4FFOA

Pylc in complex with phosphorylated d-ornithine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
363
structure length
353
Chain Sequence
MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYGLEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVLKERFGAVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase/reaction intermediate
molecule keywords PylC
total genus 118
structure length 353
sequence length 363
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ffoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ffoA01
4RF5A 4Q3NA 5JDIA 1E1KA 2Q45A 5MGBA 1BSVA 3LLSA 3BZUA 3DR3A 3NT4A 2YYYA 1AXEA 3GK3A 3VKUA 2IEDA 4TRMA 5L40A 3TZCA 3U49A 4CM6A 4CL3A 3MTGA 2O3SA 2R86A 5IZ4A 1DIAA 1SZJG 2W98A 3P2OA 4PLWA 3G8CA 3DF7A 3IJRA 3O4RA 3KSUA 3GIDA 1PS8A 1V8BA 4AICA 3AOEC 1GTMA 4D41A 5BSHA 4IQGA 3VHRA 3ZU4A 4BS9A 4XZ3A 5FEUA 5CDUA 1E1NA 2PLAA 3VDQA 1KUTA 3PWZA 5DCUA 3FNFA 3JYOA 3QRWA 5JY1A 2CNVA 2VYVA 1PJBA 2HLPA 1F17A 4CM4A 1KVSA 2DVMA 1QKIA 2HK8A 2NQTA 4XYBA 4XQEA 4N7RA 1Z7BA 3OMLA 2H1SA 1PL7A 5C3MA 3ADPA 4O7YA 2JAHA 3L6OO 3PXXA 4HWKA 1LRJA 1R12A 1KEWA 4PLYA 3WR5A 3A14A 3IJPA 1C3OA 3AOEA 4DREA 3WGIA 4CLRB 3QV1A 4L0QA 2DAPA 3KV3O 1GYQA 2OORA 4XIYA 3VPXA 4O82A 2IDZA 4TUYF 1MA0A 1NHWA 1L7DA 2JFGA 3S2FA 4N5NA 5A9SB 1YH3A 3MWEA 1YL5A 4DRYA 3E82A 3ONDA 4J2OA 4RPKA 3RKUA 2BLLA 3K96A 1T25A 1PQWA 3NDIA 4ND4A 2FOIA 3CINA 3RFCA 3D5TA 1XCBA 5DF1A 4JJFA 3F9IA 2HMUA 4GQAA 3LF2A 2O3RA 1P1HA 2FPPB 4L4RA 1DIRA 3VVBA 5T67A 2AG8A 3MOGA 2OZPA 1X0XA 2IZZA 2Q2VA 2X23A 5H81A 4DMLA 4LW8A 4RL6A 2EV9A 3BIOA 1TLTA 4K28A 5LXTF 5JPIA 1EQ2A 2CZGA 3FWNA 4AVYA 4YT2A 4PLFA 1N9GB 1LU9A 4PLTA 2R7KA 1NFFA 4B3IA 4D0RA 3QP9A 4XRRA 2FZEA 4FBGA 4OH1A 1QYDA 2CSUA 3QQPA 5DBFA 3G49A 3NRCA 3SJ7A 4YRDA 5FF9A 4JGBA 3WOHA 2OFPA 1I7NA 2YHUA 1JDEA 4JQCA 4IY1A 1IB6A 3FBTA 3KTDA 3ICPA 1XHLA 1DPGA 4YT4A 3TL2A 1GSHA 2EW2A 1VL6A 3Q3CA 4ND5A 1O5IA 4Y98A 3ROPA 4KTTE 1JTVA 4J43A 1BMDA 1K3TA 3H6KA 3F1KA 4IQ0A 4YJFA 5JW6A 4CLEA 4Y8VA 1SCUB 1T24A 4UEOA 3PZRA 4HY3A 3WGHA 4DLLA 4HR7A 4LMRA 4XGKA 5IN5A 5LYJF 3TNLA 1Q0HA 1SAYA 2DFDA 4BO5A 4JBIA 2P9CA 1PJTA 1OZAA 3V2GA 4HFRA 1C0KA 1KS9A 2PH5A 3MJCA 2JL1A 3GEDA 4WOJA 3UXYA 1X13A 4U6SA 2Q1UA 1ZK3A 4II2A 1Z6ZA 1O95A 1DHTA 1NQAO 4MJLA 4MV9A 1H0KA 3FNGA 3GFBA 1U9JA 4IDFA 4TSKA 4AG3A 4DA9A 1TT5B 2AQHA 4TZTA 3WB9A 3PGJA 2NTVA 3E5RA 1MX3A 3SE7A 1GSAA 1KJIA 3AW9A 4GX2A 4WNCA 3UOGA 4I5DA 5IYZF 4IS2A 4E5MA 4MV6A 1GQYA 1N1EA 2YV3A 3E48A 4Q3AA 3HSKA 4ZQGA 5A3VA 3ZWMA 1SOVA 4B4OA 3DOCA 3QJ5A 2WMDA 3JD2A 3K30A 3BMNA 3OIFA 3UFXA 1CEQA 3L4SO 5AYVA 2WEKA 3UW3A 1G0OA 4GVXA 4MO2A 4BO1A 2VYVD 4I8XA 4ZD6A 4FU0A 5L4SA 2A4KA 1N9GA 2QYSA 1ARZA 5DDIP 3GA0A 2YW9A 4YJ3F 3V1TC 4DWVA 1VJ0A 2PZLA 3U9TA 1RM4A 1F0YA 4TV9F 3Q9UA 5ILOA 2CNUA 2VOEA 2HK7A 1XG5A 2Q49A 4J7CA 4RF4A 1HXHA 4B8WA 4P22A 4BOYA 3RV4A 1BXRA 4ME6A 4OHUA 1VLLA 3INTA 4KZPA 3GVXA 3BMOA 4KWHA 3DONA 1RJWA 4NQZA 1EUCB 3SLKA 3TFOA 3DTTA 4Z9FA 3JYPA 4P8RA 3RI3A 3BMNB 4WE3A 3M1AA 3FR7A 3HDQA 3JZFA 4LN1A 5KJCA 3F1LA 1I3MA 1T2DA 1ISFA 4B4UA 3BMQA 4YDRA 5TNXA 3JQ7A 5KIAA 3PRJA 4I5GA 2DLDA 1IOWA 2ZK7A 3VH4A 1E3EA 1BTOA 4IJKA 3ZWWA 2FRDA 3WGQA 3KREA 2YZGA 3DWFA 4FFPA 5IFLA 5IXSA 1Y81A 2HGSA 3WJAA 3AM5A 3IP1A 1I5RA 1OBDA 4RPLA 2VWPA 4XX0B 3L6EA 5IDYA 1JVBA 5TF4A 2V6FA 4CM4B 2WD7B 4EUEA 2B4RO 2IZ0A 5IG2A 5K6AC 1B3BA 2JHGA 2CZCA 1A4IA 3I4FA 3TOZA 5IN4A 3JQDA 5JSFA 5JY6A 4AJ1A 1B8PA 1IZ9A 1WVGA 4RDIA 3C8MA 3KVOA 4Y6PA 4AL4A 4IDCA 4MA5A 4BKQA 1LRLA 1X7GA 1ONOA 3IAHA 4CQMA 4E12A 1RM5A 5C1OA 4FB5A 1TVEA 1HE4A 1TT5A 5DBIA 4MVJM 3K5HA 1D1SA 1R0KA 3MWEB 2ET6A 1I3KA 3L4BA 2FHSA 2ZYDA 3OIDA 4GLLA 4GWGA 3WGGA 4DXHA 1ZJZA 1U4OA 3RC9A 4MVJG 1DC4A 5CEFA 2DFVA 3WBBA 2FP4B 2VOJA 3PFFA 3PFWO 3TZKA 1GZ3A 1HE5A 3HN2A 4WEOA 4BKRA 3DC2A 4DMMA 3CPSA 2LDBA 1VE9A 2D0IA 4BKUA 5EMHA 4YJHB 4CM7A 3TPCA 1S7CA 4O59O 5JDCC 2CMDA 5BPFA 1Q0LA 1YQXA 3WLFA 2YRWA 4YA6A 3PDUA 4GKBA 4H3VA 5KKNB 2AG5A 1X7HA 4RVSA 1U2GA 5HV6A 4XDZA 1JN0A 3QHAA 4G5HA 5T6BA 4E2YA 1R66A 4GX1A 4HKTA 4U0JA 4CPDA 1PU2A 4PLPA 4JK3A 4O7TA 4CUKA 3UICA 4U8GA 2GNAA 2PKQO 2EWMA 5KVQA 3ZHBA 1TXGA 5HRUA 4XR9A 4L75A 1P1RA 1VRWA 4XYMA 3HZZA 2QYTA 4R1SA 4O86A 4R1NA 1F06A 3BHJA 5TIIA 1HT0A 4EITA 1EK5A 2X4GA 3GMSA 1UP4A 3AK4A 2Y1OA 1DFHA 3WFJA 2X58A 5GZ1A 1A4UA 2VTEA 2NTNA 2XCLA 1RYDA 2VZ8A 4J1TA 2GR9A 3TJRA 2H5LA 1GPDG 3FPLA 3FSRA 3GHYA 4FGSA 3HDYA 2VQ3A 2ZKLA 1H93A 5DOVA 2C7GA 3K73O 4RF3A 4IXWA 3E5MA 5F3RA 5JAZA 