 1HLDA 3PYXA 1OOEA 2YZGA 2OGUA 4K26A 4YT2A 2HRZA 3VAZA 4W6ZA 1ZH8A 2DBQA 2X5JO 5AQ1A 3CE6A 4PLCA 1QLJA 4H16A 3VPHA 1DIAA 1EDZA 1MV8A 2FPGA 1GL3A 1RM4A 5A5FA 1U3TA 4H15A 1TEHA 2VOJA 3I83A 2VQDA 1F0YA 4JJGA 4IDGA 4ZQBA 3M1AA 4CMJA 4RPHA 1YVEI 1ENYA 3PWZA 2E48A 5KCZA 3DF7A 4J9VA 4YBZB 3LK7A 3D7LA 4IDBA 4UVHA 4WCFB 1C1XA 3QVXA 3L4BA 1BXGA 2NVUB 4LN1A 4KTTE 4YJFB 1VM6A 3HZZA 1B3RA 2ZYAA 4BNKA 5G2OA 4HR7A 2HQ1A 4TROA 1H5QA 4LSMA 2NLOA 3IP1A 5CA1F 1NPDA 3KXDA 4FGSA 4J1SA 4ZI7F 4MKRA 4CMGA 4OOFA 4HQ6A 2D2IA 1M2WA 1ZK2A 4YJGB 3ROKA 1E3IA 3C1AA 4MAMA 1E7YA 2DLDA 2O7QA 3VZQA 1B16A 3LC2O 4NJMB 1D3AA 3HE3A 3ITKA 4L9RA 5JCXA 1Y9EA 1KEVA 4GMGA 2GPSA 4BNIA 4YJ2F 1ZSYA 2VWHA 4DPMA 1LTHR 2P2SA 5BR7A 1S7CA 5BSGA 3GNSA 1K0UA 1IOLA 3G17A 4O86A 3BZUA 4UVIA 3TL2A 3JQ7A 5IJZA 4MVJE 3BMOB 2R84A 4BHTA 2Q3EA 4BUCA 4DVJA 1PJ2A 3ZU5A 1A27A 2O3RA 5F1OA 4Q9NA 4DIMA 1PEDA 4YT4A 4GX5A 2HJWA 4MV7A 1MX3A 2QW8A 2CD9A 3IMFA 4R68A 1Y7TA 1O89A 4E2XA 1JLLB 1DOHA 2B5WA 3WSWA 2E82A 3CINA 2G17A 3ON5A 4J0EA 4JCOA 4R5HA 1Y5RA 3EHEA 1R4NA 3ZN2A 4CV2A 3RJ9A 2ZCVA 4YT5A 3DOJA 3D5QA 1Q0HA 1IPFA 1JKIA 1SC6A 1I32A 3E8XA 4YAEA 3ZV5A 4EGJA 1DC4A 3GPDG 4E2WA 4EJ0A 4UEOA 4ALLA 4I9UA 4PLFA 1U3UA 1ZFNA 2P68A 5HRUA 4PVCA 2VT2A 1SEVA 2CF6A 5FF9A 1C1DB 3JQFA 2C5EA 4HV4A 2UUOA 4XYLB 1DV1A 1IL0A 3ONFA 4LRTB 4EYEA 1HE4A 4LVUA 4J9UE 4OIMA 1NXQA 3ZWYA 2VHVA 2WWRA 1HSOA 2XXBA 5JVDF 2VUSA 5IN5A 3GR6A 4JGBA 1E7MA 4XEHA 2V7PA 5L53A 6LDHA 5B4UA 3O26A 2P5UA 4J91A 2BLLA 4EEXA 3IS3A 3WIEA 1ONPA 2AXQA 5DBIA 2XPCA 1H2BA 3I9JA 5T64A 3OJFA 4MOWA 1P31A 1W8DA 4Z0PA 4ZHQF 5KJ1A 1KC7A 1I01A 1OI7A 1IHYA 2UUPA 1FMCA 2VTEA 5ICSA 2ILTA 3RUPA 4YJHB 3JD4A 4B3IA 2J5QA 1LDNA 1GV1A 1EUCB 3SLKA 1DFGA 2VOEA 3GGPA 4CLRA 3MJ4A 1QLHA 1E77A 1C0KA 4MP8A 2GSDA 2AA3A 2Z5LA 3HUDA 3GY0A 3NTOA 4WECA 5GZ6A 3AY7A 4WOKA 4DA9A 1EQUA 4B4OA 1O8CA 4D7AA 3ZHYA 3LT2A 1QR6A 1VLLA 2EG9A 2O4CA 2GZ1A 1G1AA 3ETJA 1GV0A 3MWDB 4P8RA 5EN4A 3ZV4A 4F6LA 3G79A 3TWOA 2YUTA 3OEWA 3N6RA 1WDLA 1DHRA 4A10A 5AYVA 3ZW9A 5ENVA 4R41A 4NBUA 1YDWA 4FCCA 1EVIA 1XU9A 5IN4A 2HSDA 1PJ3A 3JD2A 4FPXA 9LDTA 7MDHA 3NJ8A 1TVEA 4NI5A 4AJ2A 1TLTA 1NTOA 2DZDA 3HFGA 1KEPA 2O3TA 2YQ5A 2DFVA 1YJQA 5A3VA 4AVYA 5CAEA 1EFLA 3D4NA 3PEFA 2YRWA 4O81A 4BQPA 3QHAA 5DZSA 3WLEA 3U49A 3UCXA 1CQIA 1VRWA 5EERA 3K73O 4BO7A 3E6AA 4BKPA 5DBGA 4N5MA 1MC4A 3OHSX 5L7WA 3NJ4A 4O1MA 4E5MA 1HRDA 2DUWA 2YWVA 4FQ8A 2Q2WA 4RVHA 2GZ3A 5JBIA 3NAQA 3SXPA 4NPCA 4UEKA 1JVSA 3QVSA 2C00A 1NFQA 5JDIA 2JFHA 1UXJA 1ZK3A 3UOGA 5DCUA 2IZZA 3ADOA 1CF2O 2WEKA 1H9BA 1UXHA 1FJHA 1RPNA 4O7NA 1I33A 3OICA 3RC9A 1RYEA 3KLMX 4GLOA 2FB9A 1NVGA 3KM0A 4BOYA 5I7EA 1YL6A 4NZ9A 5DT9A 2WMDA 1KY5A 3BTOA 3HWRA 4W4TA 1NQOA 4K1LA 4RZHA 1AE1A 2Q45A 3MJCA 3QP9A 3PJEA 3ORFA 1KUTA 5K6AA 1PJTA 1XWFA 4BGUA 3ZNOA 4BNWA 2QQ5A 4F3YA 1YB5A 3D3WB 3ICCA 4PIVA 3ZV6A 2BGMA 2AQ8A 2PA3A 4AICA 3BIOA 1ZJYA 3ZH2A 1UAYA 2BKAA 5HBRA 1ZVMA 2EF1A 1ZKMA 1BVUA 2HMVA 3LF2A 3RKUA 4CLXA 3DHYA 1ID1A 3VDQA 4TVBA 2X0IA 1KETA 2HMWA 4FB5A 2Z04A 1PJQA 3H9UA 3O8QA 2V6FA 4ME6A 3C1OA 3F4BA 2BRUA 3W8FA 3ITDA 1O9BA 3PHHA 2EHDA 3VPBA 4OQYA 3S2IA 2JCVA 1P74A 1V6AA 3R5FA 2QRKA 1N92A 1W73A 5L40A 1R0KA 2YFQA 4M89A 3DBHB 2RH4A 4YRBA 2GR9A 2EXXA 3UCFA 1P9LA 5U9CA 1ZUD1 3DL2A 4RQTA 4YAJB 5L3ZA 1BDBA 2ZYGA 3LF1A 1XEAA 1WR2A 3V4ZA 1LXCA 1QV7A 2PZKA 2BH9A 1I7NA 3GLKA 1YL5A 3JQ8B 4B3JA 1KC1A 3P5SA 2YV3A 5L7YA 1YBVA 3GEGA 4C7JA 4XCVA 5CPFA 4RPKA 5JDCC 3R1IA 1BXZA 1M0TA 4KDFA 4CLDA 2C2YA 4DWVA 3WGYA 4CMEC 4DTIA 3DOOA 4NIMA 1CERA 2FN7A 3HB5X 4O2AF 2HUNA 3EVTA 3I4CA 3AI2A 1IULA 2CVQA 3I9MA 4CUJA 3H9GA 4XYMA 4BNFA 2EEZA 2WJPA 2SCUA 3OA0A 2GF2A 3GGGA 5H81A 5HS6A 1Z75A 4FFOA 3GMSA 4FC7A 4BO9A 3OF2A 3ULKA 2BD0A 1C1XB 4HNVA 4JP3A 2OP1A 2NUAA 4XIYA 4MKZA 4AJNA 3GMDA 3VTFA 4ZVVA 3ENNA 4O7RA 1GAEO 2VWPA 5IDWA 1GD1O 1GSAA 5KOIA 3NT2A 4L74A 5T57A 1TI7A 3ENKA 2YL2A 1HSZA 1FDUA 1ZK1A 3O38A 1VL6A 3GUYA 4PCVA 4Q3BA 4BO2A 3WGIA 4Y67A 1W93A 2O48X 3K5PA 3LC1O 4QFDA 1V0JA 3F4LA 2FZWA 2CY0A 5FNVF 4HFJA 1XSEA 4YCAA 2FWMX 3WB9A 1VSVA 4CR8A 3RUCA 3B1JA 2NWQA 4N5LA 1P0FA 2GERA 5JQWA 3K30A 4MVJP 3TJRA 2EW2A 1LRKA 1HXHA 2YDXA 2OXIA 4I55F 2Z95A 1EE9A 4WPGA 1PJ4A 3FN4A 3GN1A 5IZCC 3BA1A 3PIDA 2G0TA 4C7KA 4PG7A 4BV9A 1VE9A 1W4ZA 4ROSA 4JJIA 2CNUA 4XX0A 1WP4A 2X0SA 2W6ZA 4GWGA 1PU2A 2VPQA 2Y0EA 3JQGB 4A0SA 2AQIA 1Q0QA 1ZCJA 2R86A 2HO5A 3QA9A 1R4NB 1VKNA 5BNFA 4RPLA 4A2CA 2VQ3A 4KDEA 3R23A 