4FFOA

Pylc in complex with phosphorylated d-ornithine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
363
structure length
353
Chain Sequence
MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYGLEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVLKERFGAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase/reaction intermediate
molecule keywords PylC
total genus 118
structure length 353
sequence length 363
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ffoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ffoA01
4N5NA 2IEDA 4O81A 1C14A 3H9QA 1CRWG 4P22A 1EHIA 1HF3A 2BI8A 5F5LA 1NWCA 3ZN2A 4RDIA 5DOZA 4AJ4A 3ZGYA 1GQ2A 3NKLA 3VZPA 4E21A 1YL5A 1BW9A 4Z9YA 4L73A 4H15A 3GRPA 1VL8A 3F4BA 4ZQFA 3QFFA 3GLKA 3TIIA 3DQPA 5HA5A 4MVJA 5I7EA 2FR0A 4I5FA 3M2PA 3Q0EA 1GGOA 1J0XO 4O2AF 3PGJA 4O59O 4GX0A 4BO3A 4E13A 1GQYA 1YVEI 1JKJA 2VT2A 2DZDA 4MV7A 2HQ1A 1HE2A 2NU7A 1K5HA 4FJ2A 4J9UE 3EUWA 2Z95A 4EW6A 5HRUA 4DYVA 3PLNA 4BNZA 3WLFA 5HWSA 3QRWA 2F00A 4J4TA 4CMIB 1JLLA 1Y5MA 3K5HA 4O4LF 1N9GA 2QZ9A 4JROA 1GZ4A 4IQGA 1T1RA 5CHEA 3SJ7A 3E82A 1H6DA 3RROA 3K2EA 3CINA 1IY8A 3NJ8A 4HNHA 4LMRA 2VHZA 1GUYA 3RFCA 4RO0A 4XYMB 1XHLA 4M89A 4FJ0A 2VHYA 4RPLA 4L4SA 4BNLA 4YVFA 1BVUA 4UVDA 2CVZA 3DWFA 4H7PA 3FR7A 4XYEA 3TFQA 1C3VA 4PG5A 1RPNA 5TGDA 3GZNA 5LOVF 2DUWA 5T67A 3UFXA 4WBNF 4WLUA 3G0OA 2J5KA 1XWFA 3D1LA 3K8ZA 2YQ4A 4O6VA 3S2FA 3PWSA 2NWQA 2WEKA 4DREA 4ND2A 1V0JA 3A28A 4FDAA 2EJWA 4K28A 2ZDQA 5IZCA 2A92A 1VC2A 1ADGA 1MLDA 4Q3NA 1IYZA 1VKNA 1DRWA 5EPOA 3S1LA 3ST7A 1B8VA 3C1OA 4MVJP 3WMXA 4B4UA 2E82A 3NT5A 2EKPA 3E9MA 1CQJA 2B4TO 1UXIA 1VSVA 1IPEA 3WYBA 3DZIA 4WPGA 2DLNA 5BSEA 3D3EA 3VPGA 3L4SO 3DFZA 2QRLA 1E77A 4M87A 4O84A 2DU8A 2OFPA 4D41A 5KJCA 4DIMA 2NTJA 1OI7A 1G0OA 3MJVA 1MX3A 3KYCA 4I9HA 2FHSA 4I1IA 1NR7A 4XGIA 4CL3A 1IOWA 1GPDG 4BNTA 1NFRA 1VE9A 1A7AA 3ZV5A 4CQMD 1NQTA 2HO5A 4H16A 4QEDA 2Q1SA 3I6QA 3MJTA 3I5MA 3INTA 4FC6A 1E3IA 4N7RA 3C8MA 2AQKA 3RBZA 3ROPA 4ZGWA 5JVDF 2AW5A 3JZIA 1BW9B 3LZ6A 4NMHA 5BNTA 1H6AA 4E12A 1CF2O 2W6OA 4UULA 2DUUA 3Q9NA 1ARZA 3VTZA 1MXFA 4ZI7F 3ETGA 3GUYA 4JIGA 2YFHA 5JCJA 4AJIA 2ZDGA 4FFNA 4RF5A 1LEHA 2V58A 2PGDA 4L4RA 4A0SA 5JYDA 1PR9A 4GVXA 4BNFA 1PJ2A 1GU7A 1UP4A 3HQ4O 4W6ZA 5A06A 1GSOA 4AG3A 2QX7A 3VPHA 1NAIA 2BFMA 4XQGA 4AL4A 4EUHA 5TS3A 1MC4A 2XCLA 3EAGA 3EW7A 4OSPA 1NX6A 3IIEA 3JQDA 4GAEA 5JC1A 2BLLA 3WG9A 1Y1PA 4FS3A 3DBHB 4PN3A 3Q3CA 4J16A 1EUCB 4CLOA 3GF4A 4OIMA 2JHGA 2W2LA 3WGZA 5B1YA 1PJSA 2ZATA 3RUIA 2XAAA 3AX6A 4MKZA 4BB6A 1R66A 5I7SA 2V6BA 1TLTA 1HL3A 2VN8A 3E5RA 3Q1KA 1PGNA 4RDHA 5BNFA 1ENOA 3H2ZA 4GX2A 1DV1A 1GV0A 3C85A 3M1LA 3PFWO 4CR7A 3O26A 3H9EO 2POQX 3DC2A 2Y66A 3AU8A 2UUPA 3DXFA 1AGNA 3KHUA 3DONA 3WOHA 2VWHA 1TT5B 1X7GA 1CQIA 1GL3A 3AM5A 3LF1A 1UXJA 5KJ1A 4XR4A 2Q46A 1EFLA 4H3VA 4OJNA 4I50F 3ORQA 3I4FA 3ZWVA 4W7IA 3UCXA 1HDXA 1WXDA 2YZMA 2CDBA 3PJEA 4YT5A 3U49A 3V1YA 4WCFC 3JRWA 5IFLA 3LT2A 2O48X 3AOGA 3INRA 1KETA 2A9FA 4R68A 5AXBA 2ZB3A 4JP3A 1MB4A 5LCXA 5A1TA 4QT0A 3KYCB 3ZWCA 5JMWA 1JKFA 3PHJA 2P91A 4IXTA 4DQVA 1DRVA 4WCFB 1VJTA 2J3IA 1DIGA 3DBLB 3VOSA 4EDFA 5JCJD 1UP6A 2EW8A 4OGWA 3NRCA 2VT3A 2IRWA 4BNHA 2JL1A 1KJ9A 2VTEA 5C8YF 3GN1A 3I23A 1WLYA 4XIYA 4F45A 2NU6B 3K73O 3JYLA 3OBBA 3PJDA 2OP1A 1EUDB 3L0DA 2YV3A 4MP6A 4UUOA 2P9GA 4FPXA 1HT0A 4IGEA 3GIDA 3I12A 1CDOA 3W6ZA 3IC5A 2C20A 3RUHA 4I55F 2ZYDA 2Z1MA 3EZLA 5AYVA 3TZHA 4BGIA 4BO1A 3D3WB 4AFNA 5A4DA 1Z75A 5IZCC 3JTMA 5L9AA 1N8KA 3QVTA 5BNIA 1UUFA 3UKOA 5L3ZA 4CMEC 4E4TA 3KYDA 2V6FA 1D4FA 3MTGA 4BUCA 3VHRA 5ADHA 4FOSA 1BMDA 3W8DA 4R9RA 1NR1A 1PX0A 2P4QA 3G8DA 3FPLA 1TA4A 4B8WA 1ADBA 4WLOA 1PK8A 5GZ3A 2XOXA 3VPBA 2WWRA 3GFBA 3I83A 3O03A 5L45A 2FMUA 3MWEB 2RCYA 3G8CA 4R41A 1LBEA 3MJFA 1LSJA 2FPGB 3JYPA 4N54A 2PNFA 5EESA 2J3HA 5ILGA 4MVJF 4YAKB 3L77A 4R01A 2CVOA 5HS4A 1ZMTA 3DBVO 4CPDA 5IZ4A 3N74A 3ASVA 1XKQA 4TV8F 1PS9A 1YWGO 2DBVO 3PVZA 1SCUB 3FTPA 2YZ7A 1IHXA 3HNPA 1DFHA 3CTMA 3JD4A 2V5AA 5JDCA 2B69A 3EC7A 1XELA 3Q2IA 4IZHA 1XDWA 1HRDA 3UVEA 3OHSX 5BR7A 1FJHA 4MO2A 1E7YA 3HN2A 2B0JA 4LGVA 4PCVA 3AFNA 3HDQA 2C7VA 5DCUA 5LXTF 4O2BF 4PLYA 4CQMB 1C1XB 1Y6JA 1ZFNA 1WDLA 1LLCA 2E37A 5U9CA 3AY7A 3LC7O 4JXKA 2DBRA 3WMWA 4EEXA 3P2YA 5TIIA 2BFOA 1M2WA 2PD3A 5IJZA 2CF6A 3P19A 3WQQA 1DBVO 4U7WA 1Y7TA 1SPXA 2D1YA 2HMSA 1E3JA 4ZJUA 3BAZA 5G4KA 2O7SA 2EGGA 2HJRA 3HN7A 3O8QA 4R9SA 2YL2A 2GDZA 4QECA 1ZMOA 2B4QA 2UUOA 5JDIC 2O3JA 4MA0A 4HNTA 2PZJA 3FRJA 1PQUA 2VNSA 4QQRA 4E5MA 1JWBB 1HETA 4E33A 2JKVA 3ULKA 3MEQA 2HMWA 2HSDA 3AUTA 3H3FA 1QV7A 1WNTA 3AY3A 5IXYA 2WE7A 2ZCVA 4LVUA 1RM4A 2DTXA 1UDBA 2W71A 2CVQA 2R6JA 3C7AA 4I5GA 3BMCA 5F21A 1KJJA 1M6VA 2HGSA 2B35A 5DBIA 3OETA 1HTBA 4Z9XA 1U4SA 3DHNA 3A4VA 2QYSA 4J6FA 2RAFA 4JJFA 3EYWA 1FDUA 5F1KA 1RKXA 1BDMA 1CIVA 1U7TA 1HYHA 2YZNA 1E1MA 1E7RA 5EJ2A 3UICA 1TB4A 1GYQA 3AY6A 4R51A 1GEGA 5A9TA 3UF0A 2C2XA 1C30A 4P4GA 4CQLB 1L7EA 1ZK2A 1HKUA 4XQCA 4HNUA 1Z2OX 4N5MA 4B3IA 1EFKA 4ZOLF 3D5TA 4YAIA 2I87A 4XYMA 3L6OO 4P38A 1E4EB 1U1IA 1TT5A 3BTUA 3JD1A 3OFSA 3C1TA 2AQIA 3CZMA 5C7IO 3ZHYA 3BTSA 