2F00A 3ETHA 3RUEA 3SX2A 4AJ2A 2QF7A 2GCGA 5C8YF 1IOVA 1AE1A 1K0UA 3VDRA 5TSDA 3JQAA 4MIOA 2CUKA 1YONA 1XQ6A 3RJ5A 4JJIA 1NVGA 4CMHA 4AJLA 3VH3A 3I6QA 2AW5A 4J1NA 1GZ6A 1PZGA 3JQFA 1U3WA 2SCUA 4QXMA 1GV0A 5KVCA 1QV6A 1XKQA 4UUOA 2FMUA 2I9PA 3T4EA 2VHWA 1HSOA 1RM0A 2DU8A 2DM6A 3P7MA 1VKNA 4XA8A 5LDGA 2E48A 3DBVO 3Q9NA 4CLHA 3M2TA 5ER6A 4E31A 1QYXA 1BGVA 2Q2QA 1SB9A 4MAMA 2BFMA 4W4TA 1Z82A 4J1SA 4YTEA 4J1QA 4CMKA 4BNZA 4R4JA 1J4AA 3ZW8A 1KJ8A 1H6BA 1ZNQO 1YOVB 3AM3A 1HEUA 1YOVA 4J4TA 3ETEA 4YJGB 3BTUA 4MIEA 3MEQA 1GAEO 3MJVA 2FSSA 4W82A 1E7QA 1GYRA 3BMQB 3OICA 5GONF 1G0NA 3EGOA 4OXNA 5T64A 3VZRA 1JKFA 2GN8A 4MKZA 4PG6A 5LC1A 2HJWA 4WLVA 1NX6A 4O7WA 1XU9A 3B1KA 1DOHA 3GZNB 4A26A 3HO8A 2W70A 1U3VA 4IJWA 3H2SA 2B83A 4WJZA 1NQTA 1ZK1A 2WE8A 2G17A 3VA7A 1M67A 4KDFA 3L6DA 3IS3A 4LSWA 3G1UA 3VKVA 3NAQA 4XX0A 3FCOA 2W6ZA 1ISIA 2PTGA 3OH8A 2YZNA 3EVTA 4DBVO 3DBLA 1R0SA 4CMJA 1HDOA 1T26A 2DBRA 3JD3A 4NYEA 2GZ3A 5LP6F 1ONPA 1ZIDA 2PD6A 3KAJA 3PQFA 2IRWA 3G79A 2I6TA 2YHIA 3JQ8B 1C0PA 2C2YA 3LT2A 4DIBA 4E21A 2NUAB 2EG9A 5CAEB 4EI2A 1N1GA 3ICCA 3NKLA 4QFDA 1WDKA 4Y8VB 1EFKA 1YRLA 2Z02A 1U3UA 2OBYA 4U7WA 4XIJA 3VPSA 4CUZA 4YJ2F 2V6MA 2NVUA 4NDNE 1E4EB 1E92A 4P4GA 4ALIA 3ZWPA 4IGFA 4CM1A 4DYVA 1K6JA 4ZVVA 1S6YA 2J8ZA 4WGGA 1XWFA 3WS7A 4BGIA 2VHYA 3ZHYA 4GX0A 5A5FA 4DGSA 4IDAA 2Y68A 4MKXA 4CR6A 3PP8A 1NTOA 1LLUA 1I2BA 2VYNA 1PS0A 3DO5A 4L73A 2Q1TA 4YWJA 1HRDA 4QSHA 1YO6A 1UZNA 4YAEA 3IUPA 2W6MA 4R9RA 4R9SA 5LCXA 3BHIA 3C1AA 4IM7A 2ZB7A 3CXRA 3DL2A 3UFXB 2EHDA 1PS9A 3WSVA 4ZHSA 4NI5A 4HUJA 2FSVA 3L07A 4O5OA 3INRA 2DTXA 4WNIA 1P9LA 4J2HA 4OOFA 2PD4A 1VC2A 9LDBA 5F1PA 5HS6A 1EUCA 4N5MA 4GMFA 3DOOA 4LK3A 1IULA 1DSSG 3EYWA 2WYVA 1E7YA 2W90A 4E4YA 3E1KA 1LDBA 4MVJP 1HDXA 4CLRA 4H16A 1E7SA 4PG8A 3JQ7B 3NX4A 5DBGA 4K6FA 1NR1A 1PZFA 4M54A 4JIGA 4L76A 2QZZA 3TDKA 5JVLA 4DVJA 3CE6A 2Z04A 3DFZA 4EZBA 4EJ0A 4AFNA 5EL0A 5TJHA 4BO8A 1W73A 1C0LA 3NYWA 2VYND 1Y8RA 4GI2A 1YBVA 3JSAA 2VNSA 1UP7A 5I8ZA 3FNEA 3RBVA 1UDBA 3RSHA 1HYEA 4DQUA 4XRGA 1GUZA 3DZHA 1Z2PX 3F5QA 1NQOA 1Z2OX 2PNFA 1GSOA 2X0RA 1UH5A 4IBOA 5CAEA 4CM9A 1Z2NX 3ORRA 1W0CA 5A4DA 1PJLA 2BHLA 5F1OA 3BTVA 3V2HA 3OA2A 5CG1A 2E4AA 4GSLA 2W6OA 3V8BA 3OJFA 4WUVA 3AUAA 1U3TA 1GD1O 3D5QA 1AUXA 2VZ9A 4O4LF 1LUAA 2VZ0A 4LVCA 1D1TA 1JAXA 4Q9NA 1Q0QA 2A94A 1E3IA 5I8WA 2HU2A 4IS3A 4ZOLF 4RV9A 3Q2KA 2NU8A 1QORA 1WMBA 2EKQA 4PZCA 3WICA 5DT9A 3SBOA 2G82A 2HMSA 1A9XA 3RVDA 1LQTA 2IP4A 4JLWA 4TZKA 2BGKA 4I4TF 3BMCA 4B7UA 4UVGA 4HX5A 2RBEA 4BNGA 1ENYA 3ZU3A 1F8FA 4ZHQF 4KUHA 3U4IA 1WZIA 2HUNA 2J3JA 1RPNA 4CMGA 2B36A 4INAA 1KC7A 4HNVA 4ZGWA 4FE2A 1AUPA 3TSCA 4BMVA 1QV7A 3K3PA 2X0JA 3AI3A 3VC7A 4ID9A 1Y5MA 4MDHA 1ADCA 5IF3A 3I23A 5THQA 4LCJA 2Q46A 4FFMA 4TRRA 4RF2A 1T1SA 1CQJA 1P44A 4JXKA 2CFCA 3VVCA 4NG5A 3CSDA 4P38A 4E4TA 1P1KA 5A1TA 1ZK0A 5JYEA 1B6RA 2WYUA 3VPCA 3HE3A 3PHIA 3RKRA 2I87A 1M6HA 1BDBA 5L7WA 3UGKA 4OQYA 1ONNA 4BNLA 4Y6RA 4LCEA 2BH9A 1YE3A 2RHCA 2Y1DA 4QX6A 5IDXA 4WEQA 2JD2A 3JV7A 3EY4A 3RU9A 4O2AF 1HL3A 1EQUA 1P0CA 1PR3A 4A2CA 5GZ6A 5B4VA 2QHXA 3LWBA 3HNPA 3ADOA 1DV2A 1V0JA 3OIGA 1XDWA 4OQZA 2QRLA 1YWGO 5JAMA 1WWKA 4YB8A 2IEBA 3PYMA 4FSHA 1DLIA 3GVPA 4CMIA 2R00A 3DMTC 3QLJA 5F5NA 3DAPA 3ENKA 4XCVA 4D0SA 1ORRA 3RBXA 3QFFA 5G0TA 1ZBQA 2VUSA 1FMCA 2CD9A 5FWNA 1VKZA 1W93A 4R3NA 2J9GA 2IE0A 1SBYA 1E77A 2D3TA 4OAQA 4B3JA 2XD4A 4GL4A 2WWRA 1GZ4A 1MFPA 1ZZEA 1UXHA 2AQKA 2YW2A 4YEDA 3HB5X 1O8CA 1F12A 2GD1O 2Y1EA 4UVEA 4RZHA 2NU8B 2E49A 1TEHA 4IXTA 2C07A 2V5AA 3PGXA 4DLAA 4BO4A 3L77A 5EPOA 2DTDA 2R00C 3DMTA 5ES3A 3RUPA 1LDNA 1XELA 4O4JF 1X14A 3IQDB 5IJZA 4BVAA 2FR0A 7ADHA 3DHYA 1WDLA 1EBUA 1O0SA 4B7XA 4CM3A 3KRTA 4ZRMA 5FFFA 3UKOA 3AFMA 3VPHA 1LI4A 3MJFA 4RVDA 3KSDO 5HBRB 3ONEA 1JWBB 4XGNA 3ZWNA 5JDIC 2ZTUA 4XQCA 5JYDA 1DJQA 1IPFA 3AFNA 3IKVA 4UVDA 4FFNA 4OOEA 1C30A 4TWRA 1MXFA 3H9EO 4TRNA 1NVMB 3NGXA 1N7HA 4D7AA 5JC8A 3OJEA 2CF5A 3DBHA 3JD0A 5A05A 3IKTA 3L9WA 3ITKA 3N8DA 4HV4A 1PJQA 3JQGA 4DLBA 3I83A 4E32A 2EIHA 1JU9A 2AE1A 5G0WA 4DUPA 4WOKA 3FTPA 4ONEA 3Q1KA 1QXSA 1AHIA 3K2EA 1U28A 5AXCA 2ZQZA 5JCJD 4DPLA 1CF2O 3UCXA 1B15A 4HNGA 2JFHA 5IXYA 5CA1F 4OJNA 3V1YA 3P5SA 2LDXA 3RASA 1EUDA 4GMGA 1X1EA 3WQQA 4CMEA 1I0ZA 3ASUA 4Q3CA 5AXAA 2O3UA 3DHEA 3AY6A 4BO2A 4CMAA 3OJOA 1QYWA 3HBLA 3LT4A 1GR0A 2OBNA 4MINA 1R4NA 5A02A 3TRIA 6ADHA 4JROA 2ZB3A 1ZW1A 4WCFB 1KBLA 2W2KA 2I66A 2I80A 3I4CA 3QVSA 5TGDA 1PX2A 1G6KA 2X1HA 3Q2OA 5JQGF 3RAJA 1H6CA 4O4HF 5T8KA 1OI7A 