1PGNA 2HMUA 1GYRA 4RVSA 3BHMA 2ZJ1A 3U55A 1N5DA 3NT5A 2GN6A 1U5AA 4HFMA 1IOWA 4HNHA 4TZTA 3JYQA 1B15A 4R4JA 1CWUA 3F47A 3GLQA 1E3SA 4ZQIA 1KC3A 3DB2A 3QRWA 1I3NA 3EAGA 2Q4EA 2GN8A 2X9NA 2P9EA 2J3HA 3R6DA 4DIFA 1E1NA 4N5NA 1YDEA 2PH5A 3RUAA 2PLAA 4E2YA 1H6AA 3F5SA 3PQDA 3U9TA 1KEEA 3K96A 3DOCA 2PK3A 3TDKA 1WMBA 2ET6A 4XJTA 2BGKA 4ZU3A 2X6TA 3E82A 1M0WA 1VJTA 2JD1A 2POQX 3GFBA 3Q2IA 3ZWAA 3GIDA 4OH1A 1SCUB 2EWMA 3U4HA 5KIAA 3VPFA 1EBUA 2PGDA 1SB8A 3L4BC 3ONDA 3ASUA 1GEEA 4Q3NA 3GFGA 5BNTA 5TT0A 2DBVO 3GPIA 1VSUA 2WDZA 3HDHA 3JQBA 4L1KA 4TV9F 1UZNA 2X9GA 5CP8A 2V65A 3CUKA 4PLPA 4IGFA 4CM4A 1F8GA 2WYUA 4JN6B 4F45A 2EGGA 3A14A 3Q3CA 2YHIB 2AE2A 4D42A 2DBRA 3E5MA 5CEJA 2WD7A 3IAHA 1DC6A 2P5YA 3LLVA 2OP0A 3MCVA 4QECA 4EW6A 2BI8A 1ORRA 1SOWA 5JYDA 1BRMA 5DP2A 3FNHA 1LU9A 4P4GA 5A05A 1NFRA 3DWFA 3AX6A 4IIVA 3AOEA 2HMSA 4G5HA 3TZQA 4PZEA 1T26A 4DC0A 4CR6A 4OSPA 1P0CA 2EW8A 2JAPA 1BMDA 3GZ4A 3TOXA 4BKRA 4BV8A 2J3KA 1ZSVA 2DBZA 2HCTA 5CAEB 3QWBA 4MO2A 4R9RA 1Q0LA 4LCJA 4WLNA 3OQ6A 1KY4A 2AHRA 3WTBA 5KVCA 2DLNA 3GDOA 5D8DA 2VUUA 2W98A 4R51A 2DPHA 1R4MA 1CQIB 2BFPA 1XLTA 3DC2A 3EZYA 2V6MA 1E5LA 3WBFA 2I87A 3ZNPA 1TA4A 4O7SA 1HDXA 3IUSA 4XQ9A 2NACA 4NK4A 4D3DA 4EJ6A 5KVSA 3IC5A 2YZLA 3ETDA 3TNLA 5HM8A 3Q9NA 4GKBA 4O59O 1E7SA 1ZJZA 4PRLA 3WYBA 3ZWPA 4D41A 5MGBA 4PLZA 3JQFC 4ZQHA 3RFXA 3NUGA 3D64A 3E48A 2W6QA 3GT0A 1DC3A 4MP3A 5JSFA 1DRVA 1KEWA 1RM5A 1MUUA 1T2EA 3BMCB 1FXSA 3TFQA 4ALMA 2HDHA 3WR5A 4PZDA 4PVDA 4CQMB 2P0AA 4HBGA 5KVVA 2RIRA 4MV3A 4RJTA 2B35A 3B70A 3BMQB 3RFTA 3PQEA 1CS0A 3G1UA 4ONEA 4XQCA 1E0DA 2GQSA 1HDRA 1P1JA 3OJOA 4LK3A 5J2TF 4CQLA 2QX7A 4O63O 3KSZO 3PZRA 3KYBA 1MGOA 2CNBA 2EKLA 4GVLA 3V5NA 4DGSA 4E5PA 2GNAA 1EK6A 1GU7A 1OBFO 1PIWA 4J2OA 3JRWA 3RI3A 4J90A 3SC4A 3BTUA 4J4TA 2QHXA 4YYZA 3TZKA 2W6PA 3KYCB 3C7AA 4I9HA 4XR4A 3VMMA 3B20A 4WEOA 3VPSA 1X7GA 5JAQA 1WDMA 1DV2A 1DFIA 5CDUA 4A73A 3U9LA 2IP4A 1IZ0A 2CDBA 2P4HX 1UXGA 5CHEA 3GDGA 1PQWA 5AXDA 3I9NA 4RLSA 3PLNA 4GSKA 4RVDA 3KYDA 4UAGA 4IIUA 1H93A 5KKAA 1T1SA 3WGHA 3JTMA 3RASA 5HWSA 3HO8A 3KAKA 1HYGA 3AUUA 4JLWA 1E6EA 4IQ0A 4YDRA 1HTBA 1QYVA 2VYVD 1U2DA 3HHPA 5EIOA 4Q3EA 3GNTA 4DBVO 4ITUA 1MG5A 4JBGA 3PVZA 4B8ZA 3RU9A 4CLOA 1HE3A 1ULSA 3TZCA 1YKFA 4IZIA 4N54A 2YZNA 3JQCA 3O4RA 3JYNA 2DT5A 1M6VA 1A9ZA 2V58A 1YOVA 2EV9A 3F3SA 1X0VA 4NBVA 1N9GB 4E13A 2JKVA 1D7OA 1JTVA 1T4BA 2NTJA 2VYNA 4BMNA 5TF4A 1AXGA 5LCXA 1PR9A 2R00C 1ZO8A 1LA2A 2JFGA 3JQAB 5IZ4A 2OUIA 4N7RA 2RHRA 5JO9A 3WFIA 3TQHA 1LRLA 5L51A 1ADCA 4O82A 1G0OA 2GPTA 4WE3A 1HDYA 3AU8A 3GGOA 1H2HA 3GG2A 3Q2KA 3R3JA 3S1LA 2H63A 3AU9A 3U4IA 3P19A 2EP5A 1LNQA 3M2PA 3KETA 1X15A 3ETGA 4PN3A 2IYOA 4FE2A 4XDYA 4J43A 8LDHA 5K6AC 4BO8A 3R3SA 3VKVA 1Q2XA 2HU2A 4E4TA 5CB4F 2V6BA 1J5PA 1F14A 4FBGA 2GDZA 5JPIA 3VH3A 3DMTA 3H3JA 4P4LA 4XYGA 5GONF 1KEUA 3MWEA 1DDOA 2PNFA 2YHUA 5IDYA 3H4VA 4WEQA 3ZWXA 2I8CA 1SPXA 3IQDB 4F46A 4AJ4A 4CM3A 4IDCA 3DAFA 1PGJA 2DAPA 5JC8A 3ROPA 3L6OO 3AY3A 2Y67A 1DLJA 4OSOA 4P4NA 4IGEA 4FFRA 3R0IA 4IDEA 3I6QA 4IDAA 1YXMA 5LA6F 1NQ5A 2P4QA 4UEJA 3L9XA 2J8ZA 4RPGA 2TMGA 3PHLA 5F1PA 4EI2A 2VNAA 5CA0F 3LP8A 3AI1A 3UKOA 1GADO 2GO1A 3VC7A 4R3NA 4XX0B 2B5VA 2HK9A 4UREA 4IZHA 4D3FA 4BVAA 4IXTA 3VA7A 2OLSA 3OQBA 1I8TA 5KJCA 3GDFA 3DHEA 5FWNA 4CL3A 4RL6A 1CIVA 4BNGA 1EUZA 1ONOA 1YS4A 5J2UF 3KSDO 5JCJA 5K9ZA 4CM9D 3Q1KA 1GGOA 3GQVA 4TZKA 4RQUA 1PS8A 3PIIA 4YVFA 3AK4A 3MJTA 1HDCA 4JXKA 1VPDA 1YB4A 3ZCXA 5JC1A 3W6UA 1A5ZA 2QG4A 2PZJA 3C24A 1XIVA 1T2FA 3T4XA 1U8XX 2GYYA 3RIHA 3FPCA 2VRCD 4DQVA 3LT4A 1AUVA 1PGQA 4L4RA 2Q49A 2PZLA 3A1NA 3I12A 3LT1A 1WMAA 4G65A 1ISIA 2XOXA 2RCYA 1PR3A 4O7ZA 4MV9A 5B4TA 4IM7A 4FFPA 2Q1UA 3PJDA 4Q3AA 2AG8A 3KOUA 4OQZA 5KJ6A 3OSUA 3RBXA 3RUDA 4DC1A 3R9RA 4TMFA 1D1TA 5T67A 3INGA 1JDEA 4YB8B 5I9MA 1ADBA 1R66A 3UICA 1JWBB 3V2UA 1LRJA 1LJ8A 4PLYA 3SE7A 2NU7B 2YY7A 4RORA 3CKYA 3IOYA 3AM5A 3AUSA 3GUCA 4G81A 5F5LA 5TIIA 1ENPA 1WLYA 4EITA 3UH1A 1DAOA 3WMWA 4O83A 2Z1NA 4D0SA 1CEQA 2QZ9A 6ADHA 5TS3A 2P9CA 4J7UA 3OQ1A 5C7IO 1K6XA 4U8GA 2WD7B 3KREA 5L4NA 4NFHA 3SJ7A 1MC5A 3EZLA 4I1IA 5GZ1A 1Q7CA 4JP2A 3W4IA 3OH8A 1DIRA 3SJUA 1EVZA 1BTOA 3FD8A 1QKIA 2G1UA 3ZW8A 4ALKA 1DJNA 1Y9AA 3EMKA 2FR0A 4E5YA 1X1TA 5ENDA 1QYCA 4RDHA 1RM3A 3HNPA 4M8SA 1C3VA 4L75A 5BPFA 4J3FA 2PBZA 3U9SA 4J1NA 4BNVA 4KQWA 2C59A 3VZRA 1HL3A 1R4MB 3TQTA 1MA0A 3C3XA 1SEPA 4RV9A 1U1IA 5CPBA 4AJLA 1GTMA 1UDAA 3QW2A 1NASA 3H7AA 1UZLA 