3VH4A 3PJGA 4A5OA 4J1SA 3ROQA 4E5YA 3N7UA 4I5EA 4E4YA 1IZ0A 2FP4A 5C7OO 4K26A 3PP8A 2V65A 3R5HA 1U5AA 3KOUA 3ETJA 5IN5A 4OAQA 1XLTA 4R1UA 1DDOA 1K6JA 4RQUA 3JQ7B 2I3AA 1KC1A 1PJ3A 3QWHA 3VH3A 1EMDA 5JO0A 3ORFA 3JQBC 1AHIA 5TJHA 2I5PO 1XU9A 4Q3CA 4XDZA 5IXSA 1JDJA 4BNGA 3VC7A 1LDYA 4IHJF 1NXQA 1V6AA 2O3TA 2GPSA 1DLIA 2NUAA 2R7KA 2OBNA 2VWPA 5JDCC 2DVMA 3WNVA 1C0PA 1P1IA 2I65A 2V6MA 4BQPA 5JQWA 2X5JO 2CNQA 1ZIDA 1LA2A 3RI3A 3Q6IA 4TQGA 4JJIA 4WLNA 1LUAA 1DJQA 1Q7GA 1WDKA 3E03A 1G0NA 2Q2VA 4PIVA 3MCVA 4GSKA 4YCAA 5G0TA 3PGXA 4HV4A 4PVCA 3DTTA 2H9IA 4IBOA 2OORA 1EEHA 1KEPA 3FBGA 1HZZA 8ADHA 3PWZA 4WKGA 4XYLB 1QR6A 4OMUA 2OO5A 2XPCA 4MIOA 3OUZA 1C0KA 5TX7A 1U8XX 2GUGA 4FD3A 4J4BA 4UUMA 4NJMA 1B14A 4YJ2F 5I7FA 2JFGA 3O8QB 5TQVA 1DAOA 2ZK7A 2XD4A 3L4BA 5BPHA 2C7GA 3DMYA 1IHYA 3ZW8A 4DWVA 3SC6A 5ITWA 3KSDO 2ZQZA 4PGFA 1KBZA 2BELA 2R87A 3D5QA 4E0BA 4O7RA 9LDTA 4YB8A 3BXXA 2JAHA 3VMMA 1M76A 3V5NA 2OMEA 4WJZA 1H2HA 4HFMA 1EBFA 4O7LA 3OP4A 4YTEA 4OQZA 4U8GA 3ITDA 2CDCA 1UXHA 1I30A 4AJNA 1X0XA 4WLEA 4CLEA 1NTOA 3ZH2A 3BG5A 1WAMA 2O3QA 2WYWA 4ITUA 1IL0A 3AFMA 2C29D 4Y8VB 2VHXA 3G17A 3WGHA 4QO8A 2W8ZA 3VVCA 3GHYA 3ANMA 1K0UA 2Y68A 1PJBA 2NU9B 5JNLA 2JCVA 4CM5A 3P5SA 3UUWA 1GZ3A 4QSHA 4RCVA 1P0FA 1PS0A 3OECA 4I8XA 1NPYA 4WEOA 4ZICA 3BA1A 1QXSA 2X5OA 3DHYA 2QIOA 3JSAA 1DIHA 2Y1EA 4JNKA 4ND3A 5A05A 4J7XA 4ZHSA 4R5MA 4X54A 5G4LA 2IXAA 4A73A 3BMQA 1P31A 1KVUA 1SB9A 2C5EA 1A71A 4HX5A 4UVGA 3DOOA 2ZTVA 1DC3A 4BNVA 3ZU5A 2Q4EA 4LCEA 4BQRA 3VOTA 4K6FA 1UXKA 4PZEA 4IGFA 3RBVA 3OH8A 4C7KA 4R54A 2AEMA 2DFDA 1W93A 1M67A 3IL2A 1I3MA 1H93A 2I9PA 2VRBA 1IE3A 4IQ8A 5H83A 3ZNNA 3ONDA 1D3AA 1SOVA 3QVXA 4ZD6A 2YV1A 3HDHA 4ZQEA 4L75A 2WSBA 1T25A 1GR0A 3TL2A 4BGEA 2PGJA 3VVBA 1R4NA 1JVSA 4KDFA 3G1TA 3WBFA 2FSSA 5F3RA 1WDMA 3GY0A 2HCTA 3KRTA 1ZKMA 2AQ8A 1Z45A 3QIVA 1DHTA 4YJGB 3CMCO 4DL9A 4IPTA 1YS4A 1A48A 1PWXA 2W2KB 4NHEA 2R7NA 3HBLA 2ZTMA 4G81A 3DBRA 3L9XA 1A4IA 2VR1A 3WGGA 2YZLA 1B15A 4NFSA 1SZJG 1VJ1A 4BVAA 4BL5A 1I0ZA 4XWYA 3JQGB 4R5HA 2WM3A 1UJMA 2D4AA 4KQWA 1I2CA 3QVOA 1EZ4A 4KMSA 5T8KA 1YL6A 4BOYA 3LP8A 5KKCA 4MP3A 5IAAA 3RD5A 1DIKA 3KAJA 2G82A 2J3JA 3DBHA 3NTQA 1F8FA 1CYDA 3FR8A 4MVJM 4BNKA 2GO1A 2JFFA 1JN0A 4ZQGA 4TVOA 3E18A 5GY7A 4O0LA 4CMEA 4YPOA 1I3LA 4D43A 3N8DA 2J3KA 4JK3A 5I9MA 3MTJA 4L76A 3NJ4A 2YY7A 4E2WA 3R5XA 1E7QA 1AN9A 3SBOA 1B3BA 1I5RA 2Y1GA 4DC1A 5L7WA 1T36A 4B7XA 1XG5A 3PXXA 4F6LA 5T57A 6ADHA 1Q0QA 2PKQO 3EGOA 3P7MA 4PG4A 2JHFA 4YT4A 2R84A 4WNCA 5L4SA 1VI2A 3RBXA 3SX2A 3ZDFA 2FRDA 1KVSA 3GEDA 1EZ1A 3WFIA 1XQ1A 3DAFA 2NM0A 3C7CB 1HDCA 3D4PA 4MVJG 2BRUA 5EIOA 1Y9EA 2ZTLA 3RUAA 3BHIA 4IMPA 4R16A 1EDOA 2YS7A 3T7CA 4Z3DA 1OZAA 3NYWA 4J4HA 4OXNA 1CE8A 3ZHBA 3GDOA 3AWDA 1VKZA 1D1SA 4L74A 3T7EA 5JAMA 5KNLA 4P4LA 1ADCA 2XXBA 4CUJA 2FPPB 5EN4A 3ICPA 3H2SA 4BV9A 3KEOA 4E5NA 4J7CA 3K2BA 5KJFA 2JD1A 3HB9A 2IP4A 5F5NA 5DCWA 5A9SB 3SVTA 2O2YA 2WTBA 1ONOA 4XQ9A 1BXGB 1W6UA 3RCBA 4BNWA 4GQAA 3E5MA 1Z82A 3NDIA 4ZA2A 5JSFA 5COBA 4ND4A 3ETEA 5EQDA 5DMXA 4A26A 1DC5A 4XYGA 3DR3A 5JO9A 3QVWA 3HSKA 1IZ9A 1A4UA 3PYMA 3VPCA 4NR0A 4F3YA 4OOFA 4LRTB 1P45A 4M9UA 4Y6RA 2Q99A 3GLQA 2O7QA 4GMFA 1EUDA 1B8UA 4UEJA 3KREA 4HUJA 3WWYA 2YHIA 3LT1A 4R4JA 4XQEA 2VCYA 4TRNA 3ENKA 4R1SA 2Q1TA 4UVEA 2NV6A 4DPLA 3HG7A 3V1UA 3ADPA 4TRMA 5G0UA 2VOEA 1GPJA 3WB9A 4RGBA 3RJ9A 5T8KC 1Z6ZA 4FGWA 3FPCA 4BKUA 4UAGA 1GSHA 2AE2A 1LQUA 4PFJA 4RPGA 2VWGA 4LN1A 1DJNA 5C37A 4D3SA 4ILKA 5TLSA 2BD0A 1LTHR 3DZBA 3F6YA 1LU9A 3LDHA 3STHA 3WGOA 3I3OA 4TSKA 2I76A 5K6AC 4KUGA 1AUVA 3FNEA 3PHHA 4KWHA 1PGJA 4CMHA 3MJ4A 4Y98A 1P44A 5IDYA 2RHRA 4PLGA 2W6MA 4WASA 5ILOA 4BNYA 4OXKA 2G1UA 1B6RA 1W96A 4HR7A 3OA0A 5CA0F 3CPSA 3FHLA 2HDHA 3S8MA 2GZ3A 2QW8A 2DLDA 5L40A 1N1EA 5FNVF 1R16A 2GASA 4Q3DA 1ULZA 4YBZA 2H5LA 4PLTA 1YH3A 2YYYA 3AUSA 3EHEA 3ANNA 3JQ8A 1DO8A 2EJVA 3HE3A 3L6DA 4JBHA 1UH5A 2AMFA 3D64A 3OIGA 3KXDA 1SEVA 3UGKA 3E6AA 1U7HA 3K5PA 3LU1A 1K3TA 3K6JA 1PX2A 5TF4A 4DIOA 5KOIA 2ZYAA 2G5CA 3AOEC 2GPTA 3Q2KA 1ULUA 1W4ZA 2NU6A 4INAA 4PLZA 2D59A 5I9LA 2OGUA 4CJXA 1O6ZA 2NU7B 1NASA 2VNAA 5ES3A 1B6SA 3OJ0A 4AJHA 5JCXA 1PR3A 1SMKA 5L51A 1KJ8A 1H6BA 1MC5A 1P0CA 3DL2A 1TI7A 5A02A 4QXMA 1NPTO 3NAQA 1VJ0A 1VL6A 1FDWA 2X7HA 3JQ8B 2YDXA 1JKIA 3OQBA 3Q11A 4ZHQF 3DF7A 3G49A 4IM7A 2IYPA 3LQFA 4B7UA 4ONEA 1AXGA 2DPHA 1WWKA 3DZJA 1ISJA 1EYZA 4BGVA 1V35A 1AE1A 1PJTA 3H6KA 5DP2A 3KLMX 3R0IA 2X23A 5AOVA 4M55A 3L6EA 4HWKA 5CAEB 5B4VA 4M1QA 4TMFA 3TOZA 5HBRB 3A06A 4K1LA 3TIGA 3CXRA 4IDGA 2HK7A 2PLAA 4R69A 1YB4A 5AVOA 3H5NA 2CFCA 4KQXA 5JY1A 2PN1A 1B8PA 2DT5A 2FPGA 1SEPA 3U9TA 5B4UA 2HJWA 4G65A 4IJVA 3LLSA 4TWRA 2GYYA 3TQTA 1SCUA 2NACA 3KAKA 2GGSA 3TZ6A 5AXDA 2C5AA 3DDNA 4UUPA 3V4SA 1YGYA 2W6PA 3EY4A 3WNZA 4E32A 1PZEA 1QLJA 4CL8A 2J9GA 3HZZA 5EZYF 4XYLA 2GN8A 1E7SA 1ZZEA 4GWKA 2YJZA 1F12A 1NFFA 4EYEA 3RKRA 5U1PA 4OOEA 4CUKA 3JYNA 4LK3A 1D1TA 3W4KA 2HRBA 1T2CA 4OKNA 2LDBA 4F6CA 2C59A 4GMGA 4D0RA 1OBGA 2BMAA 4PG6A 3WSWA 5I7VA 4MV6A 4TZKA 1ZSNA 1LDMA 2V7PA 4CR8A 1I3NA 1WW8A 1X0VA 4RZHA 4DIFA 1PJ4A 3HFSA 5G0SA 3MJEA 2Q2WA 3ADOA 4CUZA 