2GLTA 4EG0A 1EDZA 2UV8A 4FQ8A 4IMRA 5JNLA 3IOYA 3QWFA 3PVZA 7MDHA 2J5RA 2YV2A 4YVFA 5G4LA 3ZV6A 1BNCA 1I36A 3DBRB 2O7QA 2X0IA 3HG7A 3KLMX 3GNTA 1QRRA 1KEPA 3C7DB 4FFLA 2YV1A 3WMXA 3H9JA 4M49A 1EE9A 1KY5A 4QECA 4R01A 2DLNA 1WAMA 1R16A 3V2UA 1UAGA 4AJNA 4PG4A 5BR7A 2UUPA 3FTNA 2GYYA 4WASA 5IZCA 4CUJA 5JCJA 4CLXA 1H2HA 2TMGA 4ZQBA 2H6EA 1BG6A 4DPKA 1ZMTA 1KEEA 3O8QB 3TN7A 4EW6A 4FPXA 3SVTA 1UZMA 3FD8A 2GLXA 2PD3A 3GUCA 5KCZA 4BNMA 1PL8A 4PVDA 3FBGA 4DC0A 1DAOA 3LSYA 1B8UA 3KEOA 5EQDA 3WLEA 4EYEA 3RV3A 2VT2A 4XWYA 2C0CA 3GEGA 1K89A 2WE7A 3I6IA 3VPGA 3JQ9A 3JQAD 5DP1A 4GKVA 4IUYA 4OO3A 4YXFA 4KQXA 5CEEA 2A35A 3WYCA 1IL0A 1ADBA 1DRVA 3T7EA 2OMEA 1JLLB 3R3SA 4Z0TA 4IZOA 1PQPA 5G4KA 3QVTA 4E33A 2EF1A 3GLQA 3NTRA 5KX5F 4YRAA 4ZU3A 3E03A 2ZTVA 1CE8A 1T2CA 1V9LA 3F6YA 4IIJF 4Z0PA 3LU1A 4CLOB 3MJTA 3QWIA 4DYDA 1KIFA 3QWAA 3CZRA 5COBA 3ZCXA 2EJVA 4JJGA 4TV8F 2BRUA 2YQ4A 4YBZA 5U9CA 5C5IA 1PJ3A 4ALJA 1NASA 2YY7A 3ZV4A 4LISA 3TW6A 3KYDA 3PTZA 4F3YA 2IXBA 3B1JA 5U1PA 1PK8A 3DXFA 1KJQA 5L45A 2EEZA 1SCUA 1O89A 4NMHA 1BVRA 5F1KA 3JQBA 4CLDA 3BTSA 4W7HA 1DJNA 2WSBA 1HTBA 3C3XA 4O63O 1AHHA 5I7SA 4C5AA 3NT2A 3JYNA 4RORA 2NLOA 1V6AA 2O4CA 3HWRA 1PWZA 3ZWVA 1NFQA 4BL5A 2W6PA 1QYVA 1M6WA 4YAKA 4AJIA 1EUDB 2D59A 2UYYA 4XKJA 4XYGA 4MV1A 1WNTA 3LF1A 4KMSA 5COQA 5KWEA 2NV6A 2NU9A 4ZQHA 1P1IA 2VNAA 5HA5A 4RJTA 3BG5A 1NXQA 3S2EA 4ALNA 1H94A 3LLVA 4EEXA 1CQIB 4XJSA 5ADHA 4O81A 1ZEJA 2PWZA 3GZ4A 4CV0A 3C7AA 4BGEA 4O7RA 4NBRA 4BGVA 4BO7A 3QIVA 4MVJA 2EXXA 4R1TA 1D7OA 1Q7GA 4R3WA 3W4IA 4I9UA 4A10A 1HE3A 1W96A 3GVIA 2I5PO 1Y8RB 3KBOA 3K9QO 3VOTA 4Y67A 1ULZA 4HP8A 3ROQA 3JTMA 3K2BA 4IQ8A 5G2OA 1E6WA 1ZJYA 1HDRA 3AW8A 1A7AA 1Q1NA 2BI8A 4O0LA 1N5DA 1NPYA 1M6VA 3RFVA 1H6DA 4GGOA 3T7CA 2Q4EA 1HYGA 2FPGB 3CTMA 4ALKA 3H9GA 1QSGA 4EGQA 2P4HX 4I9NA 2I65A 1WR2A 3KYDB 1Y8QB 1V3VA 1A7KA 4XYLB 1XEAA 2BKAA 2QRJA 5TJ9A 1I33A 4E5PA 1KEVA 1T2AA 4HNUA 1L1FA 1NWCA 2Y93A 4M55A 5BQFA 3NJ8A 1PGQA 3EDMA 1E7MA 1PIWA 5DNAA 4CV1A 4GVLA 1XU7A 1YDEA 2BD0A 2W6QA 2X86A 2DBVO 1SB8A 4PLCA 1PX0A 2NTJA 5KKAA 4PRKA 2V6GA 5JC1A 3U4CA 2POQX 5MDHA 1JA9A 1T1RA 2ZTMA 2R6JA 4QUKA 3FRJA 4RDHA 4RVGA 1JKJB 1YDWA 3I9JA 3FI9A 5JDCA 1PZHA 4BNYA 3FHLA 3TQTA 3U09A 1L7EA 3PJEA 3GQVA 4B8ZA 4CM8B 1KVUA 3OJ0A 3JQAB 2V7PA 2RH4A 5B4TA 1JWAB 4OSPA 1J5PA 2H63A 2AHRA 1R4MA 3K5PA 3O9ZA 5KJEA 4DTIA 3GMDA 3JCZA 5DMXA 4KWIA 2HSDA 4I08A 1LC3A 3NV9A 4E2ZA 4DQVA 4IDBA 4ND2A 1OAAA 4YJFB 3ZNQA 4L9RA 4CQLB 2PK3A 1I10A 4B3HA 4CV3A 3A1NA 3ROKA 3QE3A 5TQVA 2NWQA 1I3NA 4O4IF 1GEEA 3DBRA 3S2GA 4YPOA 4RVHA 4JP3A 4HFMA 4C5CA 4YAJB 1NFRA 5AXBA 3WMWA 2A92A 3R1IA 4TMFA 2X8LA 3ZWBA 4PN3A 1UUFA 3QVXA 4WBNF 1LC0A 1KETA 1SPXA 3AWDA 3GAZA 2NACA 5HTOA 4YYZA 2D1YA 3LQFA 1F14A 2CNBA 4CM9D 2PBZA 1KY4A 3DBLB 3O8QA 4DPMA 2ZCVA 3IP3A 3LDHA 2ZB8A 3K92A 5DP2A 4DIOA 2HMTA 2NADA 1Y1PA 2D8AA 4XDYA 4CQMB 4NBVA 3RUFA 2QG4A 1JKIA 3HJAA 1A72A 3GR6A 4YCAA 1UDCA 1JW9B 4E3ZA 2GSDA 4DC1A 3F5SA 5G0SA 4AJKA 2B5WA 4TKLA 1DB3A 2NVWA 4H7PA 1NYTA 3PYXA 2P91A 4FIZA 1UXGA 1HDCA 2XOXA 3PZBA 1ZCJA 2P9EA 2X5OA 2BFOA 1BDMA 3NDRA 4WCDA 3PHLA 5A03A 4RCVA 1IZ0A 4MOWA 3ZU2A 4CM8A 4HFNA 3R23A 2D2IA 1DDOA 3JQCA 3GDOA 2FR1A 3JYLA 5KVSA 3ST7A 4MV7A 2QW8A 4O7ZA 2AXQA 1B3RA 1LDMA 2P4QA 3BMCB 3KXDA 1YB1A 3KZVA 2XF8A 4YACA 5DCYA 1E6EA 4UAGA 4NFSA 3GC6A 3DTYA 3VZPA 3TZQA 1F8GA 1OBGA 3U55A 1P1FA 1EDOA 3PJDA 4BNIA 5JCXA 4RVFA 6LDHA 4O83A 3VMMA 1T36A 1GUFA 3Q11A 2HJSA 3OETA 2FWMX 1C1XB 3ENNA 2AMFA 3I9MA 3GAFA 5LA6F 1SNYA 4BB5A 4GGPA 3WO0A 4MVJE 1CQJB 1GL3A 2X6TA 4O6VA 2VUTA 3JQGB 1SC6A 5LDHA 4WLEA 2O2SA 1VL8A 2OL4A 5J23A 4PLHA 3OQ1A 4GH5A 1Z75A 3ORFA 1PJ2A 2ZATA 3I9KA 3WGTA 2NU7A 2WJPA 2BFPA 4K6CA 4A0SA 1EVZA 5DULA 5EERA 2ILTA 3RC7A 4F6LA 4NNJA 2FN7A 3JRWA 1B2LA 4XQGA 2GN4A 3WJ7A 1ENZA 3ZZNA 2WYOA 1OFGA 1H9AA 1K6IA 3B1FA 1GU7A 3SLGA 4ITUA 4O84A 1BWSA 2VHVA 3ANNA 3RFXA 3BXXA 1H6AA 3U4DA 2VN8A 3VTZA 1VL0A 4ESOA 4YR9A 1E1MA 1P45A 1LDYA 3P19A 2NM0A 4CMIB 3DZKA 3HDHA 1JAYA 5FYDA 1FDVA 2Y1FA 4ILKA 2AEFA 4NIMA 4AJEA 1R37A 2UVDA 4BKPA 1ZEMA 4I1IA 4BUCA 3WGZA 1RWBA 3KAKA 2YDXA 3ZNPA 1ISMA 3FN4A 1VJ1A 3D4PA 3X2FA 3DEYX 3KYBA 4NJMA 2BMAA 2HRZA 1M66A 2D5AA 4LGVA 4OXYA 4L4XA 5GZ3A 5ICSA 1DFIA 3KUXA 4OKNA 4WLUA 3M6IA 4CV2A 1MC4A 5L95A 1XGKA 1EZ4A 1W4ZA 5A3JA 3LT0A 3W4JA 4YJHA 1NBOA 5H82A 3MCVA 2GRAA 2ZDHA 4O7SA 3EZYA 1MFZA 5CHEA 1XYGA 3NT5A 4M1QA 3SEFA 1SEPA 2J5KA 4RQTA 3P2YA 4YQYA 3DZBA 4H15A 4K1LA 4RZQA 1C0IA 1Z73A 2PGDA 4PZEA 