3SC6A 1GCUA 5THKA 1B2LA 2D1YA 1O94A 3CZRA 1PJCA 5TC4A 4CJXA 1NP3A 5C3MA 2W6MA 1N2SA 1NHWA 1PL7A 5HA5A 2X0JA 5I9NA 1QV6A 2CMDA 5ILOA 1XGKA 4RCVA 2O23A 4KP7A 1Z7BA 5DNAA 5JFOA 4NU6A 2VZ9A 3MTGA 4WLVA 5AXBA 1VJ1A 3I52A 3ROQA 4BNNA 1DEHA 4PG5A 5HTOA 5EPOA 1K6JA 4A03A 3SX2A 3GH3A 4C5CA 5KJFA 3PI7A 2OOSA 3CSDA 3NRCA 1ENZA 2R7MA 3WNVA 4Z9FA 4HNGA 2X23A 2ZB4A 4IPTA 5LC1A 4BNHA 3FBTA 4MA5A 3Q11A 2Q50A 1YBMA 2LDXA 3NTQA 4WLFA 3WGTA 3DAPA 1BHSA 3RVDA 1H94A 4TV8F 5JNLA 4DBZA 1CRWG 2ZTMA 4PG6A 2X0RA 2CNQA 1U3VA 4ND1A 4GL4A 3JQBC 5EMHA 3OM9A 3QLJA 4XB1A 1KJ8A 1NPYA 3AWDA 1YWGO 5L95A 3EC7A 2ZTVA 2BI7A 2DU8A 3KV3O 2ZCUA 1QP8A 3RROA 4CMKA 1L7DA 3DZIA 2OORA 4DIOA 3MJFA 1HEUA 2W71A 4J0FA 3QWIA 3CH6A 4YRDA 2B83A 1NFFA 3T7EA 3AI3A 3NDJA 2VYVA 3E9QA 1DXYA 2JD2A 1KJ9A 2O50A 3C85A 4D46A 4CPDA 3FCOA 3W8EA 1JWAB 2C54A 3NYWA 1A71A 1V35A 3WQRA 3Q2OA 3TIGA 2FPIA 2PZMA 4BNXA 3HDYA 3VHRA 2VHZA 1P1KA 1ULZA 2Z1MA 3NX4A 3L4SO 4HKTA 3RKRA 1C3OA 4D45A 4MV4A 3M1LA 2IEBA 1QSGA 3O9ZA 4GKVA 4YJDA 5LDHA 2B69A 4UULA 4II3A 3V8BA 1ZK4A 2ZKLA 4EUHA 4ZN6A 1DJQA 1SAYA 4JK3A 2H6EA 1WXDA 2ZB8A 1E7WA 2O3JA 4FGWA 3QVOA 1YOVB 2Q1SA 3DBLA 3WOHA 1D4FA 1WAMA 2HMTA 2X5KO 3OJ0A 3PTZA 1NWHA 4JROA 5J23A 1IY8A 1UP6A 1UXIA 3D0OA 4HUJA 3LC7O 2YV1A 3HBLA 4BKQA 1B8PA 4M54A 3KEQA 5G4KA 4DMLA 2NU6A 3JQEA 1NQAO 3BMNB 3F6YA 3QVTA 1QG6A 1XR3A 1XYGA 5DMXA 1Z7EA 1BW9A 2R7KA 4EGQA 3U54A 3VVBA 4C4OA 4CR7A 4MDHA 4BKUA 4PLGA 3HADA 1ADGA 4J1TA 1WVGA 2IODA 3E5NA 1AHHA 2Y1DA 3M2TA 4O7LA 3MWEB 4IQ8A 2VHYA 4QO7A 4R1UA 3ZWMA 1YQGA 4XR9A 4BB5A 3QFFA 5T8KC 3RFVA 1Y8RA 4TRRA 3PHJA 4GSLA 1JKJA 3K31A 4ZJUA 4U0KA 5TGDA 3G0OA 1KVUA 2HJSA 3PGJA 4DXHA 1KIFA 4E6PA 2UDPA 2NVBA 4D3SA 3C7CB 4CM9A 4D44A 5JAIA 1I30A 2QK4A 3FTNA 5C8YF 5B37A 1NAHA 5TX7A 1TT5A 1LDGA 1WZIA 1Z82A 3B1KA 2YS6A 1E6WA 4I8XA 1JU9A 3RC1A 4OYRA 2HRBA 5LOVF 4YA6A 3ZU3A 2YZMA 2D5AA 1F06A 3PHIA 4J7XA 1RYDA 4XZ3A 3C7DB 1ZIDA 2VRCA 4QUKA 3U5TA 3NGLA 4UUMA 3JCZA 3GK3A 3LDHA 2O2SA 4MIYA 1B3BA 3V1TC 4Z0TA 4RPJA 4BQRA 4PLHA 3HB9A 5U1PA 2PTGA 4NQZA 5TJHA 2E6UX 3ZNQA 2FPGB 3GVCA 1MFPA 3ZWOA 3IJPA 2Y1EA 1E4EA 5CFZA 4NBTA 1A4UA 2R2GA 4NBRA 1X14A 1H9AA 5EZYF 1ISMA 3A9WA 3LLSA 4HXYA 4TWRA 5JAZA 1PZFA 1PX2A 3DXFA 4AJJA 1U4SA 5ILGA 5CEEA 1YJ8A 4ND4A 2D59A 1O0SA 3PDJA 1DHTA 4R16A 3PK0A 3AY6A 1T2DA 3ANMA 3S2FA 1ZXBA 1YL7A 3BXXA 1OC4A 2QZZA 3FBGA 4GI2A 1YO6A 1BXGB 4WKGA 1HDZA 5H82A 1E92A 1H6BA 3JRXA 4CMCA 2EJVA 2DVMA 4IJVA 4IXWA 4YQYA 4BO1A 3L9WA 1VL0A 2ZQYA 5A9SA 3EK2A 1EUDA 1CQJA 2IZ0A 1GR0A 2JCYA 2JHGA 3MOGA 1I3LA 2CUKA 2OO5A 1BXKA 2Q2VA 3DTTA 1CJCA 1Y81A 3JYOA 5EQFA 5IXYA 1DPGA 1PX0A 1HZZA 4MVJI 2DTEA 1HETA 3H9QA 5CG2A 5JY1A 2XD4A 4DQUA 4J16A 5JS6A 2O7SA 2ZK7A 3JD3A 5IDXA 1YRLA 4I08A 3RCBA 2B0JA 2A92A 4RF4A 3DMTC 1LC3A 5KKNB 3AW9A 1EHIA 3JQ7B 3COSA 2CZCA 2NU8A 4CM1A 5JXWA 1AXEA 2P9GA 1E3EA 3UF0A 2JL1A 1PQPA 2RHCA 3WICA 4J6FA 4OJNA 4IY1A 3K8ZA 5CDTA 5K0ZA 1Q7GA 5KWEA 2C5AA 4NDNE 1X0XA 1PWXA 3WS7A 2GCGA 2AEJA 3KBOA 4FR5A 4LVCA 4TSKA 5C1PA 1LSOA 2E4AA 3H5AA 3GZNA 4XD2A 4DYDA 4IDDA 4O5OA 1U8FO 5ITWA 3ONEA 2X58A 4AJIA 4B7UA 1I0ZA 4GGOA 2QF7A 2R7LA 2X22A 4MKXA 4R1SA 1NAIA 3DBRA 1YQDA 1UP4A 4EZBA 3B6ZA 4R5MA 1CETA 5COAA 3AUAA 2JJYA 4EBFA 4U7WA 1XQ6A 1VBGA 3PYMA 2PKQO 3KLPX 3A06A 3UGKA 1AUXA 4NFYA 1O6ZA 1UUFA 3PXXA 1GDHA 1XCBA 2E37A 2QYTA 3BAZA 5C5IA 1BSVA 2VNSA 4I4TF 1JW9B 2C82A 3KHUA 1GFSA 4W7IA 1HZJA 3L6EA 5A04A 1P1IA 2O3QA 2C29D 4HFRA 3WSVA 4HX5A 2DIKA 2CF5A 2DPGA 1A9XA 1ISJA 3GHYA 5DCYA 4NFSA 1KJQA 3VPCA 2FOIA 3IKVA 4CL8A 3OFSA 3DZHA 2W2LD 3AFNA 1T2AA 4LMRA 3D4OA 1D8AA 1PJBA 1YQXA 4URFA 1LDYA 5FI3A 3FWNA 1K5HA 4DLLA 4FGRA 4ZQGA 3TL3A 2Y0DA 2VWQA 3D5TA 2FY8A 3RBVA 4J4BA 5COQA 4YBZA 4CLRB 4KMSA 2FZEA 4WCFA 3MTJA 2A94A 4IS2A 3LU1A 3ZI0A 4E31A 1ONNA 2CZGA 1NVMB 3KO8A 4DMMA 2VCYA 2JAHA 4RZQA 5A1TA 4O2BF 2PKRA 3OMLA 3E03A 3ZDFA 3WIDA 2VN8A 4GVXA 4MINA 4AJHA 2I80A 1FDWA 2NM0A 2RH8A 5I7SA 1MB4A 3CXRA 3LYLA 1WWKA 4O7TA 3DTYA 4FFMA 3DR3A 5DOVA 3ZHXA 4CM5A 4INAA 2R87A 2B36A 2RAFA 4Y6PA 2IXAA 1QXSA 2PY6A 1MXHA 3K5IA 3RBZA 1B7GO 1JAYA 1I3KA 3ZWVA 5GY7A 1R6DA 1E1MA 1XELA 1NBOA 2YS7A 3WMXA 1GLVA 4CMIA 1FDVA 3D1LA 4GX1A 3G8DA 4G2NA 4GLLA 3RJ5A 5TNXA 3MZ0A 2BFMA 3ZGYA 1SOVA 2G82A 4QX6A 3PJFA 2W8ZA 4AG3A 1JLLA 4XWYA 1UZMA 3OECA 5L4SA 4OAQA 3JZFA 2GPWA 1U9JA 2FMUA 1V3TA 1E3WA 9LDBA 2WYVA 4E2ZA 1DB3A 1SNYA 3AM4A 1JA9A 5I8ZA 1C14A 1KOLA 2I3GA 2GQRA 3UVEA 2H9IA 1PZEA 