3I1JA 2ZQYA 2WDZA 1GUZA 1X13A 3RUCA 4NK4A 1MUUA 2G76A 1O0SA 1JDBB 3U55A 1I24A 1RJWA 3JQAD 6LDHA 2FPPA 3CUKA 1T4BA 3JQFC 4QX6A 1Y9AA 4M86A 4W9NA 4B4VA 5LP6F 5CFZA 2NVUA 3H4VA 1BXGA 1MGOA 4AJPA 1NNUA 3U0BA 4BIIA 3B6ZA 1YBMA 2B37A 3GZNB 4YQZA 3GPIA 4II3A 2EV9A 1L1FA 4CM4B 5MDHA 3U5TA 2JAPA 5H80A 4JBGA 3AM3A 1OC2A 5KVQA 4DQXA 2BF7A 1YRLA 1DC6A 1HLDA 1U5CA 1W0CA 1OAAA 4BNNA 2C07A 1YQXA 1ZK4A 4CLRA 1ZK1A 2EGHA 1I7NA 3AM4A 3TDKA 1A72A 3QLJA 2I3GA 1UDAA 1ENPA 1J4AA 1P74A 4XGNA 4QFDA 1GZ6A 2O4UX 3ZWXA 4O7YA 1HDYA 1EVZA 5DCYA 1PZFA 2BFAA 4WCFA 1RWBA 2FZWA 2FB9A 4BO7A 4DUPA 3TZCA 2DFVA 3D7LA 1X1EA 3NDRA 3IAHA 4XZ3B 3BHMA 4FC7A 4UEOA 1Q1NA 3F1LA 2LDXA 2GERA 4EEZA 3HDYA 2GQRA 1SB8A 5JAZA 1LSUA 1RM3A 1A9ZA 5IDQA 4LRSB 3VA7A 1LI4A 5KVCA 3QY9A 5DBFA 5CAEA 3MOGA 4GBJA 3EVNA 2CZCA 2E6UX 2VYND 4HXYA 4MINA 3WDSA 1QRRA 3CEAA 4MV3A 3OA2A 1KY4A 5AQ1A 1JQBA 2AXQA 4NFYA 3I6IA 4BO2A 1KY5A 3QSGA 4UVHA 3B70A 4GGPA 4I9UA 4LMPA 4N18A 1NHWA 5GONF 2P5UA 1E3SA 1P9LA 4Z0TA 3ZWPA 1LC0A 4YJHA 5THQA 4G5HA 4EJ0A 3H8VA 4I08A 4DLAA 1WVGA 1SC6A 1XYGA 3F5SA 3PI7A 5L7YA 3JQGA 4DGSA 2AG5A 3KYDB 1UAGA 3DTYA 2E49A 3FWNA 2ZYGA 2UV8A 3LF2A 1TXGA 4HNVA 4OM8A 4PLHA 1WR2A 2EF1A 3IKVA 3VPXA 3WYEA 5CG1A 3P2OA 4KP7A 4WUVA 4EBFA 3BTOA 1XSEA 3V2UA 5L95A 3NT4A 1KEWA 5KTKA 2EHDA 5A5EA 3NUGA 3FI9A 2PH3A 5B12A 2IXBA 4MVJD 1KERA 4YA6A 2ET6A 4S1VA 4Z0PA 4PG8A 3IJPA 3WSVA 1KJQA 1ZSVA 2EP5A 3D4OA 3KB6A 2DTDA 2C00A 5ENVA 2YWVA 1P33A 2EEZA 4BO4A 3RFXA 3ZWAA 4MJLA 5HV6A 4E5PA 4TZTA 1ENYA 1YOVB 3F47A 4ZRNA 4I5DA 2RBEA 3ZHZA 4O7TA 4DIBA 1GAEO 1KEEA 3U3XA 1Q7CA 5EMHA 3GMDA 4TKLA 4DLLA 5EL0A 5JY6A 3NTRA 3AUUA 5A03A 1VBGA 2CMDA 1EVIA 3F5QA 3H9JA 2VRCD 1GDHA 3D3WA 3GDGA 4FB5A 4O83A 3GH3A 1H2BA 2PFGA 3IS3A 1JW9B 1AXEA 3FBTA 3VPFA 3OIFA 2CNVA 3GHHA 3MWDA 1AHHA 4RLHA 1A9XA 4I4TF 1D7OA 4II2A 1FMCA 2CNBA 4A27A 2PGLA 5I8WA 4CM9A 3IP1A 3RASA 1FF9A 4Q3BA 2VUUA 4I9NA 1WP4A 4ME6A 1EUZA 2QRKA 1EBUA 1JLLB 2I80A 2IZ0A 2X22A 3PWKA 5A5FA 4TV9F 4MVJH 2BKAA 5ICSA 1IULA 1WZIA 1E3LA 3NGLA 1ZK3A 3QA9A 2OXIA 1X7HA 1Q2XA 3BMCB 1SO8A 1CWUA 5L53A 4NBRA 1YKFA 2X9GA 4UVIA 5BQFA 5C1OA 3WIEA 3DAGA 4IDEA 3PDUA 3ZNOA 4QSMA 3IUPA 1DPGA 1ULSA 4CMBA 2PKRA 4WLFA 1PTJA 3WLEA 1O5IA 3ZV6A 3TNLA 2VYNA 3AI1A 5ER6A 3GEMA 4EITA 3WGIA 3ZWMA 4IZIA 1F17A 3GN2A 4ZRMA 1T2DA 1B7GO 3R6DA 4MIYA 4OL9A 3RWBA 2QRJA 3KALA 1ZJZA 1MA0A 1ZCJA 3PHGA 3GG9A 2PTGA 3UH1A 3ZU2A 1I01A 3MZ0A 3NEPX 3H7AA 2Y93A 1T2FA 3OMLA 2TMGA 2DAPA 5C3MA 5JW6A 4PG7A 3DB2A 1M75A 2VZ9A 4NDNE 5FYDA 1IPFA 2NVUB 2Y0DA 1JVBA 4CLOB 5IDXA 3MJCA 4HP8A 4R3WA 2VZ8A 4FW8A 4UUNA 4NPCA 1ZH8A 1ONPA 3GAFA 3G1UA 4YEDA 5THKA 1SAYA 4YAGA 2O50A 3F9IA 3R3JA 2C2YA 1EE2A 4NK5A 2PVPA 4D3FA 1N5DA 2EP7A 3ENNA 1Y8QA 5T5QA 2VRCA 3HB5X 3N58A 2W6QA 2WYUA 3FNHA 3ROKA 2PWZA 5GMOA 2VQDA 4R1NA 4B3HA 1BTOA 1GFSA 4WGGA 2ZTUA 1U3VA 1N9GB 2CY0A 1F06A 2NQTA 2W90A 2X5KO 4U6SA 4B3JA 4DPMA 1Q7BA 2OZPA 3ITKA 4CODB 2ZDHA 3GGOA 3W8FA 2YRXA 1I2ZA 2FN7A 3DEYX 4DVJA 4FFOA 3ZI0A 2R00C 4EGJA 1QG6A 5A3JA 1BSVA 4BO9A 2IZ1A 4YYZA 3U9LA 2NUAB 4MV8A 2DBZA 3RC1A 1YO6A 4IUYA 3U09A 3OF2A 4D46A 3G79A 3A9WA 3VDRA 2GN4A 3DHEA 3LT4A 4XRRA 3TPCA 3S2IA 3LC1O 1U3TA 1N2SA 3GVXA 4CMJA 1XU7A 2O23A 2NU8B 1HE5A 3C1AA 3VDQA 4FU0A 1LNQA 1O8CA 1E6UA 2FOIA 3VTFA 4M49A 4ALIA 1LRJA 4AJLA 1I33A 1YE3A 2X0NA 3C7DB 2H6EA 3Q9UA 3D4NA 3IP3A 1JWAB 2D2IA 4DYDA 3KETA 3GEGA 4GH5A 3ETHA 3MWDB 4CM7A 4IJWA 1A9YA 1EK6A 4XIJA 2W6ZA 4KZPA 1LSOA 3TQHA 2GN6A 2QG4A 2VHWA 1BHSA 1H0KA 3JQ9C 4U0JA 4J90A 5J2TF 4OSOA 3OEYA 3WICA 4XRGA 4IY1A 3T4EA 3ZWYA 3R1IA 1BG6A 1U3UA 4CLDA 5J2UF 2GNAA 3ZCXA 1RM0A 4ZQIA 1Z7BA 1JAXA 3ZWOA 2OBYA 4YAEA 2YUTA 4LCJA 4RPKA 1I3KA 3W1VA 2QK4A 3OUUA 3V8BA 2W2KA 1HZJA 1I36A 1LXCA 4E30A 3K5IA 4RJTA 2FR8A 2UYYA 4JP2A 4Y67A 4BMSA 1X15A 4BNIA 2D8AA 1E6EA 4FSHA 3V2HA 4NBWA 3WO0A 3RKUA 4D3DA 4O4IF 5FI5A 2XF8A 1CJCA 2OP0A 4FE2A 5C5IA 2R85A 2PR2A 3U4CA 1KEUA 1O95A 1PGOA 1I2BA 4L4XA 4Y9DA 1C0LA 1PWZA 2H1SA 1Z2PX 4IDBA 4GLOA 2O4CA 3FWZA 4IDFA 2PD6A 5F1OA 1ISGA 5TSDA 4DQUA 1O9BA 3KM0A 4W7HA 5COQA 2Y67A 4GX1A 2SCUA 2IYOA 2OUIA 5ER9A 3LK7A 1M6HA 3BMQB 4JQCA 4CM3A 4BKRA 4AJ1A 1ZBQA 3OM9A 3TW6A 5EQFA 4PLPA 2W70A 1VSUA 4BO8A 2Z02A 1MG5A 4DC0A 2O3RA 1MFZA 4BNXA 2R7LA 3LC2O 2HMVA 2Y99A 1HXHA 3AI2A 1PQWA 4MPDA 4R1TA 2YV2A 2I6TA 3WBBA 1B16A 4RVDA 1WZEA 2P9EA 3AU9A 1OC4A 3JQAB 3WXBA 4GVLA 4W82A 2FP4B 4DMLA 1QKIA 2R86A 1N92A 3ZU4A 3RC7A 2GZ1A 3IQDB 3QVSA 4BV8A 1DSSG 1U2GA 1VRWA 4URFA 1QYXA 1AUXA 4FR5A 4NQZA 4YRDA 3SLGA 4EGFA 3R9RA 1B26A 1GUFA 1XEAA 3CMMA 5G4KB 5CDSA 1KBLA 5IYZF 4C7JA 1Z2NX 2A4KA 4NI5A 5DULA 1LJ8A 2EXXA 3EK2A 3JD2A 4YJGA 3JD0A 2Z1NA 3QP9A 1R12A 1GV1A 3BZUA 1B0AA 3EZYA 3JRXA 3FNGA 3GC6A 3QV1A 4AJEA 2JD0A 4MDHA 4OQYA 2VTDA 4JCOA 4HFJA 4YDRA 4YQYA 3VH2A 1HYGA 4EUFA 4FFMA 2Q45A 3FSRA 3O38A 1KVRA 3R5FA 2QYTA 1E0DA 3JQ9A 4MVJI 4O7SA 1F8GA 3R3SA 1UR5A 4J0FA 3ROMA 2EKQA 1NHGA 3U4DA 4KTVE 1FK8A 2X0SA 3WGQA 4GKVA 2VYVA 2X86A 1Y5RA 2I99A 1EVYA 1JTVA 3VZQA 2QHXA 3QWAA 7ADHA 4D0SA 3WWZA 2W98A 3PRJA 4RVHA 1E6WA 2GD1O 4YXFA 4RLSA 3AK4A 1WMAA 1ZJYA 2B4RO 2R2GA 5CG2A 4KUEA 