1WP4A 3H3FA 3PYLA 4UUMA 3V1UA 1VI2A 1UXIA 4M9UA 4J6FA 1YKFA 2PKRA 3GPIA 1ULSA 1GYPA 3EC7A 2OHXA 1E5LA 1FDTA 3GT0A 1AGNA 4JBGA 3RFTA 4K9DA 2HK9A 2JKVA 3AM4A 2EKPA 3QA9A 1YJ8A 1LSOA 2EKLA 1CJCA 4E2WA 5L3ZA 2H9IA 4RPGA 3GDGA 3I5MA 3N58A 2B69A 1BRMA 4A5OA 2CY0A 1AXGA 2NU6B 3OUZA 4J3FA 3SXPA 1C1DA 4ZICA 2C7VA 3LYLA 3KHUA 5ILGA 1I24A 4WCFC 4IGEA 3NUGA 1E3LA 3VAZA 1B16A 4LRTB 5EESA 2Q2WA 3CZMA 1LXCA 4XEHA 8LDHA 4IJUA 1ZMOA 3KYCA 4NK5A 3VOSA 3WIEA 2ZYAA 1YQGA 3BTOA 2AE2A 4ZI7F 3GHHA 5F21A 1XR3A 3L0DA 5T5QA 1H9BA 3ETDA 5TRTA 1P74A 4M86A 3WIDA 3CH6A 1X1TA 3OFSA 4RGBA 1E7RA 2BGLA 3UH1A 4AJHA 2R87A 4YQZA 4D3DA 4DBZA 1JVSA 4FD3A 4PLZA 1UXJA 1LLQA 2JCVA 4JP2A 1HWYA 3H5AA 3PWSA 2EGGA 3BMOB 3LP8A 3KALA 3U4HA 1LSSA 5HM8A 5TS3A 5A9SA 1SOWA 1MC5A 5JBIA 4XYLA 4PG7A 3LT1A 4YJGA 1DO8A 2GQSA 1WDMA 1NAHA 3OECA 2G0TA 1NHGA 1GPJA 1EVIA 1LTHR 3GLKA 2PGJA 2X9VA 3FR8A 4IMPA 1SMKA 3N74A 4MP6A 1CQIA 1I01A 5KJ6A 1KOLA 1MG0A 5F5LA 4G65A 1IOLA 2I8CA 3D3WA 1NVTA 5JXWA 2JAPA 4F6CA 5CA0F 3CMCO 1TT7A 4IIUA 1CYDA 1G1AA 5I7VA 3IDSA 4NK4A 4FJ1A 4YAKB 2YZ7A 2C5AA 5C7LO 5ITVA 1P3DA 3IL2A 1LRKA 2DT5A 2HCTA 5CPFA 3KB6A 1EZ1A 5C37A 2VRCD 2Y1CA 2PR2A 2FY8A 1VBGA 1KC1A 3WTCA 1GCUA 2XAAA 4J7XA 2CVQA 4Z6KA 4TKMA 4FOOA 1ZUD1 1IHYA 4QO7A 4O2BF 2JCXA 3E18A 1ISHA 1WPQA 1FF9A 4R1UA 4CR8A 1Y8QA 2O23A 1YGYA 4J90A 1U2DA 4FOSA 3ASVA 3RROA 1I8TA 4TROA 3AOGA 3W8FA 2Z1NA 2Y1GA 2ZTLA 3VH2A 4C4OA 3AY7A 1C1DB 4HQ6A 4O7LA 2CDBA 4E2XA 1HF3A 1YB5A 3MJ4A 1YJQA 4CLOA 1UJMA 2IZ1A 1EK6A 3ON5A 1PJCA 2DQ4A 3PHJA 3I3OA 3H8VA 3V4SA 3G17A 3H3JA 3EUWA 4BO6A 5B4UA 3R5FA 2ZDGA 3MZ0A 4PFJA 4BNKA 3GN1A 1Y5RA 1Y9AA 3FNHA 4NJMB 3LZ6A 1O6ZA 3OF2A 1RKXA 3JQ9C 3ONFA 1QLJA 5BNFA 3ORQA 2RH8A 3B20A 2BF7A 3DB2A 5CB4F 4YB8B 1BXZA 1TB4A 5A5EA 4EEZA 3WQRA 4EJ6A 3ZI0A 4XQ9A 2GASA 2P2SA 4CJXA 1EEHA 4O7VA 4NFYA 1IHXA 3S1LA 5BMVF 1HSZA 5BSFA 2R82A 2I67A 3MJEA 3UCEA 1K6XA 1VKOA 5J2UF 3R0IA 4MVJD 1WW8A 5HS4A 2OXIA 3ZDFA 3Q6IA 4MP8A 4NBTA 2NU7B 4FGRA 1UXKA 3GRKA 2WYWA 5L9AA 3F3SA 4D45A 4Q3EA 1I2CA 1YBAA 3RUHA 2YHIB 1KYQA 3JQ8A 4LVUA 4P4LA 1YL7A 4GAEA 4ZQFA 2V59A 1P1JA 5IAAA 3WFIA 5JMWA 1ZVMA 2HDHA 1B0AA 1IY8A 3LVFO 3MWDB 3RCBA 1P0FA 3WNZA 1J49A 3PIIA 5L4LA 3ZGYA 4C7JA 3JQEA 4PVCA 5L4NA 1KVQA 2I3AA 1E5QA 1GQQA 2RAFA 1VM6A 1ZSYA 4LRSB 3QWHA 1T2EA 3GGOA 3E9MA 4FW8A 5EINA 1QP8A 3GZNA 3IMFA 1N92A 1PSDA 3D0OA 3BHMA 5L7TA 4JBHA 3S8MA 3JZIA 5BT9A 1P31A 2QX7A 3ZV5A 4Z3KA 4U0KA 1R0LA 4RLSA 5CP8A 4P4NA 1LDGA 2VRCA 4J4BA 1RYEA 3MTJA 1EYZA 1KBZA 2JD0A 4KQWA 3ZW9A 4J9UE 2PA3A 3WWYA 3GVCA 3ZWOA 2UDPA 4IPTA 4NJOA 2FP4A 4PIVA 2XXBA 2YZLA 4BNVA 3CIFA 3D1LA 2VCYA 3BYZA 4NPCA 2WM3A 4GLOA 3DBHB 4CMEC 2PH3A 4YT5A 2DKNA 5KOIA 1E1LA 2YRXA 4I9HA 5B37A 1BHSA 3PJGA 5IDQA 1LA2A 1ISGA 2G1UA 4BNNA 5TT1A 4KTVE 2I99A 1C3VA 4IIVA 4BGUA 4BNXA 3QVOA 2DZDA 1AN9A 5BSGA 4BO9A 4HFJA 4PLGA 1LQUA 3ROMA 1PQUA 3PWKA 2XXJA 3G0OA 3UUWA 4BNFA 5BNIA 1PGPA 3HB9A 2Q4BA 3NDJA 2C2XA 4XB1A 5COAA 4B4VA 5EQFA 2AEJA 1ULUA 4OMUA 4A7PA 4Z3DA 2GF2A 1U5CA 1DRUA 2CF6A 1ID1A 4MIYA 3TL3A 1LJ8A 3NJ4A 1GEGA 1D8AA 2VT3A 4FN4A 2PN1A 1NWHA 3N7UA 3NGLA 5FNVF 1IYZA 2V65A 5CG2A 3KETA 2GGSA 2X7HA 5TT0A 1BXGB 2OLSA 4G2NA 5H80A 1Q7BA 3KO8A 4CM5A 5L53A 4PRLA 5DZSA 3WBFA 2Y99A 3DMYA 1M76A 1ISJA 5TC4A 4D43A 1ZXBA 4OSOA 2C59A 4IZIA 4IHJF 4HNHA 2QIOA 3NUAA 3DHNA 4N5LA 1DBVO 4QO8A 5CPBA 5KJFA 3VZSA 1DC6A 1MG5A 4R41A 5KJ1A 3O03A 1PL6A 1OMOA 1U1IA 5HWSA 1FDSA 2IODA 2Q1SA 3ULKA 1GFSA 2B5VA 1HLPA 1NAIA 3RU7A 1ZK2A 4N54A 3KOUA 2VWQA 4II3A 1YB4A 3Q2IA 2GZ1A 3AUSA 1EVYA 1DAPA 4FGWA 2W4QA 1EVJA 4BV8A 5I9LA 3LK7A 2P0AA 4L1KA 4MVJH 1B6SA 4ZRNA 1E4EA 3GOHA 4C7KA 2O3TA 3QY9A 4URFA 2FPPA 3W6UA 1FK8A 3B6ZA 3ZU5A 5ICMA 5K0ZA 1ZH8A 2FZWA 3DAGA 2PFGA 1GV1A 2HRBA 3ZV3A 1MV8A 1OC4A 2SCUB 3DFUA 2OO5A 4RQUA 4UEJA 2B4TO 2Z1MA 3JQBC 3DAFA 4XD2A 1E3WB 4E6PA 3TZ6A 5K6AA 3CEAA 4J9VA 5J2TF 2PKQP 3GUYA 4E5KA 2R85A 3TIGA 4E30A 1JKJA 3HN7A 1DC3A 3H9QA 4NR0A 4I5EA 1Y6JA 5AQ1A 3C7CB 4J16A 2VTDA 3CUKA 4BB6A 4IZHA 1PEDA 5JVDF 1T4BA 2IYPA 5CEJA 1PJSA 4NBWA 3PHHA 5EJ2A 3LC1O 2OP1A 1GQ2A 2Z5LA 3W6ZA 4LMPA 4QT0A 4PG5A 2GZ2A 3HDJA 3C1TA 4NBUA 5T8KC 5A04A 2EERA 3KEQA 2OUIA 3ABIA 3EMKA 5I7EA 1ZO8A 4C5BA 3WX0A 1B26A 3AX6A 1E0DA 4W7IA 4OKIA 4ND3A 3PI7A 4XJTA 3BA1A 2PY6A 1U4SA 3D3EA 4EGJA 1FJHA 3K31A 4A27A 2I3GA 3V4ZA 2Y0EA 4AJJA 2NU9B 2X0NA 3AU9A 2UAGA 3H5RA 2VWHA 3STHA 3AY3A 1U5AA 1YL6A 1Z74A 1MB4A 3K8ZA 1HYHA 2JFFA 3G3EA 4MV3A 2NQ8A 1X15A 2VRBA 1Q2XA 3DOJA 3JQ6A 3I9LA 3K6JA 