2I9PA 3PRJA 5TSDA 1U7TA 3VZPA 4FFNA 1ADFA 1D1SA 1C1DA 2GLTA 5JW6A 4AJ1A 5G0VA 4OO3A 4QSHA 1HKUA 5TRTA 4XYLA 4M1QA 1VI2A 1ARZA 4XA8A 3H2SA 2Y68A 3FR7A 2V59A 5JO0A 1BW9B 3WFJA 3GRKA 4DQXA 1NWCA 2E49A 3QQPA 1T25A 3X2EA 1UDCA 5BSFA 2PD3A 5HBRB 2J5RA 2UYYA 5A06A 2W6NA 2VR1A 2O3UA 4M49A 1HE2A 4R01A 1VJ0A 3WQSB 1EDOA 3UAGA 4O4JF 3MJVA 3AW8A 5ITVA 1GYQA 4HP8A 3WLFA 1I36A 1LLDA 1FDSA 1X1EA 1HT0A 4ZD6A 3O8QB 3RSHA 5LP6F 3K2BA 2AE1A 3ASVA 3KVOA 4L76A 4YJHA 1U28A 1KVQA 4DLKA 1A9YA 1EUCA 1PK8A 1RM0A 1N1EA 2HGSA 1X7DA 2ZDGA 4W9NA 3OP4A 3S8MA 3CIFA 4LW8A 1NHGA 1TT5B 3QWHA 3MWDA 4RZIA 2BFOA 3JSAA 4AFNA 1HYEA 3IP3A 1KBLA 5BT9A 3V4SA 2AQHA 4OM8A 5ES3A 3RUHA 3OIFA 3P7MA 2Y66A 2WSBA 3DZFA 1X7HA 1IHXA 3QSGA 4L8VA 5DOZA 2Y1GA 3WWYA 3UUWA 2EGHA 2W4QA 3HB4X 4MIEA 3D4PA 4WNCA 5LDGA 5JYEA 2UV8A 4E32A 1FF9A 4FJ0A 3W1VA 1CYDA 4UUOA 4CMAA 4ND5A 1GZ4A 5ADHA 3DZJA 5DN9A 4XYMB 2I65A 2LDBA 1PWZA 4YRAA 4RGBA 4BB6A 5JDIC 2SCUB 4O7WA 4CLEA 1DRUA 4J1QA 1E7QA 3QV1A 1I2CA 1I2BA 2CVZA 1DC5A 4A26A 4BO4A 1M6WA 3GHHA 2O4UX 4AJKA 2UAGA 2NUAB 1M67A 1R12A 2ZQZA 5TT1A 4BKOA 4DLBA 4JQCA 3WGOA 4ZOLF 2D8AA 3H6KA 4EG0A 3DZKA 5A9SB 3TF5A 5JAMA 1CQJB 1CDOA 4CM6A 1A4IA 4YAGA 4FDAA 3QWFA 3WGGA 3EUWA 1P77A 4B4UA 5HS4A 5LXTF 4XYEA 3VH4A 5JH7F 1Z74A 2C2XA 2NQTA 3A28A 3I5MA 5C1OA 5JE8A 3WGQA 4E5KA 1QYWA 2IE0A 3V2HA 4D43A 4ZA2A 2ZDQA 3U4DA 3NT4A 3K92A 2VZ0A 3NDRA 3D3WA 3EDMA 2DKNA 4ZRMA 2NU8B 3RU7A 1ZMTA 4L4XA 1P44A 4E5NA 2VTDA 5GZ3A 1GPDG 1M6HA 4IJUA 4L73A 4U0JA 4YR9A 3G8CA 4CQMD 2DTDA 4CM7A 3WJ7A 4D79A 2Y99A 2F1KA 7ADHA 2OHXA 3IKTA 1EEHA 5EINA 1NR7A 2CSUA 5DBFA 4GPD1 1GZ3A 4WLOA 3SVTA 4PG8A 5IZCA 3F5QA 4S3MA 1LSUA 2YYAA 1PS9A 2IDZA 3V2GA 3PFFA 3DBRB 1XQ1A 2B4RO 4LGVA 3TSCA 1XKQA 4FW8A 4XQEA 3DBHA 1MFZA 4O0LA 3JYLA 5B4VA 1ZXLA 2VRBA 1PJSA 1MXFA 3H2ZA 1V3UA 1LLQA 4J7CA 4WOJA 4YAJA 3X2FA 2HKIA 1VKZA 5KJEA 3VOTA 5C37A 5JY6A 3C8MA 1P33A 2Y1CA 3H5RA 4KOAA 3JQ8A 4TKLA 1ENOA 1R0LA 3KZVA 5B12A 5I7VA 3Q9UA 1IPEA 3DONA 3FWZA 4QSMA 4NJOA 1ZZEA 1F8FA 1GY8A 2EKQA 2WYOA 4GX2A 4MVJG 1UH5A 2AG5A 2OBYA 2X1HA 2ZTUA 4QTZA 3OA2A 1IOVA 1PQUA 4DIBA 4KQXA 3Q1LA 5G0WA 2DUUA 2Q99A 2QRJA 1LQUA 2GN9A 2NV6A 3OUUA 3I4FA 3LWBA 4IQGA 4RVGA 3SEFA 4GH5A 1Z2PX 1Y8QA 3N8DA 2AEMA 1R15A 1IUKA 2NSDA 1B6SA 4IIJF 1ISGA 4FIZA 1ZEMA 4Y98A 1R37A 4Z3KA 2F00A 2W6OA 4Y8VA 5FI5A 4FN4A 4CM4B 1NNUA 5CDGA 4ND3A 1T36A 3TN7A 1ZEJA 4EDFA 4Q3DA 1FK8A 4I5EA 3G1TA 2YQ4A 4KWHA 2C07A 4OGWA 4CMHA 2P91A 1PL6A 5IYZF 3PJGA 3FRJA 4IS3A 1UR5A 5JMWA 1DSSG 2XF8A 4KUGA 1GQ2A 4Q39A 4H7PA 4DPKA 4GX0A 4H3VA 3WDSA 1ISHA 1DIHA 4WNIA 1LSJA 1TB4A 3JQAD 1KBZA 3W4JA 2PGLA 5G4LA 2PFGA 1AUPA 2I76A 3OIDA 3FR8A 4PLWA 1P1FA 4C5AA 3ANLA 1Y1PA 3PHGA 1DRWA 3H65A 5TJ9A 1B8UA 1FDTA 2H1SA 4KUEA 3RAJA 2A9FA 5L9AA 3W4KA 2IYPA 1V3VA 1KS9A 2QYSA 2DQ4A 1NX6A 4O4LF 2HJRA 1A7AA 4PRKA 2Y05A 1OBGA 2EIHA 4CMIB 4GGPA 4U6SA 3RWBA 4Z9YA 1ZK0A 5T6BA 4PLTA 4E0BA 2CNVA 2PN1A 2HK8A 2VUTA 4R54A 4ZHSA 3ETEA 1EK5A 1CE8A 2FRDA 3JQGA 2PGJA 3K3PA 4OOEA 4BNJA 2D3TA 2GD1O 4TKMA 2IEDA 1E3WB 1UXKA 3FNEA 4RVUA 2PR2A 3H3FA 4LSWA 4MVJH 2AQKA 3LZ6A 4RF3A 1HWYA 2ZB3A 4ALJA 1DAPA 3TW6A 4BNLA 1LUAA 3FTPA 2DFDA 2Y0CA 3DHNA 3GEDA 4UUNA 5BQFA 4LMPA 1MG0A 3ZU2A 2HAEA 5C7LO 1P1HA 3RUEA 2Q1WA 4HY3A 4J4HA 3HSKA 3VDRA 1E7RA 3ZNNA 4RO0A 4K28A 4A27A 4Z6KA 4W99A 5EQDA 3P2OA 5LYJF 1NYTA 4RDIA 4YQZA 3DMYA 1EZ1A 3QIVA 4FOOA 1N7HA 4ALIA 3ZV3A 4CMBA 1R16A 2BHLA 3E5RA 1C0LA 3RC2A 4CQLB 1X13A 1K3TA 1E6UA 4NU5A 2B4QA 3DZGA 4YEDA 1SB9A 2I3AA 4KTVE 1KVSA 2HK7A 2YJZA 4YACA 1A7KA 1GQQA 1TT7A 3HN7A 3BG5A 1I3MA 1SCUA 4WCFC 1EYZA 3TIIA 2JD0A 2WE8A 4O7YA 2NNLD 4ZGWA 3ADPA 3PLRA 3VH2A 5G0UA 3GRPA 4BNZA 1OC2A 4EEZA 4XIJA 3EGOA 2I6TA 1EFKA 5KVQA 1E3LA 1LDBA 3IL2A 4E30A 1MLDA 3KSUA 3AUTA 3WQQA 1XG5A 2G76A 3E1KA 1QYDA 1G0NA 4BO6A 3WYEA 4E12A 4CM8A 2G5CA 2IXBA 1NVTA 2YHIA 1J49A 3AOEC 4GMFA 3NDIA 3M6IA 2UVDA 4EUFA 5JMPA 3LSYA 4FS3A 4NK5A 3KYDB 2ZYDA 3SBOA 4YAIA 4HNTA 4E4YA 5EESA 4EGFA 3TFOA 3DDNA 1P1RA 5A4DA 4W82A 4B4VA 4HNUA 2YV2A 2VHXA 3VPGA 3T4EA 2W2KA 1LI4A 4FD3A 4CLOB 3F9IA 1PZHA 3H8VA 3RV4A 1ZW1A 2NU9A 3KAJA 1PJLA 4UVDA 4FJ1A 4IDFA 3CPSA 1EZ4A 3NTRA 5CG1A 4MP6A 4BNTA 3I3OA 4GQAA 4A7PA 2HLPA 5EJ2A 2ZDHA 4I5GA 4QEDA 1N8KA 3EYWA 3U4CA 5TLSA 1BWSA 3I6IA 3S55A 4XGIA 3FNFA 3BHIA 5G0TA 5DDIP 1Y5MA 4LCEA 8ADHA 1K89A 4MV6A 3NKLA 1YB1A 5HV6A 4BO0A 1KVRA 1M76A 4O84A 1GUYA 1GYPA 4O6VA 1L7EA 1U5CA 2JHFA 1ULUA 4P38A 4XJSA 5I8WA 4HWKA 2NTNA 4NBWA 3E9NA 2WM3A 3KUXA 3ZZNA 4CODB 5A03A 5C7OO 2R00A 4IINA 1NPTO 3OIGA 3ABIA 1IYZA 4DREA 5BPHA 3G49A 2C20A 4II2A 2GZ2A 3GC6A 1P3DA 1YH3A 3BMCA 1V9LA 2Q4BA 3OETA 4LRSB 4BGVA 4CUKA 2XAAA 1KVTA 1YE3A 3H9JA 4OXYA 1K2WA 4CQMA 2VHWA 3GF4A 1XDWA 1BGVA 2I66A 1O95A 3WGZA 3U09A 2NVWA 3BMQA 4WUVA 5THQA 1VKOA 1EBFA 4YTEA 1MP0A 3MJEA 1U2GA 2C7GA 3WXBA 3BYZA 4FJ2A 2V5AA 1Z6ZA 4E33A 2Y93A 4O4IF 2FR1A 1DO8A 1PSDA 1DIGA 1OMOA 4IJKA