4FQ8A 3VH1A 1LSSA 4XB1A 3ZW9A 4J49A 3AUAA 1PL7A 4MIEA 4FFPA 4XJSA 4BNUA 3AI3A 1T26A 2PZMA 3JQEA 1V3TA 2WE8A 3HFGA 2PK3A 3CIFA 1DB3A 3OQ1A 4PLWA 2WMDA 3OICA 1C0IA 4Q9NA 4WK6A 4YT2A 1DV2A 1U28A 1UZLA 4DA9A 4D7AA 2HLPA 1NQAO 1BXRA 4O82A 4WECA 1YQGA 5CPBA 2B5VA 5FF9A 5T64A 1U4OA 5JAQA 5AXCA 3K30A 2HUNA 5LDHA 3IJRA 4RF3A 1H6CA 1I32A 4L9RA 3RU9A 1QYVA 1P1HA 1KVQA 3GNTA 1PU2A 5JFOA 3W6UA 1CERA 1W8DA 3QHAA 2Y1CA 4IMRA 3V4ZA 4ND5A 4GLLA 3WJ7A 4R3NA 2BGKA 4D44A 1FDVA 3B1KA 3RU7A 5BSFA 3MWEA 1QP8A 2W6NA 2DKNA 3KVOA 3Q1LA 3PYXA 1F0YA 1VPDA 4Q39A 2HK8A 1HYEA 1DIBA 1EDZA 3AJRA 3PQEA 2EWMA 2YDYA 5KIAA 1ISFA 3KO8A 3DOCA 1V9LA 2FSVA 2HU2A 2AEFA 1U9JA 1Y81A 1ENZA 2BFPA 3RUFA 3WTBA 4IDCA 3H9UA 3OJLA 4JN6B 4CM8B 2FZEA 4EUEA 1F14A 2EKLA 1JA9A 4RPHA 2JCXA 1KOLA 4MV1A 2PD4A 3H5AA 1E7MA 2BHLA 1R4MB 4XB2A 2PZKA 3UN1A 2J6IA 1UZMA 3K31A 2V6GA 5HBRA 2P5YA 5L7TA 1UP7A 2Q50A 4CQMA 3GG2A 3GVIA 3KUXA 3RUEA 1GLVA 2DBQA 2J5QA 2NADA 4DLKA 2NTVA 3L9WA 1XR3A 3L4BC 5EINA 3NV9A 1AUPA 1ZUD1 2GQSA 5COAA 5FFFA 3K92A 4W4TA 1E1LA 3LWBA 2G0TA 3JV7A 3NT2A 2NQ8A 5F1PA 1GSAA 2BI7A 4KDEA 1G6KA 1H5QA 2NU8A 3WGTA 1TT7A 3PPIA 4P4NA 1LX6A 4XDYA 1EQUA 3GDFA 1R37A 4G2NA 4OHUA 2PKQP 2Q4BA 1ZXLA 2J5RA 3IKTA 1BWSA 1HLPA 3GVCA 5K6AA 4UREA 3PEFA 2IZZA 1LDNA 3DMTC 2DIKA 3PDJA 3C3XA 1RYEA 4N5LA 2YYAA 5D8DA 3U9SA 4IZOA 2B36A 1UXGA 4TRJA 4KOAA 2NLOA 1BVRA 3FTNA 2HMUA 3I9KA 4TKMA 2WD8A 3WQSB 3PTZA 4BNMA 4O4HF 3E48A 4EJ6A 1P1KA 2IDZA 1W73A 1P1FA 3GOHA 3E1KA 1QMGA 2UVDA 1RM5A 2X6TA 3RC9A 3PK0A 1K6IA 4E3ZA 3I4CA 4YJ3F 1HSOA 3QWBA 3X2FA 4BB5A 4CM1A 1NM5A 1TEHA 4O86A 1VLLA 3AW9A 3F3SA 3V2GA 4O7WA 1FDSA 1MG0A 1T24A 1ZVMA 1LDEA 3LSYA 4IQ0A 3ONFA 3TINA 4HNGA 4J3FA 2WD7B 1DFIA 4PLVA 3INGA 3RIHA 1T2AA 4U5QA 4IDDA 2GSDA 1ZEMA 5TNXA 1B2LA 1FDTA 4ALNA 1C1DA 1YL7A 4Q3AA 4BO6A 4GSLA 1E3WB 1QV6A 2CUKA 4C4OA 5EERA 3HWRA 2AG8A 1XCBA 1VBHA 2I67A 3IMFA 3TRIA 1ID1A 4CM4A 4J2HA 3SC4A 3V1TC 2VUSA 2C82A 3JCZA 1NFQA 4YACA 2VUTA 3RC2A 2EERA 3N6RA 4Q3EA 1L7DA 4RZIA 4MKRA 1EVJA 2PH5A 3U4HA 4D42A 4PVDA 4WOJA 5JPIA 4GPD1 1EQ2A 1LQTA 1T1SA 2TMDA 4Z6KA 5CEEA 1UZNA 3D0OA 2IE0A 3F1KA 2GR9A 1Y8RA 4MV4A 4BS9A 3KLPX 1LLQA 2Y1OA 2FR1A 3JD3A 3UCEA 4BKQA 3BMOA 3B1FA 4O5OA 3HO8A 1DC4A 4HFRA 4BKOA 1T4DA 4RF4A 3RSHA 2YW9A 3HADA 2W2LD 3TZQA 4OH1A 3COSA 4FGSA 1U2DA 3FCOA 1BGVA 5A9RA 4GX5A 4S3MA 2NTNA 5CB4F 3PHLA 3CSDA 5G0WA 3S2GA 5K0ZA 1PJQA 5L4NA 1IUKA 3LT0A 3DZFA 1NBOA 2PBZA 1ML3A 1I8TA 1HDRA 4RVFA 1YB1A 4WNIA 2WYOA 5DDIP 3SEFA 5KCZA 4WEQA 1PL8A 2O3SA 2YHIB 5ICMA 2B5WA 3PZRA 1NP3A 3LLVA 4AJJA 4YT8A 5LA6F 4YRBA 4AJ2A 1E1NA 3FN4A 4J2OA 2VZ0A 4XD2A 4EG0A 4XJTA 1TVEA 2BH9A 1GCUA 2YZGA 1CETA 4FBGA 2AA3A 4J1NA 3C24A 3IDSA 4ND1A 2CZGA 3K3PA 1KVTA 1M6WA 3ZWNA 1K2WA 5H81A 2WYVA 4DBZA 1QORA 3BHJA 4CR6A 3GA0A 1K89A 5JS6A 3F46A 1PIWA 3PIDA 4XA8A 1PS8A 4YR9A 2A35A 4GI2A 3KSUA 4ROSA 1XIVA 1HWYA 2D5CA 3E9NA 3I9OA 1X1TA 1JKJB 2C0CA 5JYEA 2SCUB 4GL4A 2GRAA 2GF2A 3G3EA 2JD2A 4WE3A 2IEBA 4J9VA 1KC3A 3GFGA 2G17A 4FGRA 4K9DA 1PJCA 2X0RA 3WYCA 4HKTA 4CMIA 2Z5LA 2VWQA 4FFLA 2ZCUA 2OHXA 3O4RA 3TJRA 3DFUA 3WIDA 3WNQA 1D8AA 4NBVA 1PSDA 1ISMA 1KIFA 4XZ3A 1Z7EA 1CQIB 2GCGA 4RVGA 4IIJF 1BDBA 4J43A 4B7CA 2NVWA 2YFQA 4A2CA 1ZEJA 4J91A 3UW3A 3PIIA 5KVVA 5BSHA 5KKNB 3TFOA 2X9VA 4XX0B 3JQBA 2YRWA 2NSDA 7MDHA 2GLTA 2Y0EA 4AVYA 3IUSA 2YW2A 1BNCA 4DPKA 1N7GA 3PZBA 3A1NA 4EZBA 3VKVA 4NYEA 4DLBA 1Y8QB 4AJOA 2RIRA 4MKXA 1DIRA 1E1KA 3RFTA 4EI2A 4OXYA 4FOOA 2EW2A 5FEUA 1HE4A 3RUPA 3PQDA 4DXHA 1R15A 4FN4A 2Y0CA 3DMTA 5A04A 3S55A 3Q2OA 1PGPA 4NU5A 2J8ZA 3DZKA 3GMSA 4IS2A 4Y6SA 1A7KA 3I52A 4DRYA 3BMOB 4U6QA 1PQPA 2ZIZA 4JJGA 1CQJB 4HBGA 1MXHA 3BTVA 4KTTE 4CLHA 5K9ZA 1T2EA 3BMNB 3M6IA 5BPFA 3PQFA 5CDTA 1SNYA 2HMTA 2GLXA 1P3DA 3W8EA 5I9NA 3GQVA 2RH8A 4FFRA 3SXPA 3VZSA 1GD1O 1KC7A 1R0SA 2FWMX 1NYTA 1DXYA 4ESOA 4XEHA 4ALLA 1P1RA 1Q0LA 2X0JA 4NU6A 4YAJB 5CDGA 2X4GA 3SJUA 1E92A 1DLJA 1U8FO 3GGPA 4RPJA 3ZU3A 3JYQA 5CA1F 2WD7A 5JH7F 1VM6A 3GAZA 1YQDA 4L0QA 5KWEA 4ZQHA 4BO5A 3RV4A 3ETDA 1LC3A 3FD8A 3I9JA 1SBYA 4JLWA 4A03A 1S7CA 3ZNQA 2HRZA 2ZJ1A 3T4XA 2HKIA 1XA0A 5DF1A 1WPQA 3I9LA 5A9SA 1BXZA 4OKIA 5DNAA 1M66A 2DC1A 2NNLD 4NIMA 3BYZA 1KUTA 3EMKA 1XGKA 5IDWA 4MP8A 3VAZA 3B1JA 1ONNA 3WFJA 4J1TA 1GYPA 1Q0HA 3ZV4A 1E7WA 1P1JA 4TVBA 1UAYA 3OQ6A 1YXMA 3I9MA 4CV0A 2AHRA 4ID9A 4Y6PA 4HADA 1IOVA 4CMAA 3DOJA 3ABIA 4LSMA 4RF2A 3JYOA 2JCYA 2E48A 3GUCA 4NBTA 3GNSA 2D3TA 1JAYA 3WGYA 4QTZA 1NQ5A 3PJFA 4NBUA 5JE8A 2E4AA 2P4HX 1P77A 4JX8A 4BMNA 1C3OA 3OEWA 5TJ9A 2Q2QA 1EUCA 4E31A 3VPSA 4BO0A 3HJAA 2Q3EA 3SE7A 2Q1UA 4XX0A 4GKBA 5GZ1A 3M1AA 4IIUA 4U0KA 2ZB8A 4BNJA 4PZDA 4YWJA 4PRLA 4RL6A 1DAPA 3TN7A 3WR5A 2UDPA 1R0LA 3PLRA 4M54A 4TROA 1I10A 3EDMA 4Z3KA 5IG2A 5H82A 2R82A 2X0IA 4GGOA 5KJEA 4CV1A 4DTIA 2Z04A 4GWGA 5IN4A 4MA5A 4Z0HO 4BKPA 1HE3A 2PY6A 5CDUA 3U54A 3JQAA 1G1AA 1N1GA 3CZRA 4RQTA 4YRAA 4FIZA 1V8BA 3KV3O 2GN9A 1N7HA 1HDZA 1SOWA 2VOJA 5B37A 3WQRA 3TOXA 2H63A 3KBOA 1X7DA 2QF7A 1YBAA 3WO1A 3K96A 5LDGA 1O89A 2R00A 1OMOA 5HTOA 1HDGO 1GEEA 4K6CA 4ZU3A 3OJFA 3QE3A 3HUDA 4CQLA 3VKUA 1ADFA 5A3VA 4YJHB 5LC1A 