3QVWA 4GBJA 4IDEA 3WTBA 4NFHA 1KC3A 4RPJA 1I2ZA 3G8DA 2O3JA 3A28A 1ZFNA 3OP4A 4K26A 2VWGA 4DIFA 3NTOA 2HMVA 2E37A 3GG9A 3TF5A 4YAIA 4TVOA 3TFQA 1YBMA 1WLYA 5I7FA 4Z0HO 4B4WA 1J6UA 1V3TA 3GG2A 1IUKA 1I3LA 5JLAA 4BNHA 3RJ9A 1Y9EA 3R9RA 5AXDA 3U3XA 3IC5A 5U4QA 2YL2A 1FXSA 3I9OA 3TWOA 3I9NA 1XQ1A 4AJOA 2BI7A 4WLOA 2O48X 2Q50A 1PGNA 5ENDA 2AQIA 4EGFA 3UF0A 3JYQA 2CDCA 3R3JA 1QMGA 3SC4A 1JDBB 1I30A 2Q3EA 3F46A 5I9NA 2X22A 4PCVA 3W4KA 5ER9A 5CFZA 4MKRA 1O9BA 2GPTA 1CERA 3PDJA 3JQFC 5JQWA 4KUEA 3DZJA 5L51A 3U62A 3RQSA 3GN2A 1VJTA 1A27A 2Z95A 4XR4A 1VSVA 4ZQIA 2ZB4A 4OL9A 1DV1A 3ZWYA 3ETJA 2EGHA 2A9FA 4MPDA 2VUUA 9LDTA 3I52A 4BIIA 2HKIA 3AU8A 4ZQEA 1C1XA 4A73A 1YXMA 3MOIA 4PLVA 3BAZA 4ZA2A 5JAQA 4CMBA 2P68A 3EK2A 2WDZA 3V5NA 3WWZA 5ITWA 2HO5A 2FPGA 4EUFA 3OEWA 2B37A 5JE8A 4WPGA 1GADO 5AOVA 2FR8A 5GMOA 3QWBA 4A03A 2TMDA 1P77A 3MJSA 4X54A 3X2EA 4BNTA 1Z7EA 3GGPA 3RC2A 3K5IA 1MP0A 1MXHA 3ZHXA 1LSUA 3OM9A 2QRKA 5B1YA 1DIBA 1KERA 4NU5A 2W2LA 1W6UA 4EUHA 1HKUA 1LEHA 1BXGA 4ZJUA 3CMMA 3G1TA 2EJWA 3PQDA 4B7CA 2NNLD 1QLHA 4TQGA 3D64A 1MGOA 4TVBA 1PJ4A 4UEKA 1HDGO 1LLDA 1O94A 2J5QA 2Q99A 1PWXA 5JMPA 3RIHA 2DIKA 2R7LA 4IDDA 1E6UA 1WMAA 2HJRA 2C00A 1FDUA 1EUZA 3PPIA 3TQHA 4AJPA 3GY0A 4ROSA 5EN4A 2IXAA 4YAJA 1CRWG 3FPCA 3SJUA 2YUTA 3COSA 1XLTA 1R4NB 1D3AA 3OSUA 3PLNA 1SEVA 3JD4A 1DEHA 4Z9YA 4YJDA 1R15A 1KVTA 1ZSNA 3E9QA 3EZLA 3O26A 5JAIA 4RZIA 3QW2A 1EE2A 1CETA 4BNJA 3ZNNA 4ALMA 4R68A 3R5XA 1PR9A 3DQPA 4O7NA 4I5FA 3Q0EA 2RHRA 4GPD1 3H7AA 4CR7A 3EVNA 1R4MB 4WCFA 2C29D 4J91A 4UVHA 1DXYA 3MWDA 1PGJA 4MP3A 3VH1A 3WXBA 4OIMA 4B79A 3H5NA 1U8FO 5G0UA 2X9GA 4FC7A 5BSEA 3TZHA 2GUGA 4W99A 1DIKA 3GFGA 4HNTA 3PLRA 4DIMA 3U9SA 1Y7TA 4ALLA 4QEDA 2ZYGA 2AQ8A 4WECA 4FFRA 4R5HA 1DLJA 1BW9A 3FWZA 1HDZA 4XGIA 1U7TA 2DPHA 2NUAA 2PZKA 3HFGA 3H65A 5ENVA 5IDWA 2YS6A 2O7SA 3A9WA 3SC6A 1IE3A 2DTEA 4HBGA 5G0VA 1EMDA 4D79A 2C20A 1QYCA 3UAGA 1M75A 2DWCA 5BPHA 2AEMA 3WO1A 4HXYA 1PTJA 3EW7A 3VPFA 1I7LA 2QZ9A 3W1VA 2J3HA 1N7GA 3RBZA 2D5CA 4XB2A 1EFLA 2I76A 1DFGA 2Q1WA 3I1JA 5FI5A 3H4VA 2GN6A 2RIRA 3HFSA 3TIIA 2WTBA 3RD5A 4FJ0A 1K2WA 1KVRA 3KM0A 4YT8A 3OEYA 1KEUA 2Y0DA 4GSKA 5K9ZA 2ZQYA 2GDZA 3U9LA 4D42A 4JNKA 3L9XA 4Q39A 2O50A 3WYEA 4UREA 4PGFA 1AUVA 1A9ZA 1FDWA 2OGUA 4WLNA 1B8VA 1M0WA 1LDEA 3GVHA 3EAGA 3B70A 3GEMA 4MVJI 2QQ5A 1E3JA 2R84A 3KYCB 3ANMA 4OYRA 1WZEA 5DN9A 2R7MA 1JQBA 5C7OO 1A71A 2YS7A 3DDNA 3JD1A 3F4LA 3AJRA 4BNWA 2J3KA 5CDYA 4BKOA 3PIDA 4WK6A 2DUWA 3I12A 1YVEI 2V58A 5KTKA 1I32A 1ZKMA 1QG6A 4NHEA 3OQBA 4XZ3B 2PZJA 4U5QA 2PGLA 4TRJA 4AJ4A 1HE2A 3O38A 1HDYA 3LC7O 4CMCA 5H83A 3WSWA 1MLDA 1UR5A 4OGWA 4XYMB 1N8KA 1DRWA 1OOEA 1LSJA 4BQRA 2GQRA 1Q7CA 2NVBA 1NR7A 1GLVA 3HB4X 1HZJA 2JHFA 4FS3A 2EP5A 3D4OA 3HQ4O 2Y0CA 3KLPX 1YQDA 2NU6A 3C1OA 3IIEA 4FCCA 2W8ZA 2YZMA 4LSMA 3N6RA 1XIVA 1GUYA 4FR5A 1H2BA 1KJJA 2J3IA 2Y66A 5CDTA 1V35A 4Q3BA 3OUUA 2EP7A 4FC6A 2RCYA 4UVIA 1NM5A 5G4KB 1ADGA 5C1PA 4IJVA 3NEPX 4UUPA 3RWBA 4BQPA 2GN9A 4QQRA 1H5QA 4BMNA 3UVEA 4OXKA 1B7GO 4F46A 2VR1A 3GNSA 3IUSA 4JCOA 4MVJF 3GF4A 1TA4A 3E8XA 4J0FA 3LC2O 3UHAA 1K5HA 2WD8A 3S2IA 4L8VA 1EBFA 2W71A 1T4DA 3A06A 1J0XO 2W2KB 3NTQA 4QSMA 2YFHA 3WG9A 5JO0A 1ML3A 3GRPA 3ZNOA 4NH4A 2VQDA 2C82A 1W8DA 4FFOA 5L7YA 4RO0A 4CODB 4CQMD 4WLFA 1ADFA 3AI2A 4YRBA 8ADHA 4L74A 3C85A 4I55F 2ZCUA 3ITDA 5GY7A 3GDFA 5KVVA 1VBHA 1LLCA 3U0BA 1HLDA 2FPIB 3M1LA 2CNQA 4W9NA 4E5YA 1CIVA 4E5NA 3AUUA 1T2FA 2DC1A 2O2YA 2ZIZA 1HETA 2C5EA 1VSUA 3E5NA 2JD1A 4ZN6A 4J0EA 2AA3A 4WKGA 3OJLA 4ND1A 2CVOA 4IINA 4JX8A 4OM8A 1X0VA 2BFAA 5JH7F 4BO0A 2W2LD 2FB9A 3H2ZA 2B0JA 4E0BA 2X9NA 4KP7A 3HADA 3OA0A 3DZIA 3E9NA 1N2SA 5LOVF 4KDEA 3ZWCA 3CKYA 3INGA 1R6DA 2FPIA 4DLKA 1DHRA 4GWKA 2V6BA 2OP0A 4W9NC 2NVUB 3ANLA 5THKA 2P5YA 3DZGA 4R69A 5HBRA 3U54A 3VPBA 2YYAA 3HHPA 4BV9A 2PZMA 4KOAA 1GGOA 1A9YA 1A48A 3R6DA 3WDSA 5B12A 1ENPA 4NU6A 4S3MA 2P5UA 4J4HA 4R51A 1OC2A 4RPHA 1U8XX 2YWVA 4QFCA 4EBFA 3VTFA 5C7IO 3ZHZA 1EHIA 2E82A 2VPQA 1WXDA 4O1MA 3WNQA 3OQ6A 4S1VA 1DC5A 5AVOA 4L4SA 3PHGA 3RUIA 4YBZB 1BXKA 3F47A 3QSGA 4MV8A 1HZZA 3VZQA 2DUUA 1D4FA 3U5TA 5EIOA 3RUCA 5JS6A 2DBQA 2GPSA 2JJYA 5T57A 5A9RA 5I9MA 4QTZA 2QK4A 1E7WA 1CS0A 1KJ9A 1JLLA 4Y9DA 1UAYA 4FDAA 2YFQA 1DIGA 4UULA 1M0TA 2EW8A 4MV4A 2GERA 1V3UA 1GCOA 2R7NA 3F4BA 3GH3A 1BVUA 4CL8A 1XSEA 2P9GA 3WQSB 2VHZA 4UUNA 3RC1A 2D4AA 4JN6B 1NQ5A 3D7LA 1C14A 4IDGA 1UZLA 1PGOA 5JFOA 5CDGA 3AI1A 2J6IA 4M8SA 3C24A 2YQ5A 3R5HA 2C54A 1JDJA 5DCWA 1YS4A 1ZXLA 