chains in the Genus database with same CATH superfamily
3P52A 2ZJ8A 2JZNA 2BL4A 2GPYA 4FU0A 5ERXA 1R6AA 4M86A 3ZU4A 4F4CA 4HDRA 5ICGA 4QXAA 3PJRA 2GBLA 2DUMA 4JBIA 4TRJA 2HFJA 3DTVD 1E1KA 3I72A 3DMDA 4K6FA 1SCAA 1SO8A 1X70A 1T4DA 4OBBA 3HYTA 2HL6A 2X15A 1JU3A 1ZMOA 2QP4A 2ZWMA 2FEKA 4ICIA 5G1PA 2NUTA 5JVLA 4EVRA 5LPNA 4XCQA 1C30A 4RY9A 5DW0A 3WIBA 3T6KA 5DMHA 3V7NA 4KIFA 1ACJA 3KRTA 5JXGA 5D1OB 2HW8A 2WVGA 4B3HA 2Q5OA 3EW7A 3KK0A 5CNKA 2JCXA 5LOVB 2QVLA 4DCTA 4C0BA 1HFEL 1L5ZA 2H5JA 2VC2B 2YZ7A 4JJ4A 3THWB 3L7LA 1QK5A 1KNQA 2WZQA 1E1LA 1RJWA 2FP4A 1X39A 3MJSA 4LJAA 2HH9A 1SCJA 2IT1A 1D03A 2WZBA 1LTKA 3B82A 4W8OA 4DDUA 5KTRA 2YJTD 2BR5A 4EHNA 3ZWBA 3AL2A 2LW7A 4U6QA 1EG2A 5PNTA 4A16A 2YJ4A 5CFMA 1VYUA 1EIZA 3X1ZA 1LK5A 3NASA 1SOUA 1Y37A 1N2EA 2HDOA 5HF5A 5I9LA 4KYTA 4C29A 4LBYA 5DSTA 1QB7A 3GNQA 5G3YA 3D8TA 4PFQA 4MR8B 4EA7A 1M2HA 3COYA 2BFNA 2IY9A 3SSMA 1VCOA 2EFYA 5BSTA 1RYYA 4IH1A 5EL0A 3TRIA 2PKXA 2BMFA 2ZIFA 3TZHA 3UCEA 1II0A 4UDNA 4F5EA 3IDSA 4EAQA 2EERA 1UPAA 2CVOA 4M8LA 3R7NA 2W2VA 5FYDA 4HLUC 3WSTA 4C0AC 4LOJA 5J43A 4JIGA 2EF0A 2PMFA 2WIFA 4ZOLA 1F12A 5FL3A 3EGDB 4HUQB 4DHEA 2W0MA 4R31A 4NAUA 1DZIA 4LKOA 3D4IA 1B00A 4WLEA 3RRBA 3AY0A 1ESMA 3HP4A 1NQUA 3QKUA 4LVOA 4WGGA 5EUMA 5J1TB 1MABB 1F2TA 4HADA 2WUDA 1JDJA 4OI4A 4QA9A 3WYCA 3BJRA 1T43A 4Y9DA 3IFSA 3T7CA 2C9CA 5JS7A 1XHLA 5EOVA 3SHVA 1G6KA 1EEXB 3EVAA 2VRWA 1EK2A 1Q0PA 2WD8A 4GOKA 4MVXA 3NXSA 2FSSA 2WAYA 3KC2A 4NABA 2BFFA 4KFSA 4DY4A 1TQ8A 3PQ7A 4RA6A 4KXUA 4NE7A 1JSZA 4N8SA 2XUDA 5IH3A 2FX5A 4GRIA 4MQ4A 4CKBB 1CK4A 5AJHA 4V3BA 5REQB 1HLPA 4UW9A 4JBXA 3TI9A 2ZZNA 2Q0HA 3U7IA 4CKYA 4GEGA 5L3SA 2ZRIA 4OP1A 3NHSA 1BU8A 1ZSNA 1JHOA 3BCSA 4Y1RB 4AJ9A 5IWCA 5KTKA 1WDWB 2I1WA 1P2FA 3E15A 1AGNA 3A6FA 4GW3A 5CDYA 1E60A 1Y1RA 3NM4A 1BMFA 2FMFA 5FDFA 1UWKA 2NXEA 2BTOA 5JADA 1NV8A 4OHKA 1RWKA 3ZDAA 1OWMA 3NWOA 3RHSA 2VQFB 2XUGA 3OJXA 4GYJA 4UFZA 1H1LB 2IS6A 1GQOA 4AZTA 3AO0B 2JCSA 3PC2A 3CVJA 4ZJPA 4H3KB 4JJKA 1AC5A 1XRNA 4GFDA 4BX9A 2OL4A 3UV3A 1A9SA 2I1QA 1TU3A 2XOKD 1SPBS 1T4GA 1UFVA 2IDMA 5FRDA 3I8OA 1A0GA 2Y9PB 3OQIB 3OJLA 3GJXB 1U94A 4NH4A 5FBWB 3CPEA 4OHUA 3W5SA 1R6VA 3QLUC 4EQZA 3FPLA 2XXJA 4BMOB 3OZBA 4EELA 2ZB7A 3WHLA 1TIKA 2PS3A 4H6XA 2D5CA 1SXIA 2P1ZA 3H5OA 2CDCA 3ZWWA 3VKUA 4G0VA 4WINA 1KYQA 3DB1A 5KDDA 2QMOA 3EEIA 1LSSA 3M6MD 1QQBA 4RF2A 5JYCA 1EX1A 2J5KA 4RMJA 1F17A 3N2GB 5BSUA 3DDWA 2R82A 3V1KA 4AIIA 1ZM2A 2MMGA 5AVOA 4P22A 3DAOA 4BAZA 1SXQA 4XCXA 4UM8B 1NW9B 3DE3X 4XPIB 4PPGA 3H1BA 2NPIA 3CNOA 3ZIUA 2ZB2A 2BGIA 2ZIVB 5DN6D 5JCJD 4FVTA 4OVKA 3DUFB 2JA2A 1P0QA 2IPOA 4NZNA 1Z6GA 3QUCA 4CV3A 2ZIXB 1Z8DA 3PGXA 4AY3A 2NVUA 4FYWA 3W2EA 4YJFA 2X8LA 4DQ0A 5HUJA 5I47A 2PGAA 3RUIA 2D2XA 2A9PA 4OQDA 4O7VA 1N2JA 1F60A 3HJAA 4PQYA 4TMTA 5A5EA 3GJ5A 1L1FA 3KWFA 4ZEMA 3KFXA 3IXQA 1JN0A 4JJ6A 2A1UA 1NMZA 5CH3A 5EUQB 1PNRA 3WO0A 2ZATA 4UDYX 1N33B 1UBSB 2P3QA 3C1TA 5E9AA 1NUHA 2VPPA 3PPIA 1KMMA 4ND8A 1U02A 1YIAA 3QJ5A 3QU2A 3UAOA 4BWGA 1WW8A 2GLXA 3BWBA 1VLQA 3G2QA 3MFQA 4MUEA 3MWGA 4QAQA 1NQTA 2V7EA 3CF4A 1YI8A 1LEHA 2FDXA 5AXAA 2MCFA 3PUWA 4TM7A 3HT5A 4HH1A 4YJ3F 1E2QA 3A9CA 4INJA 2YFHA 4MRMB 5ALTA 1GZ6A 2NQ8A 2GJ8A 2VH5R 1U7PA 3HRHA 2FPIB 3JARB 1U0LA 5I7RA 3S2GA 1H66A 1X1AA 1ECGA 1I1NA 2HADA 1BQEA 1ORDA 3CTMA 4UJ3A 4WXPA 4DJJA 1ML3A 1NW8A 2H2IA 5JSKA 1UMKA 4O4LA 4YRKA 1LVUA 4PQEA 4UHDA 3AKEA 5HF9A 2OZKA 4FHEA 4O8ZA 4C2AA 4OKSA 3PI6A 5AW0A 4EG3A 3NEPX 1PFWA 2P77A 2WFLB 2P7HA 3MMXA 1TU0A 3RS9A 4DMGA 4D5EA 3H9CA 1E2MA 5IUKC 4CEHA 4K9DA 1M34A 3U81A 1HFWA 3QBDA 5KQRA 1ULTA 2FW0A 1UZUA 4POOA 1NQWA 3FDXA 3FFAA 1UC9A 3RC8A 1NQXA 1SBYA 1W0CA 1BE0A 1ZA2A 4PWZA 3R7BA 1IN1A 1T1RA 3I05A 4EA8A 2X7HA 1UWCA 1XALA 1F2UA 2J6IA 3GJXC 4KI0A 2O2YA 3VTZA 3KPYA 2Y1XA 3K72B 3R9KA 3W78A 1SKBA 3KT0A 3OJEA 1PGOA 2QRLA 3SZMA 3SDBA 3LQFA 3UB4A 3G8AA 2AOVA 1U7HA 4GXTA 4WKNA 5G4KB 2I67A 1X3LA 3HCAA 4EFDA 3LLUA 2ZJZA 4WV3A 1N77A 5FEUA 1OAOA 3IAFA 3RV3A 3SDSA 3MTQA 