3LYLA 3DAPA 3E9QA 2Y1DA 3DZGA 4J1QA 2AE1A 4RORA 4W9NC 3M2TA 3TZKA 5DOVA 2Q1WA 3QWFA 2VPQA 2OL4A 3TF5A 2PV7A 2IODA 2BGMA 4C5BA 2VQ3A 3H9GA 4IINA 5FI3A 4O4JF 5TT0A 2O2SA 3ZNPA 4A7PA 3CKYA 5DP1A 5KVSA 3MOIA 1VKOA 1NWHA 5BT9A 5CEFA 1RYDA 5IF3A 3L07A 9LDBA 1DOHA 4BHTA 2VHVA 4HY3A 5KKAA 2CNUA 1YJQA 3GK3A 4IDAA 2RHCA 4DBVO 1R4NB 2A94A 3RFVA 3E5NA 4PLCA 2CF5A 2DPGA 1HSZA 1M0WA 2AEJA 1ZK0A 3WX0A 5FWNA 1M0TA 3GNQA 3RV3A 1J6UA 2DQ4A 5DN9A 2FY8A 5JMPA 4B4OA 3FNFA 4IIVA 1YB5A 4WOKA 5I8ZA 5HM8A 3PHIA 1K6XA 2V59A 3JQ7A 2O3UA 1B3RA 1FXSA 1NVMB 1QLHA 2NVBA 1X14A 2DWCA 1E5LA 1GY8A 3X2EA 4RV9A 1C1DB 4M8SA 3WS7A 3TL3A 4AJKA 5CDYA 4YJFB 4F46A 3UFXB 4NJOA 1YDWA 3BMNA 2NU9A 5JVLA 3SLKA 1A27A 1QYWA 4RVUA 4RZQA 1QSGA 3ONEA 4IS3A 3RUDA 3W4IA 1DIAA 4ALKA 4CLXA 2ZKLA 3TWOA 4AICA 5JC8A 1MV8A 2BGLA 4XCVA 1QYCA 4L1KA 2WJPA 3KSZO 2CSUA 2YS6A 1GQQA 2HAEA 4LW8A 4WCDA 3NGXA 3DBLA 4HFNA 5B4TA 1CS0A 3NTOA 3ON5A 3R23A 3UHAA 1CEQA 1IB6A 2P9CA 3GGGA 4BMVA 2UAGA 1Y8RB 4XYBA 1ORRA 3WTCA 4QFCA 2GZ2A 2X58A 4CMCA 5LYJF 2W4QA 3F4LA 1ISHA 4OYRA 3H5RA 1LLDA 8LDHA 1KS9A 4C5AA 2DM6A 2DTEA 3LVFO 3UAGA 3ZV3A 5ITVA 3KEQA 2XXJA 4W99A 4O7NA 3QQPA 3E8XA 1EK5A 1LDGA 1QYDA 5JXWA 2HK9A 3O9ZA 4PLFA 1V3VA 3OJOA 4A10A 4XGKA 5JAIA 2QZZA 3HHPA 4D45A 4BGUA 3FF4A 4YB8B 3ZWBA 3H3JA 3JQCA 3RVDA 2CD9A 3KZVA 4E2ZA 5TRTA 1LRLA 3KTDA 1V3UA 5CEJA 5J23A 4ZQBA 5JQGF 2C54A 1YOVA 2HJSA 3A14A 3HB4X 4IJUA 1PJLA 1YJ8A 3MJSA 5TC4A 1MFPA 2X9NA 3GVPA 3IOYA 4NH4A 4E6PA 1PEDA 1GTMA 1PZGA 4CV3A 4HQ6A 1J5PA 1ZSYA 1PL6A 3I9NA 1UDCA 3GVHA 3AOEA 4NNJA 3ZZNA 4CM9D 4MV9A 1Z74A 2GPWA 4YBZB 4TUYF 3HDJA 1H94A 3DZHA 4MOWA 4IJKA 4OO3A 5L4LA 1PGQA 1ZW1A 3OJEA 5KX5F 2OLSA 2ZJ0A 3CE6A 3PFFA 1KYQA 4CMGA 4NZ9A 3GT0A 3W4JA 1GCOA 5MGBA 2X8LA 3UOGA 1NPDA 1E5QA 2YQ5A 4YAKA 1J49A 1BRMA 3GR6A 3NX4A 4CM6A 1OOEA 2ZB7A 4Z9FA 4L8VA 1GADO 3GZ4A 4IXWA 1DHRA 4NFHA 4PRKA 5DZSA 4RVSA 5G2OA 3NUAA 1KEVA 2YHUA 5AXAA 3K9QO 3ZWWA 2F1KA 4O7VA 5JBIA 3ICCA 4E2YA 2RH4A 1NAHA 5ENDA 3QJ5A 2I66A 2OOSA 2X1HA 1YBVA 2EIHA 1ZNQO 1A5ZA 3GRKA 4C5CA 3OSUA 4JGBA 4ZVVA 3UCFA 3ZHXA 4KWIA 2JJYA 4ALMA 1H9AA 2Y05A 1Z73A 4NJMB 2EG9A 5C1PA 4B8ZA 3DO5A 4DMMA 3UXYA 1OBFO 3EVTA 4WLVA 2Y1FA 5BSGA 4MVJE 2Q49A 3JQ6A 3S2EA 5C7LO 4CLRB 2FPIA 4YJFA 1NVGA 3KYBA 2D5AA 4EJMA 3NDJA 4CM8A 1I7LA 4B4WA 3RJ5A 5JDIA 3ANLA 2CDAA 1ZXBA 3B20A 4XKJA 3H65A 5JLAA 3OIDA 5TT1A 5DBGA 5DT9A 1DFGA 1LRKA 1DRUA 5BMVF 2I8CA 1E3EA 1R6DA 1OBDA 5GZ6A 1R4MA 1H9BA 1XQ6A 2PZLA 4E2XA 3DBRB 4TRRA 5HS6A 4CMKA 2VYVD 3QWIA 1OFGA 3ASUA 4JBIA 2QQ5A 5U4QA 1WMBA 2P0AA 1E3WA 3PYLA 4D79A 4O63O 3JZFA 4QUKA 1BXKA 2ZB4A 5KJ6A 4Y8VA 4O1MA 4ALJA 4O7ZA 3WJAA 1MP0A 2FPIB 4EGQA 1GYRA 3BIOA 4FCCA 3U62A 1KJIA 5G0VA 2R7MA 1IOLA 1R0KA 4CV2A 1NVTA 3ORRA 3CH6A 4P8RA 2ILTA 1VL0A 4LSWA 3AW8A 4MAMA 2P2SA 3GPDG 1YDEA 1S6YA 4ZN6A 4YAJA 1PZHA 4XR9A 2AQHA 3U4IA 3RQSA 4YJDA 1DEHA 1HDOA 2PA3A 1ZO8A 1NQOA 4FJ1A 2JFHA 1E4EA 1ISIA 1O94A 1HEUA 4QO7A 4NG5A 4J7UA 4B79A 3JQFA 1JDEA 3TSCA 1JU9A 1EE9A 1U3WA 2D0IA 3VZRA 4UEKA 5T6BA 3QW2A 2B83A 1YONA 4PZCA 5CPFA 3RAJA 4LVCA 1LLUA 4LISA 4J0EA 5CP8A 2P68A 1LDBA 1C1XA 4E5KA 4KUHA
chains in the Genus database with same CATH superfamily
3ZY4A 2FUG1 4O81A 2PKWA 4OHYA 3H9QA 3TXAA 4CG1A 1B6TA 1EHIA 1HF3A 2BI8A 4YX9A 4QPPA 3A25A 4PSAA 3RRFA 2PUFA 1NWCA 3ZTTA 3ZN2A 5BOVA 1YKSA 4AJ4A 2CXPA 3ZGYA 2CNNA 4E07A 3KXKA 5JUWA 1VL5A 1ZI6A 2HSZA 3NKLA 3VZPA 3B9RA 1GZUA 4ZCPA 3VKWA 1KNXA 3K0FB 4A6DA 2DABA 5AVWA 3U40A 3W3AH 5HQTA 2DQKA 2CJPA 1TZCA 2CB9A 5F52A 2GAAA 2WP8J 3OQIA 1YQ9A 2YWHA 3ZHVA 4ZQFA 1FSSA 1QB8A 4BEBA 2MINA 1SXJC 4UXJA 4XLTA 4KIJA 3TIIA 3IELA 3DEZA 2QD1A 4Q9DA 5AOAA 1PR6A 4I5FA 5I9TA 4OAPA 2IHZA 1CZRA 1GGOA 2Q3BA 3P2MA 3B7WA 1U0NA 2AFVA 1GQYA 2VPYA 2XVAA 4C1BA 1YVEI 4EKEA 1JKJA 3EMVA 4DV3B 1L4NA 4P93A 2IYWA 4MV7A 1JXAA 1HE2A 2CWWA 2NU7A 2P11A 1K5HA 3JZ6A 1Q74A 1RFLA 3A4YA 1JPVA 3E3OA 3EUWA 3NQ41 1BFKA 3SLRA 4HN9A 3TKAA 1E2GA 3VJMA 4DIDA 2VNHA 1J8DA 4ZT4A 3QRWA 4BNZA 2XGJA 3FHOA 3KX2A 4U3JB 4J4TA 4RV5A 4WK0B 3BCUA 4FFBA 5HKLA 4MQFB 1GZ4A 4IQGA 3QKRA 2LCFA 2WTAA 5ALKA 1CZHA 5EKXA 5HGXA 3K2EA 4LMRA 4HNHA 1RZRD 1BIFA 3INYA 4N82A 1GUYA 3RFCA 1Z0FA 2EX0A 1D6JA 2O0JA 2WAXA 4L4SA 1O97C 2YWJA 4YVFA 2QY9A 4WZBE 1A97A 3DWFA 4ZAWA 1AA6A 4GPEA 3TFQA 1C3VA 1WA5A 1Z34A 2ZSHA 1JQJC 2DPLA 4G56A 4I4TB 3DL4A 5AVKA 3N70A 3Q41A 5T67A 3RWMB 2E21A 3FTDA 1H3FA 1YZFA 3R5SA 1L6RA 1XWFA 2QS9A 4HDSB 2YQ4A 4IKEA 4O6VA 4YECA 3SXUB 2C4UA 1XNJA 4C4TA 4JLKA 3MS7A 1GGFA 4MAAA 2NOAA 3GJ0A 5D3MB 1BC5A 1JZSA 4FDAA 3ME5A 4R8KA 2MSNA 5G02A 2FQ1A 2I3ZA 4D82A 4DANA 2ZRCA 5IZCA 2PX8A 3CZCA 2QM0A 3VSDA 2AOXA 1VKNA 2OXRA 2WKQA 1DRWA 3EPPA 2IY9A 3PDIA 1CJKC 4U39A 5EPOA 3S1LA 3C1OA 4CWAA 1B0UA 3T41A 2ZJ2A 2E82A 2H8KA 1OFIA 3RRYA 1U1CA 2B4TO 3MCTA 1YAHA 1DKOA 1LK5A 3KEGA 3DZIA 2C5HA 2DLNA 3OD5A 4E46A 4WNYA 5BSEA 5JHHB 1MX5A 5JS7A 3JYHA 1L5ZA 4J0GA 4M87A 1L5YA 3P52A 3UMFA 4D41A 1EA7A 4DIMA 3KQPA 4PTYA 1HZZC 3WHKA 4DNPA 1OI7A 4M0PA 3V1NA 4JBYA 1P80A 3PX7A 4V2IA 4FSXA 1Z16A 3ESRA 4JR0A 3UYKA 3KKNA 2VYFA 3ZKAA 4E7PA 1NR7A 3M70A 2I3DA 3P0RA 4QL3A 1ODFA 