1IPEA 4EJMA 5EZYF 5A06A 5TLSA 4XYEA 3GPDG 2G76A 1MUUA 2W6NA 2HMWA 4GX5A 3EHEA 3UCFA 2XPCA 2O4UX 4W6ZA 1X7DA 2B35A 1LX6A 3PEFA 1SO8A 4U6QA 4R5MA 3S55A 3W8DA 3AUTA 4N18A 3TINA 1NPDA 1GY8A 1P33A 3ZH2A 4DQXA 1ZK4A 3ETGA 4YAGA 2DBZA 2BGMA 2HAEA 3M2PA 4D44A 1UDAA 4PZDA 4RVUA 3OBBA 4FJ2A 1B14A 2YDYA 1A5ZA 3L4BC 4J7UA 4D3FA 3A4VA 4BNUA 1M2WA 4Z9XA 4KUGA 4BHTA 4DL9A 5IZCC 2F1KA 4G81A 3UN1A 3W8EA 3D4NA 2X5KO 4EDFA 1NNUA 4D3SA 3PJFA 3Q1LA 2BELA 2E6UX 2Y67A 2PV7A 4J49A 4Y6SA 1CWUA 5D8DA 2O3QA 1LNQA 4HADA 2DPGA 4E13A 2GO1A 3PK0A 4R16A 1OBFO 4D46A 2OOSA 1E3SA 4M89A 2GPWA 4BO3A 5KKCA 2YJZA 5FI3A 3PQEA 2ZJ1A 3TOXA 1UP6A 2X5JO 2ZJ0A 3FF4A 5A9TA 3WNVA 2JCYA 3JRXA 5TX7A 2HQ1A 4F45A 2R2GA 3WGYA 2WD7A 2CDAA 5BNTA 2Y05A 2ZDQA 3D3WB 3HUDA 4NZ9A 2PVPA 1GDHA 4BMSA 5DOZA 2UUOA 3ZWXA 1ZSVA 2B4QA 3WYBA 1E3WA 5KNLA 1NP3A 3T4XA 1XA0A 2G5CA 5CDSA 1VPDA 3DZFA 1Z45A 3H9UA 2CVZA 2NSDA 1LBEA 3RUAA 1BW9B 3RUDA 3ZWAA 2X0SA 1CDOA 3GGGA 3GNQA 4M87A 3ZN2A 1TI7A 4MA0A 3KSZO 3E6AA 1DIHA 4R54A 5JO9A 1NPTO 1U7HA 4I50F 3OHSX 2VHXA 2IYOA 4CQLA 1ENOA 1RM3A 4RLHA 1PZEA 4Q3DA 1QR6A 3WGOA
chains in the Genus database with same CATH superfamily
4RF5A 4XIFA 4FP9A 4BN0A 3D2AA 2HG8A 1UXOA 2Q45A 2VYFA 2FFBA 4RTSA 1W9MA 2IU4A 4KRFA 1ZNZA 4W1RA 3AERB 1H2ZA 3DR3A 2BGRA 1VBFA 1IQRA 2AFIB 5L40A 3TZCA 1GNTA 3QPUA 2CHEA 4JJ4A 3OPYA 1OYVA 2W6JA 1DIAA 5DV9A 1ODSA 3B12A 4KKXB 4QYMA 3DF7A 1J9GA 1KS2A 3O4RA 1US8A 4KXFB 3KSUA 4AICA 3AOEC 1D6NA 3P9IA 1IH8A 3C4VA 3JWGA 3B7PA 4IQGA 3R5TA 2NG1A 3G02A 3VISA 3WHPA 3ZCTA 5DN6D 1TO2E 4XZ3A 5AKHA 2AXPA 2IHKA 4F3CA 1UBNA 1ZL2A 1XK5A 5DI9A 4UTNA 1JMYA 1EP2B 1RRKA 4TQUS 2QPLA 1S2GA 3FNFA 1QHNA 2R66A 1WCV1 5T7BA 4WA8A 1O6CA 1QPGA 4PY2A 3GV0A 1PJBA 2HLPA 3MBKA 1BX0A 1GRNA 2CYBA 2DVMA 1QKIA 1M8KA 3HCDA 5JCOA 3AFIA 3K4QA 4YIKA 1P2GA 3OMLA 1F3OA 2H1SA 3LOPA 4O4LA 3GJ5A 2COJA 4MRMA 1LRJA 3HLTA 1QIEA 2WC1A 5I3CA 3LD9A 1C3OA 3AOEA 1OTYA 4D3ZA 1CSEE 3B3JA 4DREA 3WGIA 4R9VA 4L0QA 4AS2A 5IJXA 2DAPA 2JH8A 3CUUA 5BWWA 3WL7A 4FZ5A 3K2IA 2AKYA 1NHWA 3L8CA 3WB0A 1W4CA 3QFHA 2KHZA 3AM1A 5A9SB 4B80A 5A1JA 1TM1E 5AWFC 1XZ8A 3A1VA 4J2OA 2HGZA 1J1IA 2JLCA 3R7FA 2VNHA 1PQWA 4FT2A 2ZE5A 3RFCA 2YJGA 2X7JA 3CH5A 5FO0A 1QG0A 1NNSA 2OCKA 4GQAA 5GJCA 3ZQKA 1I2LA 3G9QA 3A6GA 1VHJA 1KARA 5M29A 4UU0A 4L4RA 4RFSB 5E4JA 5T67A 2WP8J 3QEBZ 2NAPA 1VCMA 2CWDA 3KNZA 4LW8A 1TLTA 4YT2A 3CLUD 4XSGA 4B3IA 3HZRA 4B83A 2R7KA 4KWTA 5G1NA 4D4GA 4OK6A 4QOEA 3H1EA 4I4LA 4XRRA 1FA9A 2RGNA 1EWVA 3F98A 3G49A 3OQHA 4CEJA 1NVUQ 1P9WA 2Q07A 4MWBA 1SUIA 4KLNA 1ULTA 4XB6B 4YRDA 3NM4A 2V5UA 5FF9A 4BMDA 2OFPA 1I7SB 1I7NA 5AH0A 1VIYA 1IB6A 4Z49A 2KLHA 2YUIA 3ICPA 3PGA1 4YT4A 2MINB 4LE0A 1P39A 3RVLA 1VL6A 3LCJA 2PZ8A 1WEHA 1O5IA 1TOAA 4FNAA 1QCCA 1G6HA 4D82A 4HDCA 3MQFA 3JATB 2XB8A 3EH2A 3IEMA 2B4AA 4KTTE 4AUKA 5LQRA 3QX9A 4HPJB 2AI1A 4HC4A 3DB1A 2WTMA 4IQ0A 2RARA 1JQKA 3JASB 1LNZA 3Q7PA 4MR7B 4MMYB 4Y8VA 4CLEA 5I6DA 5JZMA 3PNQA 4ETMA 4DLLA 3WGHA 4QU9A 4UEOA 2AVNA 3ANSA 5BW5A 5K6RA 1U0OC 1SAYA 2DFDA 3C16C 4YONB 2P9CA 4S1TA 1N2ZA 1OZAA 2C04A 3M89A 1C0KA 1KS9A 1NMYA 1P7WA 2QX9A 3HI4A 4V02A 3SZMA 1HLGA 2FVYA 4LQ4A 3WC4A 1UJBA 3TGLA 1Z6ZA 1O95A 1DHTA 5FR2A 4TMXA 1Y80A 3PIRA 1H0KA 4DA9A 4AG3A 1TT5B 2IEAA 2AQHA 1DAEA 2AFIE 4M7RA 4FNMA 1H05A 5H3LA 2HR1A 4PSUA 4AKHA 1J07A 1GSAA 4F5EA 2ZRBA 2CN1A 4GD3Q 1BN6A 1TF5A 4IS2A 1N1EA 4JBYA 1YB2A 4ZQGA 4FDMA 3UZUA 4D26A 1FS5A 1UJ5A 3IAAA 4KQ6A 5NULA 4B4OA 5LD2C 1FRQA 3W1BA 1HMPA 2WMDA 3BJMA 3ICOA 1I6KA 3QJ5A 4M0LA 1CKMA 2QJWA 3L4SO 1DAFA 3TTYA 5CLHA 3QJYA 4CF5A 1P4JA 4BO1A 2H4YA 2EYUA 1AQYA 1YMVA 3U81A 4I8XA 3ZJUA 4IW3B 3T9EA 3TKYA 3VYWA 3K9GA 1U2QA 5K8CA 5KSOA 1ARZA 3UO8B 4EFKA 2OR3A 1VJ0A 2CEKA 5KNCA 2Q0QA 1AMUA 1C0EA 2XZPA 3U9TA 3SFZA 4N12A 3Q9UA 4ZWNA 3WLTA 5AK5A 4J7CA 5K8UA 3NW9A 1Z0JA 4PC7A 4JH0A 3CR3C 1UEIA 1Z83A 4BOYA 1BXRA 3HZHA 2JBAA 1VLLA 1DX6A 3INTA 4KZPA 3GFVA 3GVXA 2FSUA 4OHUA 3SLKA 1RJWA 3DTTA 3JYPA 4JHXA 4K6MA 1NDQA 1G8KA 1OX6A 2OKCA 3IDFA 4WE3A 1C9MA 4NG4A 1CRLA 3IT0A 1F20A 1XVVA 3QQMA 2C4MA 1FNDA 3TNDA 1ISFA 3BMQA 4LHSA 1Z35A 1SUEA 4IEEA 4YIHA 3PRJA 4I5GA 4BMYA 3UTDA 4BC0A 2ZK7A 2WSMA 2IYRA 5E38A 3TTTA 2QTRA 5LD2B 1ESNA 5KS2A 1WRVA 3K71B 3QKSB 3I9FA 4PYRA 4KYTA 4EG1A 5GGYA 1NJ1A 4KBYA 2HGSA 3W7VA 5JEDA 3WJAA 5CVVA 1I5RA 1OBDA 5JECA 1LTKA 5LFAA 2H2FA 1YFZA 3HYLA 4RJKA 1U98A 2CHVA 1VB3A 1U1DA 1FYXA 5EP3A 4AUEA 2JFYA 3TOZA 3OEHD 5IN4A 3DMRA 1K7CA 1F51E 2PUJA 2GHRA 3LKZA 1B8PA 1IZ9A 1WVGA 1T8RA 