1LW6E 3I64A 5LYJA 1CKNA 1CUYA 1QFSA 3G9TA 2C42A 3HDJA 4BGEA 1O94D 1Z2OX 4JQSA 1Y80A 3AJ8A 3F1LA 3PU6A 2QVXX 1IPHA 4JCCA 4MYCA 1UEIA 3Q8MA 3U4AA 1F6DA 1Z45A 2WJHA 2WYHA 2ZSHA 1LBEA 3L07A 1M0EA 1CXZA 3CRRA 1DKOA 5BMVF 3EQ2A 3ESDA 4FMPA 3ESCA 5DI3A 4BATA 1AF4A 3C6YA 3N58A 4ZZ2A 4B3BA 1W96A 2I62A 1ND5A 1QB8A 4MIOA 1CP3A 2FI1A 3G2JA 4QRDA 3CUWA 4YUYA 1P45A 5FWAA 3P0EA 3KZXA 3RQSA 5IAAA 2I54A 4DV1B 1MT0A 1WSBA 2DWCA 1GUFA 4YY3B 1R0XA 3N7UA 2IYWA 2R5FA 4L4ZA 3ZJ5A 1NRXA 1SU7A 5ALLA 1XRRA 2BBWA 1X86B 2AC4A 2YWBA 4EFMA 1NC1A 4HAVA 4MHOA 3A4YA 5K0SA 1NLMA 2CDAA 4ESOA 4R9SA 4UCVA 1G4AE 3TXYA 4IGKA 4TRNA 4E21A 3I76A 4EHFA 1RTTA 2I99A 2JEYA 5IANA 3OQMA 1NT4A 2XNDA 5FH9A 3G0CA 4ZO9A 5FFFA 1FMFA 3AUJB 3ZDRA 2FWRA 5DNUA 1ZGBA 3OURA 1L4HA 1ZRMA 2O20A 3ROMA 1RWBA 2DPYA 2FVYA 3PG5A 3STHA 3E9MA 3AF2A 4ILEA 4JDPA 3W1WA 1ZD1A 4W5HA 4BVGA 1T24A 1RQPA 1Z63A 1EDDA 3QWAA 3A0RB 3ECAA 1ZN9A 2AEFA 4RM2A 1PZGA 3IQXA 4EUEA 3SQLA 4B8YA 1WBJB 3C8ZA 3V1UA 1ANKA 1PE0A 1RYNA 2XNKA 5AOCA 4AM8A 4H7FA 3K9LA 3Q7PA 4PAMA 4D25A 1WSWA 4O4HF 2BDUA 4LBWA 4LZPA 5KX5F 2FEPA 3E0XA 1ZHOA 3HKEB 5G0SA 4A5OA 1C0PA 3HXQA 1YIOA 2CJWB 4FFBB 1B0UA 2NT3A 2WR8A 5CR9A 1N1GA 1KDOA 2OQVA 1FNSA 4DB2A 2OZLA 3SF0A 3ORQA 3F46A 4AF7A 2Q9BA 1FUIA 1X7YA 3U0VA 1ST3A 1O03A 1RCTE 3VTAA 4EECA 4TVIA 1DTEA 4F3TA 4XB2A 4JJ8A 4LYFA 3ABQB 4YLEA 3O03A 2A5LA 4CUZA 3MWYW 4U63A 1A2BA 1EX9A 3DFMA 5B1HA 4NKRA 4YCCA 4RTLA 1WX1A 1IMOA 1G21A 2A9RA 2AW5A 2NO1A 4OLFA 3UH0A 4EF6A 3AR6A 3R5HA 4GYKA 4JB8A 5F1KA 1QGOA 5F5NA 4BLUA 2PNJA 3W5DA 2WLSA 2N1BA 1CD5A 1RI3A 1W9MA 3K70B 4DIDA 2TMDA 2X19A 2C0CA 3KVRA 1ODKA 2DX7A 4MPJA 4U9IS 3JATA 1HNZB 1WPQA 4M55A 3ZR4B 5K8VA 4EYSA 3X1XA 4MQBA 3QEBZ 5BO5A 2GFHA 3COWA 2Q46A 2WC1A 2ENWA 5F33A 2WU4A 5KYUB 2FPPB 4MJLA 4F4IA 3V1YA 2I03A 2NO7A 3HBNA 1CU1A 1YS1X 1FX1A 1HUQA 1NYRA 1IM5A 2GZDA 1FYFA 3HEBA 5EJGA 4JX8A 2JGFA 2J45A 1I24A 2VXBA 3PDCA 2WVAA 2CXSA 4J6EA 5H3LA 2GUGA 2EJTA 1B8NA 1EA5A 3CHYA 2A35A 4ZGBA 1E1RA 1UAGA 1WDKA 4FSHA 2Q8PA 4D80A 5ADWA 3CVWA 4HVTA 2B1IA 1ILEA 1Z33A 5K4AA 3ODPA 2A58A 1UJBA 3ROFA 4F2WA 2QTNA 3RIEA 3LVBA 3B3AA 3LYHA 2JRCA 4GWKA 4D82A 3IEVA 1FRFS 1UT8A 3GG9A 3TKAA 5HCIA 1PEAA 2IBSA 1U0RA 3W06A 4G1FA 4X90A 3PHCA 1RHUA 1WETA 3E2IA 3O8LA 4MQFB 5E9JA 5I3ZA 1GG8A 4J0QA 1Y4AE 1L7AA 4TVOA 1I5RA 2PSSA 2VDMB 2O2DA 3RRJA 2IW1A 4LNAA 4BO3A 3VPXA 1RYMA 5JXJA 3HUEA 2QIOA 4G6ZA 2V7QA 1USVA 3P9QA 2NSHA 5DXJA 3ZYCA 3K9QO 2MIIA 4WASA 3T8YA 3BABA 3O1JC 1A5SB 3DO6A 4X61A 4BYGA 1EWRA 1HLDA 2ZYSA 3BILA 3OIWA 3I8SA 5AJXA 3BULA 2OGUA 3PQ3A 1P2BA 2X5JO 3JVEA 5EWLB 2P0EA 1T5LA 1AKTA 3OOJA 1EGHA 4Z7OB 4RIEA 4QDTA 3DFIA 2GTIA 5U4XA 1XDSA 3HVKA 3L7BA 2FPGA 5D3QA 8GPBA 1QRUA 5A5FA 4H15A 2XUJA 3ANXA 4WACA 1FFYA 2PUVA 1KO5A 3DV0B 3I83A 3WLKX 2VQDA 2XI4A 2PT5A 4HWSA 1JPUA 1RZUA 3M1AA 3SQNA 2YIDA 1QIKA 4ZO7A 4A0FA 1VLJA 2JFNA 5FAKA 1DBRA 4NCAA 1ENYA 1JGTA 3PWZA 2I2AA 3KU4A 2O8BB 3CLKA 2JJ8A 4JLNA 4AMVA 3SC2A 4OREX 5AW8A 1N4DA 2XCUA 3FOCA 3DF7A 5D87A 3LW8A 2L18A 3R7AA 4S1TA 1JJFA 1HMPA 3JQRA 3L4BA 3QELA 4GICA 1POWA 1V8FA 3UZUA 1RC0A 5KMGB 3JU3A 3PUXA 3T61A 1WCWA 1FLDA 3LFTA 1R0YA 3QX3A 4LSMA 3KKEA 2CCJA 3DKIA 2OQ2A 3CLHA 3KXDA 4MKRA 2GTPA 3H5VA 3F0TA 4HQ6A 4YJGB 4BDTA 4GRDA 4N49A 1KZGB 3D3JA 3K70C 2FWPA 4HEA6 1B16A 3SCZA 4L16A 3LC2O 4YRIA 1D3AA 5JS2A 4C89A 1Y9EA 4WZAA 3V46A 4JXXA 4WAUA 2KBFA 1SA0A 3HEAA 4YJ2F 1XK5A 1ZSYA 2ZULA 3ANYB 4CNQA 1D0SA 1TA9A 2IXDA 3TTXA 2WA1A 1WZ2A 5TQ2A 1GNSA 1Y34E 3GNSA 4UVIA 5CBPA 2VNKA 3BZUA 3T1QA 2RI0A 3AHDA 1KQPA 3KQTA 3KELA 1EESA 3DMNA 4C87A 1AZWA 4BUCA 2D5BA 1IH8A 5IP5A 4L8YA 4FMCF 2ZBRA 3LM8A 5CM9C 2QRHA 1IIRA 1R9MA 3EG9B 1CY1A 3ZDQA 4MUIA 1DELA 3FROA 4V1CB 1SCIA 4GX5A 3RT1A 4N82A 4JI8B 2QW8A 5GJWC 3UJ8A 1WXWA 4TMVA 3OMXA 1JLLB 5LP6A 1WCYA 3CU5A 4F9TA 4HQOA 5DTEA 3DZ8A 4NU8X 2G17A 1JXQA 4BAUA 3CLSC 4MCAA 5KWSA 1H3NA 2I2XB 2IY7A 1DDIA 3NI2A 4M36A 4R5HA 3X44A 1XD9A 1ATIA 9GPBA 5IF9A 3P2IA 3RYFA 3F8WA 4PHFA 3G59A 2W6IA 3HP7A 2A5DA 1IPFA 3SVZA 1BHJA 3O9VA 1XO1A 3UYLA 3ZV5A 5AVQA 1FTNA 4P3KA 3IPAA 3P0JA 4E2WA 4HBZA 3DP9A 1V5FA 4M0KA 3RVPA 4EJ0A 4G4SO 5HKKD 1U3UA 1U5BA 2Z4SA 4HZIA 4NBLA 4CGYA 2VT2A 1XZPA 3H42B 2IZ5A 2VF7A 1C1DB 1L3CA 1P7CA 3BK7A 2C5EA 3IJ5A 5SZHB 3GAAA 3RVOA 4TQAA 2Q2TA 4LRTB 4EYEA 1HE4A 1JHZA 4R71A 5KYTA 3LD9A 2WWRA 2XXBA 5EMJA 5JVDF 4Q6BA 4UCWA 3CRW1 3GR6A 4JGBA 1ABBA 1H4QA 2O52A 4JWTA 1ZNWA 4X1KB 4H7IA 5L53A 3QXXA 1L4BA 