1GG5A 1GR1A 2REQA 3EDYA 1BWPA 1XTRA 4CL3A 2D0DA 3NASA 4BNTA 2A9QA 4CQMD 5K03A 1RPTA 2P2CA 1E9DA 1TUGA 3U37A 4QASA 1SXHA 2KSQA 3MJTA 1NR5A 2ZYWX 3W8RA 2C0PA 1FNCA 4N7RA 3WLHA 2G77B 2YN4A 5E9JA 2B1IA 4YS6A 1VFNA 1X1SA 3QNMA 4C89A 4HGQA 3Q8LA 1LBIA 2VHQA 5BNTA 3K05A 4M7WA 3DE6X 1KO1A 1JEQA 1DWOA 3FZYA 4LOAA 1ULBA 1IWOA 3F7TA 3M1YA 3WHPA 5IBCA 1MXFA 4KO3S 5JI3E 3BULA 3DC7A 4XPIA 3GRAA 1AMOA 3ETGA 4PNHA 4JIGA 2HWXA 2WIBA 4Q7LA 4KNVA 2HCBA 2Q5LA 4AJIA 1G8KA 1CX9B 2FSIA 2I3BA 3SHWA 4C3UA 5K0BA 2ZDGA 4FFNA 1XRMA 2AJCA 2JGAA 2VDJA 2V58A 5E0OA 3WIOA 4EFNA 2DF8A 2PGDA 2H4JA 5EHZA 1ESMA 1CS4C 3RVNA 1Z0DA 1K98A 4W6ZA 4HLDA 5A06A 5LQUA 1XDSA 3H4IA 5CFNA 2QX7A 3KHTA 3NAZA 4XQGA 3R0QA 5ALOA 3IJ5A 3VR4D 4LC1A 5K4HA 4DDMA 1MC4A 4EH1A 1U3CA 3OIVA 1NN0A 1H3NA 4CCAA 4UTVA 1VP9A 1JLSA 4PZPA 3GZJA 1NNSA 2WNIA 4JUBA 3EDRA 5EJ9A 3BA6A 4F8EA 1L5WA 4RV4A 5JTUA 1EUCB 2O1EA 4FQ5A 1GRNA 2EYQA 3WGZA 4C7XA 1VIMA 4U8HA 4UPEA 1HE1C 3OEED 3I53A 5IMBA 2VF8A 2XAAA 4FD2A 4MKZA 3MAJA 1TLTA 2O5RA 3D0QA 3H3XA 1NVDA 4CRWB 4Z7OB 4FFWA 4K03A 1JZTA 4RDHA 2CXSA 5BNFA 4GX2A 3H2ZA 1Y8ZA 3KNZA 2KPOA 5DGCA 2XLCA 2XSZD 3IQIX 4F96A 5DYYA 2SHKA 1FRQA 5IS2A 1RWMA 3UMYA 3O26A 16PKA 3N2GA 4ZYLA 3LX8A 2O14A 4JUCA 3HBMA 4HLUC 4Q18A 3L6UA 4DMCA 3IVGA 3VQTA 1TAUA 3COVA 3AU8A 4CG2A 1H0SA 1DBSA 3WOHA 4B46A 3HVHA 1X7GA 1MN6A 2C3OA 1ZZGA 3D6JA 1QH8A 1CQIA 3EA5A 5KYYA 1HG1A 1EG7A 2E7ZA 2F3RA 4X7BA 1V1MB 2C03A 1EFVA 3VISA 3ZX4A 1UXJA 1T0HB 1N32B 3CCFA 4OJNA 4H3VA 1IZZA 2NUPB 1JKXA 4M1EA 4ROTA 4A36A 3T4PA 5K0TA 4KE7A 1IXSB 3GZTB 2YZMA 5K6TA 3T0IA 2ZU0C 2FW9A 4DCCA 4PFSA 4F5WA 5HRUA 1E63A 3QVVA 1LCIA 3JRWA 3LT2A 5EMKA 2ZBRA 2CNLA 1S3FA 2A9FA 3A31A 4BLQA 1R64A 2Z8ZA 1F60A 3VVLA 4C0HA 2GETA 4ZEXA 2ZYSA 5BYBA 1F6BA 4TS9A 1QO7A 1QG0A 1DIGA 4EDFA 2E1PA 5CB4A 2PUJA 4OGWA 4XB6B 4LOKA 4DCUA 1W36C 5EI5A 1T0UA 4LC0A 3OQOA 3CNNA 3UGTA 2JL1A 2I78A 2QR5A 3FPHA 3OIUA 5DEIA 2HTEA 1LVGA 2IYYA 3IPXA 3A1WA 4JVMA 5HE8A 3O92A 3I4LA 4N8DA 1DWQA 1TZJA 4XOIA 2GM9A 4JYZA 4DN6A 2YUIA 5E2AA 3K73O 5DK4A 5B2FA 3PJDA 1GM5A 1UMDA 5EE9A 4UUOA 2IXFA 3QYFA 4PTLA 3SM3A 4F93B 2CFOA 4IGEA 4Z7QB 1G7RA 2BMDA 2YVLA 3HKCB 3RUHA 2ZYDA 3JQPA 4Q48A 2WW8A 1Q1QA 1HLGA 5AH0A 3EZ9A 4P7GA 3K94A 1JH9A 4UU1A 1PJRA 4CF5A 3JTMA 2VUHB 3Q87B 3QFCA 1N8KA 3R0JA 1HQKA 4F4CA 2R5NA 5L3ZA 1ZVJA 2QY6A 2IYRA 1I4TD 1MOSA 1RHRA 1MJFA 1D4FA 1XVIA 2V6FA 3MTGA 1X19A 2XMBA 1UQUA 5BWUA 1Y63A 3W8DA 1NR1A 1T1EA 1SOUA 4NU8X 4S1OA 3MMPA 3G8DA 2VG8A 3HSYA 5FFMA 1ADBA 4WLOA 1ND6A 5GZ3A 3NZEA 2WWRA 4BVLA 5KEIA 3O03A 2CMHA 5KZMB 1NY6A 1Q57A 3K4QA 3HPQA 2WUWE 4M0CA 2FMUA 3ZZUA 5K8JB 5BSMA 2J5BA 2ZYRA 4F2GA 4R41A 2BTOA 3ANTA 1YHYA 1SRRA 5FEMA 1J9EA 1CR4A 3BZWA 1CFJA 5EESA 3JYPA 4JOQA 4N54A 5CJPA 5ILGA 3P2KA 4ZO8A 3USCS 1G64A 2QR2A 4CCYA 1P29A 1JLRA 4R01A 2CVOA 5HS4A 5BQOA 1N77A 5IZ4A 3N74A 4R81A 3DKIA 1J5XA 3EEBA 4TV8F 1I4OA 2O7NA 1I7QB 4FCWA 3TLMA 3BN3A 4MI9A 2ZRLA 1RJDA 2I29A 1IHXA 5L6LB 4MCHA 2BZGA 4OHFA 3T6KA 3CTMA 1FW8A 2LBPA 1UDRA 2GXAA 2VXOA 2IYVA 5AJUA 1HL7A 4EYOA 2PL1A 2ZJAA 3ESCA 1E7YA 3HN2A 2C4KA 3ECCA 2BEVA 3IIIA 5EHIA 2XNDD 2DWPA 3FUWA 3G02A 4O2BF 3LFUA 1SUBA 2B94A 3PE6A 1JSZA 3W9YA 5C2JB 1Y34E 3L02A 5CCBA 1AQIA 2DULA 4DM7A 3GEPA 5E4YA 4RACA 4B74A 2GLUA 2NUPA 4HYTA 4KKVA 5IYZB 3P2YA 3NHBA 4JSTA 2QKYA 2P3SA 5IJZA 1DBVO 4U7WA 1Y7TA 1SPXA 2Z5VA 2WHXA 2YWBA 3TI9A 3B1XA 4DIUA 5JAOA 4RTLA 2XNHA 3JVUA 4AF8A 4JXUA 4HDCA 2YJ3A 4UJ3A 2O7SA 1A95A 3COJA 1RJEA 4CGZA 3PGA1 4QECA 1Y4DE 2Q3LA 3GJ6A 1ZMOA 2VAWA 5CW1A 2VBIA 1DELA 2UUOA 2Q2TA 1JDNA 3O2JA 4MA0A 4HNTA 1NMSA 3HCFA 1RWXA 4E5MA 3WYAA 3LUBA 1JWBB 2ZRDA 1VIAA 2JKVA 4E33A 2JLUA 1S96A 2ZR7A 4NCXA 3D6AA 1WD5A 3AY3A 4GP6A 2AX3A 1HOTA 4NCIA 2XITA 2IX9A 5FOXA 4FGKA 1UDBA 2DTXA 2W71A 4I5GA 1IN5A 2CL5A 1BA2A 1O97D 1Y89A 3OETA 1QQAA 3CWCA 3EDQA 3WV5A 4K6KA 2GXQA 3DHNA 4WNAB 4UKDA 3RIXA 1GTG1 3A4VA 5HF6A 2FVXA 2RAUA 1L7OA 3CEBA 3ACDA 3MT0A 3FPBA 5FA8A 1RKXA 2Y0PA 5EHXA 3WLQA 1UOEA 1CJMA 2A86A 3KR0A 1OTYA 4WKCA 1E7RA 3B85A 3LP6A 4Z8XA 4BEJA 5HVNA 3MCUA 1GYQA 1Z5WA 1SBCA 2WIGA 4P4GA 3REQB 4B33A 5EIHA 5I9SA 2W37A 3EFBA 3S1AB 1QTQA 4TMVA 3ROXA 2D4HA 1N2GA 4HDKB 1EFKA 3ZXIA 1HDEA 1PZNA 2FSHA 4UOQA 3DWIA 5GV7A 2JCGA 3WKAA 4J0QA 3NXKA 5IAKA 5BORA 1YVPA 2B7LA 5G1PA 1U1IA 2HVQA 1UBUS 3PFHA 4RETA 5IX8A 2A0WA 2AQIA 4FBMA 4B82A 4Z4IA 3ZHYA 4B75A 4FMCB 1R5BA 3PC8C 2UVPB 3S4YA 3T0FA 4CG3A 1LX7A 4E5YA 2PUWA 1JSLA 1A88A 2WU0A 4LI3X 2QEQA 3HP4A 3EDCA 3ANYB 4L9AA 4E4YA 5TMPA 1B23P 1DU4A 5BUCA 2OZLB 1U5AA 3LKBA 4FUQA 4LX8A 2VATA 3KOUA 4RSHA 1V2HE 2YWDA 2ZE5A 1ZGBA 1TQ6A 1TA0A 5A6VA 1U2SA 2R1TB 1FX0A 4YJGA 1PJ3A 1RLMA 5JNWA 4XAQA 5LOVA 3E81A 3FWYA 3THWA 2KI5A 3KG2A 4BXOB 1JDJA 1Q1ZA 3N2EA 3H5VA 4G0PA 4JJ6A 4IHJF 2VWPA 4WHMA 2YOHA 5T3YA 2NUAA 2H59A 1TDJA 2BHSA 3NPMA 4JBWA 3WNVA 2HVSA 1YR9A 1KDVA 2E6KA 1XEWX 2DWOA 4X71A 5JQWA 1GGNA 4DUYB 4LXYA 1F8XA 1VG8A 4IVPA 4MMXB 3Q6IA 3QMVA 4C0QC 4GLJA 3K0SA 4WLNA 4PWYA 2H2IA 1FDRA 4IIHA 1CZLA 1PD1A 1G0NA 1P4GA 3E05A 1ZAKA 1JMYA 2OR3A 4WN3A 5G0TA 1BE1A 1G291 3PGXA 2IF2A 1WDWB 5DRYA 2I4RA 2QT9A 4IDPA 4YPVA 1I4LD 