3DP7A 3KVOA 4RDIA 4AJ1A 4AL4A 1LRLA 3E2PA 3TUZC 2HPVA 3CF4G 3R3ZA 5CLLA 3GD5A 3IAHA 3EN0A 2FMIA 3C43A 4OB8A 5IVDA 1RM5A 4GECA 4K9SA 1LPNA 5EWMA 1D2HA 3R6LA 1HE4A 3O75A 2FXIA 3R8FA 1MN6A 2X4IA 3K5HA 3BABA 1D1SA 2D2FA 4GWGA 3L4BA 1EFPA 4QHTA 4A15A 3SU8A 4B2LA 3P71T 5CUQA 2GZMA 3T4UA 5G3ZA 1QBGA 1QRDA 4TXMA 1J39A 4MVJG 3NIWA 2DFVA 5JSQA 1N33B 1AHPA 5FPSA 2PRKA 3VVLA 1GZ3A 3HN2A 4K9MA 5JD6A 3CPSA 1VE9A 5EMHA 4J0DA 4KVAA 2D13A 5ALDA 4YJHB 4CM7A 2LGJA 4FHEA 2CUTA 4IJ6A 3DLCA 2FZVA 1S7CA 3L1HA 4U7FA 3THOA 3TPCA 3EYAA 3TEJA 5BPFA 1NYLA 1SKYB 1Z12A 3KPJA 4L9WA 2P3SA 3VNSA 1NVWQ 3PDUA 4MW6A 2UYCA 1CRQA 3JZAA 1RQ7A 4X1KA 2CHFA 1RRCA 2FPKA 4OGFA 4M1SA 5CVJA 2C7PA 1H8ED 1V9SA 4Y2JA 1QFMA 2J08A 4XDZA 3ANTA 4DLZA 4F4CA 5T6BA 4MUGA 3WMFA 4HI0E 4CPDA 1KIAA 5FTKA 5E6RA 3K05A 4PLPA 4DQKA 4O7TA 1OH7A 4K9PA 3PEEA 4U8GA 2BVNA 4AJ9A 4NAVA 2A1UB 4P2BA 4ZARA 3ZHBA 3D6HA 1FFXB 4G1CA 4Y1GA 3EE6A 4AS1A 4OQ4A 3EDQA 4BRZA 1MH1A 4WBXC 2FPSA 4LDRA 3NANA 5TIIA 1HT0A 1FFBA 2UXDB 4YC7A 1SGWA 1TM5E 2X4GA 3GMSA 1V8FA 1C3XA 2XBMA 3V8RA 1BOFA 3TR0A 2BGNA 2W11A 1X7YB 3ZY6A 5BYBA 1VBNA 3S1AB 2NTNA 4TL7A 3SYMA 2COGA 4F56A 4XTCS 2VZ8A 2GR9A 2CJFA 1GPDG 5J1TB 3EY9A 4RVCA 3GHYA 4ASUA 3U7RA 3HDYA 5F7ZA 2CKDA 2GZDA 3A31A 3K73O 4TUYB 4WINA 3T5BA 3Q88A 1Z47A 4HGOA 1I4TD 2REQA 4E7OA 2F00A 4GXRA 1RAIA 4U2KA 3WV5A 1F4LA 1GNSA 2QF7A 3IE2A 1FMTA 2VJDA 1IOVA 3A3YA 2CJXA 3FDZA 2I62A 5C18A 3WLAA 1OBCA 2PKXA 2DXIA 2H06A 1QH8B 4UATA 4JBXA 2WFZA 3V4LA 2OPBA 4FYHA 3SZLA 4CG1A 4CMHA 3KQOA 3W9UA 1YK1A 4J1NA 1GZ6A 1RI5A 1U3WA 1ATZA 1EUYA 1TJPB 4GZLA 4QWWA 5FWYB 5K20A 1CF4A 4H3KB 4TYWA 1YFJA 1XKQA 4BP8A 5FBLB 1N57A 1CFZA 2GK7A 2QD2A 2P6OA 3KJZA 2VPXA 3P7MA 3Q85A 2ID8A 2E48A 3DBVO 4IFEA 3Q9NA 3C3YA 1CY2A 2A33A 5BQPA 4BBJA 4Y2XA 1A2QA 2P2NA 1BROA 1JFLA 5AKZA 3GCGA 2X0DA 4E31A 1QYXA 4NYMQ 1L8OA 2O0MA 4INPA 1DO2A 2BFMA 1SVUA 4J1SA 4P98A 4D1YA 1JLSA 4GLBA 1J4AA 3KE9A 3HYRA 2I78A 2ONZA 1E5TA 3LQ2A 4CKCB 2PLWA 1VSTA 4J4TA 5TQJA 2WU0A 3ADCA 3Q6NA 3R0ZA 1NJGA 3MJVA 4I14A 4W82A 1FSZA 4JB8A 4Y9SA 3U3RA 1WXEA 4BQEA 1GYRA 4GSYA 1EZZA 2Q9AA 4QGHA 5GONF 1D0IA 1S2NA 3EUEA 2ZWPA 4DNXA 1LV8A 4FB4A 4PG6A 3RSFA 1TW3A 3GJ0A 5TMBA 2PXCA 3STVA 5BNWA 3MTBA 4KACA 4PM4A 4O7WA 4B31A 1XU9A 3B1KA 4M1OA 4A26A 3F2VA 3HO8A 4WOKA 2ZT5A 3H2SA 2DPYA 2LV8A 4Z7JA 4BYGA 5I5TA 1M67A 4G0WA 3VOAA 3L6DA 4LSWA 2MSEB 4XX0A 3GLFE 3OTOB 2AZMA 2PTGA 1ISIA 3OH8A 4E09A 1WCIB 3WWOA 1W85A 5BWMA 1XXHE 3FWHA 1BZYA 3LIPA 1HNXB 1CUSA 1TGVA 3USES 1H8EA 1R0SA 2ZQ5A 3L41A 3U3JA 1HDOA 2NO0A 2N3ZA 1T26A 1ZC4A 3IMEA 3EXAA 4CMJA 4CU2A 4JLJA 2DFTA 4QDTA 2R4QA 1ONPA 7REQA 2PD6A 3KAJA 3IQHX 2HXSA 3DYIA 3QEMB 2C2YA 4DR3B 2PUDA 1QTQA 2R48A 4IGAA 1VHQA 4E21A 2NUAB 1XRQA 2P90A 3ZLJA 2WZQA 1R0XA 3NKLA 4QFDA 3HKCB 2C3MA 3U3DA 1J8VA 2Z02A 1E2NA 1RRVA 1YRLA 2JGAA 2YJTD 3FOWA 4MGHA 5A71A 3VPSA 4CUZA 4YJ2F 2PZEA 2V6MA 2VP6A 5ED4A 2BMWA 4P4GA 3ZWPA 5CYOA 2PUBA 4C4ZA 2QKYA 3MCAA 1W76A 3PVSA 3GB9A 1NJSA 3WS7A 1D4ZA 1XWFA 1KWKA 3PR3A 1IK6A 4HGNA 3BIXA 3ZHYA 3QX7A 1JEQA 5A5FA 3I92A 1JEDA 4NE9A 2IYVA 1V95A 4YI5A 3DNMA 4MKXA 2XZTA 1RRFA 4ZV7A 2IEGA 1DC8A 1AN0A 1NTOA 1LLUA 2H48A 1IWPB 2P67A 1ODLA 3DMNA 5F1YA 5C1DA 3ZJTA 2Q1TA 1HRDA 4YJ3B 2PUWA 2C9OA 3IUBA 4IDQA 4DG8A 4FGZA 1YO6A 5E7MA 3BD7A 2PU5A 4XWTA 4XWKA 3DKPA 3IUPA 3SIPA 2GKGA 1KK0A 2NUTB 4S1PA 1FSSA 3O73A 3UWSA 3PGKA 4CHTA 4DVGA 3EXFA 2HUPA 5D7NA 2EQ5A 3HBMA 2WD9A 3YASA 4QU8A 3DL2A 3L1UA 3LP5A 3WOVA 2QGNA 3COVA 3E7XA 4INJA 3EXIA 2EHDA 1TYCA 4P1ZA 4Q4AA 2C1XA 2GBLC 1BE1A 2PRZA 4IMJB 2XJ9A 3T34A 1P9LA 2QAIA 3L0OA 4IQ4A 4H1UA 1BEUB 3M9WA 4R2HA 1WB9A 2VG8A 4GBGA 2ZI4A 3SSMA 1RT9A 3VVMA 3DOOA 5SZKB 4JENA 1C3EA 3V34A 4TV8B 1IULA 2IKSA 2PBFA 2H7YA 2WYVA 1FX0B 4BZWA 1XTTA 4KMMA 2IBTA 1E7YA 1PT7A 2W90A 5C0OE 4OLFA 1Z5GA 4F3RA 2B7BA 4CLRA 1DGSA 1SQ6A 4EGCB 5JUWA 3NX4A 4KB5A 3ZK8A 3JPWA 3FZNA 4K6FA 1NR1A 1PZFA 1ZD3A 4XLZA 4TV9A 1XNRB 1PG0A 3PENA 4ZEXA 2AOTA 3H1FA 2I3DA 1E9FA 3T5TA 3TDKA 1ZOOA 4DMKA 1WXHA 4TTIA 2Z04A 2I7DA 3RVQA 3MSCA 4AFNA 3DEKA 5TJHA 5E9AA 1M0EA 2WHPA 4KN6A 2D6FA 3DV9A 1ZC3A 3K15A 1W73A 4KJXA 1C0LA 3NYWA 4BRUA 2YWXA 4JLAA 4EA8A 1XAGA 3A6FA 4OQLA 1Y3IA 3VO1A 1UP7A 4NMWA 1UDBA 5F12A 1HYEA 4CDRA 5D1HA 2XNKA 2QD5A 3NP9A 4QBFA 3RSCA 5TGTA 2H18A 2RHGB 1Q16A 3EQ9A 5A4DA 2PWPA 3EEYA 5F1OA 3GDHA 3BTVA 3HBFA 4CQNA 5CG1A 1S4QA 3KPUA 1F1JA 4FCVA 4EARA 2KI5A 5IMSA 4JODA 2Q7XA 3EEOA 3H13A 1DRJA 3DW1X 3RB8A 5LOVA 4P80A 1JFFB 1VLHA 4R2WA 2ODBA 4O4LF 1M7HA 