1VL5A 3IS3A 3WIEA 4UNSA 2OA0A 3RH0A 4BFYA 3L5KA 2XPCA 4TL8A 1RWNA 4ON9A 3MHTA 1AGPA 2I6FA 1UDWA 4LGCA 4AP6A 3PFGA 2GH1A 1THGA 3K1TA 1P8LA 4L2IB 4PR3A 5AQEA 4BFUA 4UBIA 1QO0A 2ZRDA 3MWFA 3DCIA 3OLVA 2BHTA 3SLKA 1ZINA 2OD7A 3C4QA 4HQ0A 1UJ6A 4MTLA 5CDFA 2XKJE 1XPUA 5CB0A 4FDMA 4ZVNA 3MILA 3ZLJA 2PZ8A 4B5KA 3PFBA 4FGJA 5CGQB 1M2VB 4B48A 5KNDH 5HXAA 4PYRA 1ZOIA 2EG9A 1R00A 2G67A 3AP2A 2W93A 5AVKA 4F6LA 3G79A 1ECJA 1KK0A 3L8HA 4PRYA 3N6RA 2NO9A 1XRLA 2BEVA 2WAAA 4TMYA 3KP1A 1GGFA 5DYWA 1H0RA 3A6PC 5ENVA 4R41A 4NBUA 2LBPA 5LQJA 1WXHA 4KQ2A 3TUJC 1EVIA 1OT5A 2CHUA 3BM5A 1PJ3A 2DB3A 3JD2A 5D2CA 3IIMA 1Y89A 3I3SR 2C4NA 4QOIA 3U13A 3W8RA 5AVRA 1TLTA 4DBVO 3TLGB 2YQ5A 2DFVA 1IDOA 4O81A 4BQPA 4BRWA 5CITA 1EFUA 2CLSA 1CUEA 3VU9A 1UDRA 1P5ZB 4PYOA 5IJ9B 1ULBA 1URPA 1OREA 2DSTA 4IRUB 2QJWA 1U31A 4JYCA 3E6AA 4HTAA 1VJCA 1RRFA 4MR9B 5DBGA 1G5PA 1A96A 1TKBA 4BKPA 2BE9A 2C77A 2ZUEA 3N8HA 1MC4A 2VF2A 2CB9A 3LK6A 1KKMA 3I45A 3EULA 1S3FA 3V55A 4HX9A 2IF0A 4E5MA 3AVXA 1K7CA 1T8TA 3ET4A 3MUNA 3DGFC 5ABPA 1ZWLA 5JBIA 3V8NA 3OOYA 2ZPTX 4OJQA 4UEKA 2GJKA 1NFQA 5CFRA 1SM4A 2X2EA 3PKZA 4ZVPA 5AT1A 1YK1A 3SHFA 1VGRA 4W1QA 5IM5A 4UAJA 3ROTA 3Q8KA 3CR7A 3ADOA 1CF2O 2WEKA 4O1HA 2Q5QA 1T8WA 4REQB 1H9BA 4V0RA 4ZANA 3CFYA 1EINA 3PGLA 1R5BA 2H4FA 4MGYR 1AH2A 2FB9A 3WHPA 4EYQA 5I7EA 3I42A 4NZ9A 4UXHA 5DT9A 3VRHA 2WMDA 3BTOA 1QIDA 5I4IA 1F38A 4K1LA 5BUQA 3MJCA 4P82A 2QX4A 4LZNA 1PJTA 5JS8A 3HR8A 4MTCA 3EVEA 2JNWA 4NC9A 3ZNOA 2I8AA 2QQ5A 4GECA 1YCHA 2Y1KA 4LTMA 4BY9E 3SR0A 3EPKA 2AQ8A 2PA3A 1ZOOA 2C5GA 1UAYA 3G7UA 4HDMA 4R1QA 2EF1A 3B1YA 1BVUA 1PNOA 4JBYA 2HMVA 4IVNA 2WJGA 3LF2A 4UBJA 3IPLA 3DHYA 3OPQA 5AKJA 4DLZA 1LZLA 3AVVA 4A6XA 1C4KA 1IY1A 5JAHA 4X00A 5ALJA 4AYXA 3CJTA 4EB6A 4UBMA 4AN0A 1RAIA 1PJQA 2BE7A 2FPOA 2NGRA 5AKHA 3O8QA 4L08A 2ZAOA 3GGSA 4ME6A 3FWKA 3F4BA 3N8KA 2BRUA 4ZV9A 2FZ4A 3ZTYA 3A6EA 4F91B 2FSVC 5JRZA 2AR0A 1JEYB 1UK9A 3DE7X 2JCVA 3A1FA 2P9FA 1GCGA 4CG3A 3E3MA 5CT5A 3C6MA 2B8TA 3UHOA 5H4GA 5L40A 2CJPA 1HQKA 2H5EA 1L7OA 2ODEA 2RH4A 2Y9MB 3C7KA 3DBHB 4M1OA 1D2HA 4M89A 4NDAA 4OHMA 5E9QA 3BGVA 2QD3A 3D2AA 1Y7LA 2OXTA 5EE0A 1GGJA 3DL2A 3G0DA 3I01A 2RK3A 4YAJB 3I92A 5L3ZA 1BDBA 1G6OA 2ZYGA 3LH5A 4XW2A 5U4QA 4CDMA 3VR6D 3GEBA 1WR2A 3VAAA 1V25A 2AX3A 4TXMA 2PZKA 3DT6A 2MJLA 2WKSA 1YL5A 1IG0A 4I3FA 5DT2A 3S8EA 1U90A 2XNHA 1LWNA 5E7JA 1KC1A 2QP3A 2HA3A 2ZUSA 2JASA 4H0FA 4XUDA 4WY8A 4C7JA 4QEKA 4RPKA 1QKKA 2WUGA 3IAS6 3R1IA 3DVAA 2C4UA 2YOGA 4KDFA 4J29A 1G18A 4O08A 2QJRA 3ESAA 4CLDA 2F48A 4DTIA 3SPXA 2J46A 3W34A 3BH0A 1RLOA 1PUXA 1TYDE 2HUNA 2W43A 3ZWDA 3AI2A 3EOAI 2JHCA 2YYZA 4WKOA 4BNFA 2H07A 4KQ6A 4QHYA 3OA0A 2BM0A 4BAGA 2QE7D 5H81A 1NOJA 3E2MA 3K1AA 1W34A 3BE6A 4KLZA 2V3WA 4DDTA 4GKJB 4LH6A 1DUSA 1KKLA 3C97A 4FC7A 4OFBA 4DBLE 3BWXA 3OF2A 4P53A 1C1XB 2B2CA 4RXUA 4HNVA 1XZAA 1U0OC 1MW9X 2RI6A 3ABZA 4JP3A 1XCLA 4FIDA 4PC2A 4XIYA 4B7AA 2PU7A 3GCXA 3FJYA 2K87A 4ZVVA 5IAKA 5AJVB 5FUQA 5EJFA 4ZVUA 4QNNA 5CNMA 3MS4A 4WBNA 2RIPA 2NN3C 3ENKA 3V4FA 1SZPA 5AUOB 4CTNA 4ED9A 1FDUA 1WW3A 2R8PA 3NRJA 2QA5A 4FYPA 4Q3BA 1MO4A 3UZOA 3K9CA 3P4YA 4U9UA 3WGIA 4AU1A 1W93A 2PX4A 3UJDA 1FW8A 2VJLA 1V0JA 3LC1O 2ZSKA 1BE1A 1HL7A 4J0IA 4KXVA 3UWDA 5ENZA 1E9AA 4N4AA 4HFJA 4U2GA 4Q82A 4X41A 2P5SA 1ISRA 4YALA 4CR8A 2AH5A 2E1PA 1OYWA 4P3OA 4O2RA 4KFCA 5F9FA 2EW2A 4JB3A 3DDCA 4K6MA 2YDXA 4UDOA 3UTDA 5LVAA 3B9PA 3PA8A 1AQUA 1EE9A 2QSYA 1V96A 3MJDA 5IZCC 2QXYA 4RZSA 3PIDA 3II6X 4G1VA 1GPMA 1H22A 4MMXB 3HB7A 4BV9A 2QROA 1KRXA 1V1RA 1I4EB 4AURA 1G9XA 2CXHA 2Y0EA 2VPQA 4A0SA 1OZ0A 3QEAZ 1Q0QA 2RAVA 4E6NA 3IALA 3OTHA 2R86A 4QL3A 2X0EA 1YASA 1TJ5A 5FBHA 4YV0A 3WWHA 3HCEA 4PYQA 1JDTA 1RC1A 3TSOA 5C52B 3T3GA 1QAOA 2BCJQ 2VQ3A 4KDEA 3R23A 3QFTA 5E0OA 1PGNA 2Q4RA 4ZZ1A 1G9SA 4RVSA 5J5CA 1JTFA 2ZJ1A 1BKYA 2PGIA 5DNCA 2JGJA 1RAFA 3NT5A 2AOUB 1SXJD 2RGDA 4I3HA 3LUHA 4P58A 5H68A 1VFPA 3IVCA 2H54A 2BWJA 2CNKA 2X14A 3WHKA 1TM5E 3GW8A 3CNEA 3KFVA 5MDHA 3GLQA 1E3SA 3TDMA 2ZAGA 3VM6A 2GN8A 1RHJA 2J3HA 3H11A 4DIFA 5EQTA 4Y6QA 3P26A 3PXDA 1G3IA 1Q19A 5K6TA 3CLVA 4G56A 4E2YA 1LS1A 3F5SA 2O2GA 1ZQ9A 3PQDA 5CVJA 3TCNA 1WEKA 3TDKA 3DOCA 5C9ZA 2BGKA 4ZAFA 1STOA 3IEUA 3Q2IA 3M4JA 3LFHA 1IEQA 2GA9A 1MB9A 1QP7A 2P6OA 2NZXA 4ACAA 5ARBA 4QZVA 1YD7A 2VXOA 1SB8A 3O84A 3SK0A 1WLSA 5IAOA 5BNTA 2WOJA 4CHIA 2DBVO 2HHAA 1PWYE 2DHQA 1WSAA 1O4VA 3HDHA 2CVHA 2CHQA 3EPRA 1HNXB 1UZNA 1PCXA 1IN6A 2A1HA 2IEIA 