2OORA 3K1AB 2WABA 3ZY2A 1UKVY 1BYUA 3P9QA 2N47A 5KSWB 1SKBA 1QR6A 1WXXA 5J4YA 4K9OA 2XPCA 3OUZA 1C0KA 2FWPA 3R0ZA 1FUYB 4FD3A 5E2IA 5E6SB 3NGMA 4C43A 2CKDA 1B14A 2FPRA 2OBXA 3CLVA 2ZUDA 3TPZA 1HYQA 1Q6ZA 2WIDA 1DAOA 4ZK2A 3L6CA 3G5TA 4G1BA 4N9QA 3L4BA 4YV0A 1FTQA 5BPHA 1FCJA 2LV8A 3TUZC 4HUQB 4OQXA 3ZW8A 1C9MA 3A4MA 3PPYA 5ITWA 3NFYA 2QJRA 8ATCA 3L46A 5FIUA 3SP1A 2HIGA 4NCNA 1QFSA 2RKBA 3ZE6A 2BELA 3T15A 3WLJA 2JH3A 3WK9A 4O7RA 4KUHA 4E0BA 4X90A 3U7JA 2OLKA 4TS4A 5JWRA 3GJTA 2OMEA 5LKRA 1A04A 4QU9A 3WADA 1EBFA 2ZI7A 4O7LA 3OP4A 3VGJA 1SG0A 2V7WA 3LE8A 3R3VA 4F8JA 1F7VA 5B3LA 1SHUX 4OQZA 4TYMA 4U8GA 2XNKA 2B0CA 1ZI9A 1X7XA 1X1RA 3I34X 4ZP1A 5TDHA 3WGMA 5AHRA 4WLEA 2H1HA 821PA 3DM9B 1D6SA 5CH3A 1OFVA 1IVYA 3BXPA 4G97A 1E2BA 2WYWA 3TD9A 1F3OA 4F72A 2P6UA 1N2EA 5LZ7A 2J4CA 3FUVA 3PL1A 4U7GA 2R1VA 1EFUA 4QO8A 2J9ZB 4LFBB 1AM4D 1M2OB 2NSHA 3GHYA 2DFKB 3VVCA 4NMLA 2HIVA 3ANMA 3NYQA 3A7DA 3OY2A 3EFOB 3T3IA 2Y68A 3OQJA 3OOJA 4NE9A 3LA8A 2JCVA 3TSZA 3O9VA 4CQJA 2BFEA 3N7TA 3UUWA 1BVYF 4WZBB 3CSSA 2MSEB 3T34A 1T5LA 2ENUA 4WEOA 1CQZA 1NPYA 2CBXA 2IW1A 4BU0A 4ZICA 1QXSA 1EKPA 4G37A 3PFCA 3QOWA 1A7UA 4MPJA 3ZG6A 3ZH9B 3DHYA 3NHMA 5HNEA 2CGEA 2QIOA 4BAZA 4LBYA 4I99A 3FTEA 4ND3A 4B0PA 4FZ3A 4IKOA 3S2SA 4I1UA 1NRWA 5F12A 2H65A 2H2AA 3KTAB 2B20A 3UOWA 4RWEA 2EP8A 1EGHA 1KVUA 2R44A 1A71A 1A9TA 1O58A 3TKYA 3CRNA 3DOOA 3ZDEA 1DC3A 4BNVA 5IXJA 1J0AA 2ORWA 4JYAB 2VXCA 4N12A 3AG5A 1Q84A 2ODEA 4WY2A 1CR1A 4BVEA 1U0LA 2ZAYA 3RVRA 4K9QA 1W93A 1T3HA 1MO3A 2P62A 3ORSA 5PGMA 3RG2A 5LB4A 3IL2A 3L1UA 1FUIA 1I3MA 2I9PA 2IZOA 2VA8A 1IE3A 2ZRMA 4PAWA 5H83A 5I4BA 5I7WA 3ONDA 1D3AA 4FYMA 1SOVA 2VDLB 4JI3B 1KDOA 3HDHA 4RY0A 1DMSA 2WSBA 5AM0A 1GR0A 2GM3A 3VVBA 1R4NA 4MPRA 2CCJA 1JVSA 4EHJA 3B9BA 2FETA 5KWSA 2J1LA 4R6WA 3SXUA 3N8NA 5G3ZA 3R6LA 3P9RA 2BGTA 3AR7A 4BBAA 4LGYA 1FTGA 1NBHA 1YE8A 1NN1A 1UIRA 2OCAA 2WSYB 1Z45A 3HU1A 2YC4C 3UV3A 4C2TA 3UWPA 4NL4H 1EX6A 2R9VA 1JBEA 3WLNA 3P20A 3ZS8A 2MTBA 2W2KB 4ERNA 2R7NA 3HBLA 2V9CA 4G81A 5AVTA 2P1DA 4F0JA 1CIJA 3MUNA 3KZ1E 2B7CA 2I6QA 4HBZA 1RXVA 2CXUA 4CKWB 4NFSA 4TTIA 4GKKB 4GPTA 1JJAA 4AW9A 1YHZA 4GOXA 4BL5A 2H4HA 3RRXA 2I7DA 4RK6A 1F4PA 1JIKA 1UKYA 1V41E 3DV0A 1WABA 1Z33A 4BLRA 2WKSA 5CITA 1UJCA 1OA1A 3GA5A 3ZS9A 3MD0A 5JADA 1G60A 3R20A 4HQFA 4Y2RA 2OK7A 1YL6A 3QKIA 2YIDA 3O1IC 1I9CA 5FUBA 3T5MA 1DPFA 5IAAA 3E22B 2PS9A 3DBHA 1CYDA 5HF5A 4MVJM 3FH0A 2Q41A 4HL6A 2GO1A 3VNRA 1BDJA 1CC1S 2JFFA 1NMQA 3ELDA 2B4KA 4ZQGA 5JT1A 1OH7A 1O95C 2B25A 1RWOA 2AZ4A 4AY2A 2FFQA 4YWHA 3UJNA 1I3LA 2FUNB 4G8BA 3LHKA 4Q9AA 4RVNA 3N8DA 1FVHA 2DR0A 3OEHD 3TQCA 1N5LA 2Q1XA 2FMXA 3H1FA 4OGLA 2RKOA 4M8NE 6ADHA 5T57A 1W5EA 1COWD 2PKQO 3OKCA 2GHTA 3PDCA 5CM9C 4YT4A 2QPOA 4WNCA 3AF4A 2GXSA 3EF3A 3MTQA 5CDFA 4AXBA 5C1BA 3NDPA 5T7BA 5EVJA 3LUJA 1DO0A 3GEDA 4YJ2A 1NQWA 4FYYA 4JLUA 3WFIA 4EJSB 3E3NA 4WJLA 3CW2A 2KBFA 2BMEA 5EIOA 2W6CX 2IWHA 5B1EA 5GOTA 2PL3A 2ZTLA 4TMXA 1G3MA 3RUAA 4RPIA 3KKZA 4G8DA 3S0JA 2DUMA 3LWDA 4UM8B 4R16A 4AURA 4FYKA 4LF4B 1YI8A 3H18A 3QOXA 1YR1A 4GKAA 4X1KB 4Z2AA 3NYWA 1ZL0A 2HVRA 3WY9A 3QXSA 4L50A 1C9KA 1Y6GA 1VJRA 2D2FA 1TVCA 1D1SA 3FCAA 1KYYA 2GNPA 3GDOA 4B0OA 1XTUA 5JAMA 2BISA 3RQIA 3LUCA 2FPPB 2WUDA 3IKLA 4YMWA 2FQWA 1O2DA 2EBFX 2J59A 3I58A 5FOTA 4E5NA 2GF9A 3QLUA 3OKAA 4Z4QA 1AQLA 3HB9A 2IP4A 4AZWA 1ZC4A 4EKIA 3IT3A 4TYQA 1ONOA 5BQ5A 4WK2B 4UBIA 4DR1B 1XF9A 1Q91A 3P26A 4TKUB 4K1XA 2IWRA 2H18A 1SUFA 5JAPA 1VMIA 5I9IA 10MHA 3ANXA 3G9UA 4JA0A 1UKEA 3DB1A 3PYMA 1T8WA 2BGNA 3VPCA 4IJMA 2HU8A 2ZW9A 4LE2A 2QGFA 4CI0B 4AB1A 1S4MA 3G0BA 1P45A 2Q7XA 3GWZA 3W6PA 2EZ4A 4M9UA 1KJYA 2Q99A 4Y6RA 2O7QA 3GB8B 1MH9A 1B8UA 3KREA 3GGJA 4KN8A 1N2OA 1KHTA 2YHIA 5EOVA 1FU4A 2IA5A 1K86A 1Q17A 2ECOA 1FXWA 4LTNA 1G8AA 1NW8A 1E5XA 1LJLA 1P2DA 2PUTA 3TCXB 4D4GA 4AY6A 1ZIOA 2Z5FA 1X9NA 3RYIA 3K0CA 3HG7A 5LDDC 3T1TA 3CV3A 3BWEA 3ECAA 1TJNA 5F7XA 4CIBA 2IPAB 3HV2A 2NXEA 1SHKA 3H8WA 5I60A 3PB3A 3FPCA 5J40A 1KI1A 4H08A 1B6GA 2ZQ5A 4UAGA 1E8DA 3LHSA 3USZA 4HCJA 4HXEB 3ML1A 1DJNA 1NJ5A 2IU3A 4KH1A 1EM8B 4RAQA 2J6HA 1NI4A 2BR4A 4LRUA 5TLSA 4CT0A 3WGOA 3F6YA 3CSWA 3M81A 2Z8YM 2CJXA 3STHA 3GP8A 4TSKA 1Q3KA 2I76A 2P6MA 4DG8A 1ZRHA 4Y98A 1P44A 4OJYA 5AW6A 2DWUA 1MAAA 3MYYA 4PXAA 3EQ2A 3LDFA 2F6RA 2O2DA 4HR7A 3U4AA 5KSPA 5CA0F 2IJGX 5CHYA 1NVVQ 4ZPXA 2XYRA 1TOAA 4XGQA 4QXOA 3N05A 2P90A 3F2VA 3R8FA 4TTTS 3OVMA 3L8ZA 2GASA 1ULZA 1HO3A 1YH3A 3JQ8A 4CE6A 4H7IA 3L6DA 2EJVA 4JBHA 1UH5A 2AMFA 4FGJA 1SEVA 3UGKA 1U7HA 3K5PA 3LU1A 4W5WA 5FHRA 2NPOA 1D1QA 1U2TA 2ZUCA 3BERA 2VC2B 1YDMA 2G5CA 2NYRA 2X0KA 3T9DA 3EEFA 3Q2KA 4INAA 2WB4A 4Y9RA 5LYJB 2C97A 3C3CA 2FDCA 2JGDA 3UJHA 4CJXA 1H9CA 1O6ZA 1THMA 5IJAA 4QXRA 5CA1A 4BATA 5TGTA 4ZCQA 3D43A 2H1VA 2Q9CA 5LA6B 3H6HA 1KJ8A 4V1CB 4GE3A 1MC5A 3LO8A 2OB1A 3DL2A 1EGAA 5A02A 3LP5A 1VL6A 4JLSA 3RHZA 4QOFA 1JKIA 1TO2E 3OQBA 1BEZA 1DDGA 3Q11A 2PKXA 1W35A 4IM7A 4CN9A 1THGA 2J41A 2VH2A 3LQFA 5CB6A 3PENA 3DZJA 1ISJA 1EYZA 1R6UA 1XZGA 3DAYA 1I5OA 3U3DA 1XE3A 5AW1A 5CR5A 3RAEC 3H6KA 1KTIA 1JIJA 3Q72A 4ZVMA 1RXCA 2YMPA 4FINA 1QVAA 5AOVA 4HWKA 