4ZI7A 3H75A 4TS9A 3K0EA 1YR9A 4P35A 4BQIA 1TPYA 1AK1A 2HSGA 3CUKA 4PLPA 3RT9A 1U04A 4HSEA 2WYUA 4JN6B 3UW1A 1R10A 4F45A 3QXJA 4X1IA 5CCDA 5KNDD 2DBRA 3BBLA 4CI9A 5CEJA 4FBMA 3IAHA 2ZRPA 3UHFA 3W5HA 2I78A 5JZBA 1XMJA 1P9WA 3AERA 2BI8A 1ORRA 5DP2A 5HQ3A 2Q41A 2ANBA 5FOQA 5A05A 4IIVA 1ZR4A 5L3VA 1EM6A 5MN5A 1I4OA 4DC0A 1KI2A 2IOQA 4YR7A 2OV1A 2EW8A 2PL3A 5HE9A 4RAOA 2Q5HA 2JAPA 2LWIA 2X8WA 3GZ4A 3OIUA 4P08A 4BKRA 4BV8A 2YV4A 3C3BA 2HCTA 2Q21A 1JDSA 2WBLC 3G8YA 3EW9A 4GMDA 4WLNA 2X7XA 3A3OA 3VNQA 4ZYZA 5K8LA 4FT2A 5KVCA 2AKEA 5C1DA 3R8XA 1Q17A 4Q4AA 2HB6A 4R51A 2YC4C 2P4SA 2WSMA 2XCSB 4QASA 3DC2A 3ZBQA 4P1ZA 4DEXA 3L4JA 2P7IA 3EZYA 5FCDA 3B6JA 2QLBA 3WRXC 4E22A 2MSKA 5T7BA 1VS0A 1X1RA 4QUEA 3WBFA 3T1HB 1YUMA 3BVPA 4B2IA 2F1OA 3FMFA 3PDIB 1HDXA 3QG1A 4XQ9A 4EHJA 3OUTA 4NK4A 5KI6A 4AO7A 1C7RA 1KZ1A 3AR2A 5KVSA 1NGSA 3AIOA 1WUKS 4KMMA 3TNLA 1MAUA 3N75A 5HM8A 4YAOA 3BQ9A 3UUEA 4MJXA 4PRLA 4I1VA 2PUWA 3WYBA 4N6NA 3ZKWA 4D41A 5K7SA 5MGBA 1CF4A 1PT7A 1EAYA 2VPTA 4JXUA 2IITA 3D64A 3IB3A 1KSHA 3E48A 5J4KA 1UM9A 3OCZA 1MEEA 1NNLA 2V74B 3QPWA 3G2PA 4FEGA 4XARA 5JZSA 1KEWA 1FRVA 1MOSA 1T2EA 3AZQA 3BMCB 5J1SB 1JMYA 1YA6A 4PZDA 4N9WA 4X7BA 3IUQA 4XWGA 3WISA 1ELOA 2H17A 2ZG6A 5LLTA 1UKYA 4ZCSA 3B13B 2QN7A 4X7MA 3RSLA 5FL7D 3LP5A 3B70A 3T3DA 1XI2A 3HL0A 1LBHA 1RPJA 3G1UA 3H97A 4XQCA 1E0DA 4BJ6A 1G4HA 3IR7A 2G80A 1GA4A 2XB9A 4KU4A 1HDRA 4XM0A 3RSCA 5J2TF 2YJ6A 4CQLA 4ZV7A 3N2ZB 4O63O 5IASA 1R8SA 3KYBA 3U7RA 1ZN7A 3O0TA 5C46F 2EKLA 3SC3A 1BAPA 4UCUA 1GPH1 4QUHA 3U3JA 4YUWA 2AMVA 2GNAA 4BTEA 2VKQA 1OBFO 1TM2A 2HXYA 1ECCA 3EZ6A 2COUA 1N32B 2YNMD 4YYZA 2C9ZA 4A6DA 3GBSA 4MQUA 3PXAA 4QJBA 2ZTHA 4U2KA 5K0NA 3ZIDA 3S99A 2BM8A 4TTAA 1DV2A 4RBNA 1T1IA 1LFDB 1DFIA 1OI3A 1SUDA 4NV3A 4A73A 3S2UA 1W19A 4PYMA 4U7FA 1KE2A 3TRFA 5KWVA 5BWUA 3NVKI 1YZUA 1TF7A 4N8DA 2G08A 4IKPA 1R0CA 3C5VA 2H51A 3B3GA 1PQWA 3ET5A 3GDGA 5DGTA 4RLSA 2FPSA 3UT5A 3IKJA 3N0TA 3KJZA 3FCAA 4HF7A 4X62B 1LPOA 1T1SA 2RG7A 1WQ3A 5H8WA 1NJ2A 5HWSA 5GOZA 3AR5A 1HYGA 1S1MA 4EM6A 3ZLVA 4IQ0A 5CCEA 2VAXA 2VYVD 1ADJA 3C98A 2GAFA 2PTHA 4Q3EA 5A4AA 4KBYA 5K8IA 2I2FA 4RM3A 4YIKA 3M83A 2RJOA 3SBEA 1ULSA 1T5SA 1G6Q1 4D1YA 1KDTA 3K9BA 1M6VA 1XQWA 2AD5A 3BH7A 4H1UA 4LYJA 4D9JA 5IPFA 4E13A 3DR5A 1IAQA 4L6IA 3AF1A 2JKVA 2NTJA 1JTVA 1UQRA 5DYNA 3VU8A 3VO2A 3WL5A 1YRBA 5TF4A 1AXGA 2IUSA 1PR9A 4HDQB 3ELWA 4RYLA 2XNSA 4MYSA 4F04A 3B3QA 3MSCA 2QM8A 2XQKA 3C16C 5C0OE 3W04A 3TQHA 5EXXA 3O90A 4O02B 2GPTA 1EUYA 3STTA 3GGOA 1H2HA 3IPYA 5LXTB 2GHQA 4DG9A 4L5AA 3AU9A 2QZPA 1QF7A 1QZTA 2JFYA 1I0LA 2R6HA 3P19A 2EP5A 5TF0A 3QX7A 2VDNB 3NHJA 3R40A 4FE2A 5AUQA 4F4UA 2EBHX 2X4IA 5K6AC 4GXNA 8OHMA 2ZR9A 3AYZB 2Y8EA 4KKXB 3E7WA 1LV8A 5EXSA 1RXUA 4MW1A 4FBGA 4OFXA 3TGWA 3N76A 4BP9A 3G7SA 2YOHA 2H1IA 5GONF 2PNFA 3NTLA 1NG9A 4WEQA 1G55A 3M34A 2OLJA 5FWXB 4YLGA 3HJNA 3UKJA 5MN4A 1RFGE 4K46A 5I5EA 4YH1A 3OM8A 2D62A 2XSZA 2Y67A 2XOKA 3AEKA 3OFJA 1NMYA 4GXRA 1KWGA 1XMOB 1C8KA 1FFCA 5FPYA 1OKKD 3EVGA 1OROA 1YXMA 1NQ5A 1XZIA 2P4QA 4UCQA 1UPCA 3ZHUA 4HUTA 221PA 4EI2A 1NNI1 5F1PA 5CA0F 2AHOA 4MCJA 3UKOA 2FPWA 3LXMA 3LQ1A 4G0WA 2QPLA 2YASA 2CJFA 3COJA 2B5VA 1RXEA 4EKEA 2HK9A 3EBOA 4IZHA 2ZLBA 4BV2A 4LA4A 1Q7EA 2DFTA 3QNUA 5I5GA 3RAEC 2WWHA 5KJCA 2EW1A 2DG2A 4B6JA 3H1AA 4CL3A 2AFRA 4OHXA 4L22A 3FDIA 3OEHA 1AXRA 2MSWA 4RL6A 2ZETA 5DN6A 4D9NA 5D1OA 5JCJA 3EODA 3QYPA 5E0KB 1CR4A 4DJEC 3Q1KA 3GRCA 1KFEB 3GQVA 4TZKA 2DUJA 1P29A 3PCTA 4LMBA 4II7A 4X91A 5AJUA 3ZLUA 3THWA 3PIIA 4RMNA 2IELA 5KNBA 4I19A 3T12A 5AO9A 1A5AB 1VPDA 3ZCXA 5BYBA 4IG9A 1FNCA 2AI3A 1M7GA 3W6UA 1A5ZA 5JC1A 1XIVA 3QTLA 3T4XA 3QEJA 2GYYA 3SEQA 2MR5A 4NESA 3FPCA 4QJ3A 2C88A 3LT4A 4IXDA 3B52X 2PVSA 3G2KA 3L8CA 1UWLA 3D6MA 4L4RA 1RYBA 3DQQA 2BJWA 4MWDA 4O2AA 4OXRA 4PC6A 1CSEE 2HLDD 2PZLA 3A1NA 1SIOA 2RE8A 2OECA 1ZVVA 4TTSA 4DCJA 2R6CA 3M6AA 4Q15A 1H4TA 1MAWA 1PR3A 2A5FA 4O7ZA 3EDCA 1SHJA 3HSYA 2P90A 4MR8A 4YMHA 2CV1A 4FFPA 4RSRA 4UPEA 4Q3AA 5ALGA 5CT8A 3KOUA 4OQZA 3D8HA 5KJ6A 4GI3A 2L19A 4D57A 3VPDA 3R9RA 3C1UA 4D9IA 3A3KA 2JLZA 1D1TA 3K0CA 4O3FA 2QJTA 2E4UA 3INGA 4Q4LA 4EJFA 3AFIA 4HWRA 1TAUA 4DA4A 1IEVA 1PAUA 1RQ2A 1Z28A 1XTZA 3UICA 2V0GA 4DXAA 5HKAA 4CCSA 3UMMA 1LRJA 2J30A 3EARA 2NU7B 3SE7A 2GBIA 3OOHA 3EGDA 4HUQA 2NP6A 2J4FA 3W8NA 5BWLA 4RQBA 1KHTA 3AM5A 2AYXA 4MUFA 3OZIA 5F5LA 5GQSA 4G25A 1VIDA 3AUYA 3EIXA 4LJRA 2XVAA 3WMWA 4O83A 3V6LA 1TM1E 4D0SA 1KORA 3P9CA