1XVTA 1YDGA 3TX6A 2WDPA 1K4YA 3TZBA 5B4VA 3B8EA 3M9WA 5JVDA 1HM5A 2EFDB 3A06A 1WIWA 4K1LA 1IXKA 5JD5A 5LQDA 1RPZA 3BXHA 4O1HA 3D8RA 1ZUWA 2BLNA 4OB7A 4NAHA 4N01A 4C78A 2PLAA 3TFWA 3VTKA 2AUNA 5ALHA 2MMGA 2CFCA 5ECWA 1HUQA 1DKQA 3KOOA 5E4JA 4ZYTA 4EHIA 2K4MA 4GT1A 1JHZA 4FWBA 5ETJA 5B4UA 3QFSA 1AV7A 5EG5A 4OBXA 4G65A 2DEUA 2GYYA 1RS0A 4YLGA 4XX1A 2GGSA 1RZ3A 3FSGD 2FDXA 3EY4A 1YGYA 4HB4A 4UHDA 4ZAFA 2A9PA 1ZL2A 2ZIFA 3HZRA 2J9GA 3TLCA 5EZYF 4CL8A 4E32A 5K3EA 1E7SA 1ZZEA 4DRXB 2YJZA 5CXUA 3KXIA 3IV9A 5KREA 2FPUA 1M5RA 3MJDA 1U2EA 5BSTA 2W2OA 3SNOA 2ZYVX 3K9FC 2DHCA 1MOQA 1YV9A 3CEHA 1QE0A 3DVRX 4U4AA 4GP9A 1F0KA 2QVCA 3PTLA 5AJZA 3WL4A 1QE5A 3O3OB 1RJ9B 1WB6A 2R8BA 2F3UA 5L4SA 1F6WA 2C59A 4KODA 4EJSA 4D0RA 4YQFA 2IYUA 3HWWA 1RI2A 4O4LB 4RTOA 4W5JA 3WSWA 2JGFA 5I7VA 1ZSNA 3EDOA 4H9GA 3I5YA 4P0PB 1IY9A 1GDDA 1Q83A 1X0VA 3C8DA 4K05A 2PLWA 3MGAA 4KR6A 2JK0A 3HFSA 5G0SA 4D8TA 3QX8A 1MB2A 1L4GA 3I76A 4N6GA 3KB2A 2VEDA 3ADOA 4GUAA 3TXXA 9GPBA 1N0WA 3TIXB 1L4MA 2B4AA 3U3JA 2ZWIA 1NOJA 5EEGA 4B6GA 5IT9A 2E3JA 3U55A 1I24A 2J6CA 3KYIB 6LDHA 3F8TA 4HVTA 2FPPA 3ZVMA 1V5EA 2Y1LA 3DR5A 3RIYA 4QNRA 1P7ZA 1T4BA 2ZS8A 3JQFC 4DV7B 1Y9AA 1EWTA 3QTTA 4W9NA 5WRFA 4B4VA 3UWOA 4F4UA 5LIRA 1JDBC 1D2CA 3PG5A 1MGOA 1P1CA 3E7PA 2Z2IA 3BXGA 5ALPA 3VNBA 5I5GA 1L5OA 1R9NA 5BURA 1YBMA 4UUGA 2B37A 1D0SA 1REQB 3P9IA 4GLBA 4INJA 1L1FA 4CM4B 4XWKA 5DNUA 1TYDE 3NHRA 2GT1A 1WD7A 5CXXA 4JBGA 3WNCA 1OC2A 4KFRA 2OHIA 1HLDA 3W7AA 1OAAA 1H2XA 2C07A 2CL7X 2W83A 4BNNA 3IB3A 1OLUB 4B34A 3M8KA 2EGHA 2OTCA 3RK4A 4ENQA 2I3GA 3WV4A 3E9DA 3T61A 1ENPA 5BUQA 3ZWXA 1PTKA 4QFDA 3HT5A 2O4UX 1HDYA 4CHIA 1EVZA 2A1HA 2B8NA 2BFAA 1PZFA 1XZMA 2V5VA 3JZMA 4Q01A 4RX1A 4WCFA 2EZ8A 3SIPA 4DUPA 5JNTA 4QARA 4ZKEA 2CXQA 2PBFA 4DDWA 1CZNA 4FC7A 4K81B 4MUGA 4O25A 5EMMA 4EEZA 3DKVA 1DRKA 2GCIA 1W0JD 1SB8A 1ZCBA 4O4IA 3NBZC 2P67A 2ZSIA 3HO1A 4HGPA 4X3PA 3O31A 3NBQA 2D7CA 4LRSB 3VA7A 3FZNA 4LVNA 2P3OA 4AP6A 5K8TA 1MABA 5CMLA 5KVCA 3KYJB 4P0TA 3EVNA 4RJKA 2CZCA 4IWYA 3QYJA 3O84A 4IRXA 1YOBA 4XCXA 3REGA 1QRRA 3WDLA 2BFBA 3CEAA 4MV3A 4M0MA 4AQDA 1KY4A 3FKSD 1PV4A 1L1QA 1Y3AA 4X6XA 3TL6A 4NFYA 4KPFC 1J0CA 4XVUA 1C4OA 1KY5A 2PDAA 2H0AA 3DWEX 4GGPA 2X19A 1U80A 5J2UB 4PYJA 5EKSA 3UV6A 4JKIA 1KHHA 3I8XA 1NBMA 4Z0TA 2C2ZA 5E9AA 3UQYS 1DGQA 1O0BA 1LC0A 1DQYA 2BMJA 3B1YA 2D6FA 4Y0AA 2XJ4A 1XYGA 2Z9BA 5L7YA 2GD0A 3T1HB 3ZGNA 2WI8A 2E49A 3KZNA 4UBMA 4X1IA 2UV8A 3LF2A 3A0UA 2ZUTA 3G0HA 4L6IA 4PWZA 4OV6B 4KGXA 2NT4A 3VPXA 3I01M 3VR1A 3I9V6 4AIIA 4HSGA 2R4QA 1HTTA 2YWCA 4WUVA 4EBFA 1K5PA 2JI8A 3EH1A 3IEPA 2JGNA 3VU9B 1M74A 3X3HA 4D5EA 5L95A 4P5DA 1KEWA 4FYIA 3QG5A 4LJ5A 4PYIA 4P7JA 5EHGA 1L7AA 4C0JA 3OZSA 1QX3A 2PH3A 3P71T 3TPFA 5BVGB 5KUTA 2IXBA 4FWTA 3BAFA 4MMYB 3UAVA 4L4YA 3FKQA 4ZDKA 3BAAA 3GROA 3PNVA 4Y2QA 1GLNA 1MIOA 3G5UA 2XQGA 1KJQA 3DDZX 2VZEA 1Z7YA 2EP5A 3V80A 4GW3A 3KB6A 1QPZA 2YWVA 2EEZA 1L5MA 3STVA 4BO4A 3WK6A 4P53A 2F62A 3MPOA 4M0EA 4CFZA 3SJBA 5HV6A 1YK0A 3EJ6A 1ENYA 4JS0A 3LMKA 1E9VA 4PINA 2Z4RA 4EQ6A 2ZGIA 1V16B 5AI5A 1VE3A 1ICIA 4OSEA 3RR5A 3RS2A 2XMSA 3GMDA 4PAMA 3U3XA 3DV2A 4JMLA 1MJGM 4G41A 2GHQA 2YVKA 2ZSUA 1OX4A 3V2IA 3NTRA 3ZCRA 4UCFA 3AUUA 4TTPA 4AYWA 4EI9A 3P4UA 4X7PA 2PU5A 3NONA 1DEXA 4WVFA 4CDRA 3WQRA 1E0AA 4KW7A 1VFPA 5CIYA 1LFDB 2QAIA 1WXQA 3GDGA 3J80A 2H16A 4O83A 3ICQB 4LH7A 2HADA 3FDFA 4TLCA 3GRUA 3UWMA 4KXFB 4I55B 3PA8A 5FPPA 2YR0A 3U1VA 3IA2A 1AX9A 3GHHA 1GGHA 2B1RA 2ORIA 3BJIC 4RLHA 2C2OA 1FMCA 1RTKA 1EVQA 3HKDA 4CM9A 5KOHA 1GPYA 1SXJE 4F3TA 1OV4A 3FNQA 4I9NA 1WZCA 4K88A 2QRKA 3SDZA 5EXTA 1GNTA 2IZ0A 2X22A 3WLOA 4BWYA 3KFLA 2BKAA 4MVJH 4ZYWA 3NBFA 5DMHA 4EG4A 1UKCA 2DXIA 3NGLA 4CF4A 1ZK3A 1V8DA 1CWUA 3OU6A 3IHTA 4QXQA 1YKFA 4K5QA 3K4HA 5CTJA 1M2FA 4DSOA 1U6IA 4DQKA 3OY7A 4NJEB 3DAGA 3JALB 4KQCA 3UT6A 2J0VA 4QSMA 3IUPA 3WK4A 4KXLA 4QDXA 1UOPA 4MO9A 3JVEA 1W2GA 2Q21A 3DO8A 4TPKA 3QG1A 4K6HA 3TNLA 1QP7A 4V03A 3DLHA 3QUSA 3AXSA 4OYHA 5KOHB 3W9BA 4ZKDA 3LHIA 5GV8A 1U8AA 1V43A 1JDVA 3LWZA 4FVTA 4AN1A 5ITSA 2D00A 1NKTA 2R5FA 1TK2A 2C2MA 2V7BA 3BD8A 4GMDA 3V7FA 3ZKWA 4C0BA 4ARAA 1R0WA 5DBHX 3NHUA 3PR2B 5EXEA 5FD8A 3RHTA 3RWBA 5JNRA 1MA0A 4NESA 2FZ5A 5B7QA 1KJWA 4MWOA 3KCQA 2EJUA 1QQBA 4R9UC 3ZU2A 1OROA 2ZR8A 4F9EA 3E3MA 1KA9H 3Q3VA 2XUZA 3AF1A 1L5GB 4ER6A 2QTNA 4XJXA 2VZ9A 1NP6A 3AFGA 5FYDA 1GU0A 2UVPA 4K8RB 4R3WA 1W59A 4IICA 4DNOA 3G1UA 3OAAD 3R4CA 1LLFA 4MB0A 5THKA 5KNCA 2W5UA 2X5XA 3R3JA 4UHFA 3EQ8A 3KPUA 4NK5A 2PVPA 1E5TA 2G5GX 2N42A 3MWLA 4IKPA 4PBTA 1NV8A 3HABA 5T5QA 3DLTA 4AMBA 3AJ9A 5JSZB 3ROKA 2VQDA 2HJ9A 3C7TA 1BTOA 5EPEA 4N41A 3D1VA 3MCZA 3A1VA 4NEGA 4L7VA 1L5QA 2NQTA 2W90A 1CUSA 3OZ7A 2PLFA 3VXKA 4U6SA 4B3JA 3SZOA 1Q7BA 4CODB 2HNKA 2RGWA 2LXNA 2VJKA 5LVAA 3CPJB 1J7JA 1I2ZA 2QTCA 2E0IA 4FFOA 5JSKA 4EGJA 1JFVA 3AR4A 1BSVA 2R47A 2VVTA 4BO9A 1J0DA 1DAEA 1YO6A 1WKVA 1YZQA 3OF2A 3UWDA 3U09A 3G79A 2ZRPA 2OXCA 2ZRGA 3W78A 4PSUA 5IJWA 4ZCIA 3J81A 4XRRA 3AUYA 1NZJA 1WTCA 2C8JA 5E9QA 4BZWA 2ZVDA 2XXAB 2B3TA 5DN6A 2OAQ1 4QAJA 5IAGA 3OD1A 4CMJA 2ZCJA 1ZR4A 3A4IA 1Z7WA 3VNNA 1U0EA 1ESEA 3WSTA