3ICWA 1B6GA 2IDMA 3SOPA 2WJWA 2V96A 1OR8A 1JAXA 1N5OX 3U7QB 1RE1A 3NYRA 5LXTB 1M9NA 1G98A 5KWVA 5K3FA 5I8WA 4IS3A 4ZOLF 3CIOA 4GKAA 4TGLA 1PWYE 3Q2KA 4POOA 1IXSB 4CDNA 4JJEA 5DT9A 2F48A 1H2YA 1R5JA 2Q2UA 3HM9A 2A5JA 4RFSA 1GKYA 2IP4A 1O6BA 4TZKA 2BGKA 2Q4OA 3CRRA 4R31A 5CJPA 4HX5A 4I1RA 1OZFA 2PU7A 1V8ZA 4KXNA 3FCCA 3L8EA 1F8FA 5BV8A 1IBLB 3O3OB 4ZT4A 1SXJD 3KJHA 4F7DA 3RSOA 3TTXA 3U4IA 1EVEA 2H2GA 4DAAA 2X5NA 3EEQA 3V80A 2GT1A 4R40A 4JHLA 1KC7A 3MMNA 1UBFA 1AUPA 2P2YA 1PR2A 3T9BA 3K3PA 1UK9A 2H00A 2VK4A 3AI3A 4DCGA 4EUKA 1Y5MA 1OT3A 5E2AA 5B3AA 1Y0BA 3I23A 3PF9A 4LCJA 5THQA 3QBDA 4RF2A 4W9RA 4UVEA 3EPHA 1B74A 4LOIA 2G1AA 1FEZA 4NG5A 1U65A 1DBIA 1Y1RA 4K87A 2NZUG 2XRYA 1GT91 1ZK0A 1WCIA 1TKRA 3B6MA 3BGOS 3X1XA 3CUTA 1UODA 3L6UA 3VPCA 3FFWA 3HY6A 3PHIA 5JYEA 2FUKA 2ZUWA 4JVNA 3R76A 3A3NA 1ZIYA 3MXOA 1BDBA 5L7WA 4KO3S 5BWXA 2QQFA 2WUGA 3ZDDA 1W19A 4Y6RA 1J2UA 2RHCA 2BFDB 5IDXA 5K3BA 4CIYA 1ZJJA 4C7VA 5K0CA 3RR5A 1P0CA 1EQUA 4P5PA 4KR3A 1PR3A 3W79A 5GZ6A 4TTAA 1S3GA 1DOZA 1AQIA 1FJGB 2HVSA 1CUVA 1FMJA 1DV2A 4YRMA 4ZVOA 2C5LA 3VKHA 3CEHA 3REQA 4YB8A 2BM9A 3OZ7A 4A8JC 1RLMA 4FSHA 1DLIA 1KMMA 4GI1A 3NNNA 1S9DA 3GVPA 2X5RA 3GYGA 3QLJA 5ALLA 3GGJA 4CMIA 3GRCA 3ENKA 4OB6A 1JEQB 1ORRA 2BBSA 2FE4A 4D0SA 4KNYA 3QFFA 5DNEA 2P4EA 2ZRJA 2WT4A 4NMLA 1VKZA 4R3NA 4RADA 1NL3A 3QW4B 4M0EA 3ZDBA 2WWFA 3MA0A 2XD4A 1PBTA 2Z5GA 4DR4B 1ANKA 1ZUHA 1GZ4A 2WWRA 4EJSC 3L79A 3W2FA 3ZCUA 1RAAA 1PLLA 1BEEA 4DMUB 5JQGA 3PXCX 4L8GA 2YN2A 2X13A 2AK3A 2CFIA 2ZJZA 3OESA 1PTJC 4LY6A 4DARA 2HK6A 3LI2A 3DEAA 1AHNA 2C07A 3JR7A 4WVFA 4HH0A 1EHYA 5H02A 3QXHA 2RK6A 1NNEA 3LQ1A 5KYXB 4BQNA 2R00C 3DMTA 3N7TA 4NARA 4DMGA 2C7QA 1VLMA 2A5LA 1C3OB 3PS9A 3RUPA 1LDNA 2XQFA 1DZ3A 1E3DA 1XELA 4FX2A 4DSNA 1X14A 2A9OA 2PZBA 2CL7X 2FR0A 3DZDA 4MYCA 1Q12A 4YO7A 4CFZA 7ADHA 3A04A 4B17A 2XWBF 3KRTA 3KVYA 4ZRMA 1C3JA 1FUIA 1L7BA 1S7GA 1X9GA 2B6NA 2NZVG 2XOEA 1KTIA 3HM2A 2AF4C 2W2QA 3BQ9A 2NSHA 4TMWA 3SZ3A 5JZ9A 1MX5A 4FFWA 1JWBB 1R7RA 2R2AA 3HJGA 1EX1A 4XQCA 1DJQA 4TYMA 1UFVA 4KVZA 1IPFA 2XMSA 4UVDA 1C30A 4UQOA 4H4EA 2VSYA 4MLCA 4N8SA 3RBAA 2VT6A 4M2LA 3TLCA 4TRNA 1A5TA 2HZBA 3NGXA 2HQOA 2F55A 5EKDA 1T5SA 3OJEA 3GBVA 1RQRA 4EUSA 5D2CA 5HE8A 2VO1A 3ET4A 4TMVA 5A05A 4C0HA 3EH1A 3WRVA 2JRCA 3ITKA 1W5TA 1USWA 1XZIA 3NZEA 2CLOB 4C4XA 4DQLA 5JH7A 1JU9A 2HADA 4K86A 5G0WA 1KHTA 4ODIA 3Q1KA 1AHIA 2O52A 1QGOA 1U28A 2CE7A 2QAGA 2ZQZA 4QXQA 4GR4A 4B9EA 5AIBA 2H51A 4BJ6A 4B85A 5H8WA 2OGSA 5CA1F 3IFSA 4OJNA 3THYA 3P5SA 2VYCA 3OZXA 1EUDA 4Q3KA 4CMEA 5AVWA 1E6KA 3L0YA 4CKXA 4DLTA 2QTVA 4Q3CA 2IS2A 1MJ5A 2O3UA 2IPMA 5AHOA 4BVLA 5AVZA 2PLFA 4CMAA 5F73A 1TF7A 4FDTA 2CNKA 4DEYA 4Q18A 2ENWA 3AEUA 1R4NA 5HZKA 3MFYA 4NS1A 1FW8A 1HT3A 4PHGA 3ZIDA 2N46A 3F7OA 5D3MA 4UCOA 1BO6A 2I80A 1MX9A 5TF0A 2OD2A 1PX2A 1G6KA 2J7KA 2X1HA 4GRIA 1CYEA 1H6CA 3OU7A 5FFFA 5CCXA 2PAFA 1JSLA 2G4CA 1EDZA 2UV8A 2G6BA 5CLGA 2LR0A 4N40A 3NETA 3QWFA 2H9YA 1ORDA 4XLTA 2ZJ2A 1M1NB 5T4FA 3UT6A 5CVUA 4EAAA 2WSSD 1EESA 3KWLA 1BNCA 3H87A 5ETJA 3W9BA 1S2OA 2QQ0A 2Z2JA 4RD4A 3ZY4A 1I4DD 2O7QA 3A58B 3S68A 4W5WA 1XRSB 2ZYSA 2ZROA 2DULA 2XAUA 1C7FA 3L84A 4KI7A 4LJAA 2AJCA 5HKBA 1H1TA 4OUKX 3H9JA 2YBEA 1CUJA 3D54D 2E85A 3ILYA 4QECA 3WYNA 4E5VA 1XRJA 1FOEB 2ZS7A 3B7GA 3VSAA 3WLNA 3FTNA 2RHDA 4CUJA 1YVDA 2QRQA 2YN0A 1VA5A 5JCJA 2TMGA 1E8MA 3M0EA 3RTGA 4CLXA 4JEHA 3UMFA 4EB8A 3HA3A 1NQVA 5TY0A 4CI0B 4H7JA 1CPYA 4EW6A 1F0NA 4GXQA 1UZMA 1ECFA 1U0EA 2VJCA 3HYSA 4P86A 3CR8A 5T3UA 4D2IA 3BD9A 2B8TA 3FBGA 4DC0A 3I73A 2FFRA 1DAOA 3GT4A 5CB4B 1MA3A 1N36B 1RKVA 1NIPA 1KAEA 2C0CA 3RODA 4BMXA 5JI2E 2UVPB 4WI1A 4G4JA 5DP1A 4R9UC 4UCXA 2F7SA 3BJZA 4YXFA 5CEEA 1Y82A 1IL0A 1ADBA 3KR2A 4N49A 2XGMA 3KKQA 4AMYA 4QTYA 1ORIA 4ZAYA 3R3SA 4P34A 2JFUA 3FPBA 3KHSA 1FSGA 2EF1A 2JGDA 1JGTA 2YWRA 4E33A 5JMTA 4HLUA 4FEEA 2QTLA 4JBWA 4PX5A 3WP0A 2E87A 4KE9A 4UQPA 3QWIA 2SBTA 3CZRA 4K2HA 3ICQB 3ZCXA 3ESAA 4OLBA 4TV8F 5ALKA 2H16A 2YQ4A 1SK9A 5E1MA 1KP2A 1PJ3A 1FXWA 1U8EA 3KZCA 5JXIA 2YY7A 4PAGA 5IH3A 4BJ3A 2P2DA 4Y6GB 3KYDA 1X7ZA 1OWPA 3OQOA 3FVQA 1G3RA 3OZEA 5ALRA 3A4MA 1PK8A 1IFXA 1NBAA 1WSAA 3DXFA 1R27A 2C2ZA 1IIBA 5L45A 2X6RA 2ILVA 4NMHA 1BVRA 2KYRA 4QDKA 4N3BA 2WB4A 3BXHA 1DJNA 4LJ5A 5G53C 5HIAA 1TD1A 4O63O 4L5JA 4YMGA 1U2PA 4Z7QB 4KHPB 4XM0A 1OXSC 1J7KA 4QYIB 3V48A 4AF7A 4RORA 2D7DA 4AY4A 1BX3A 3B38A 2NLOA 1BVYF 1V6AA 2O4CA 1JDNA 3AIMA 3RGWS 4H0FA 1NFQA 1P91A 1GAWA 1D2AA 2JGMA 1QYVA 2ROQA 3IBSA 3FSEA 3B1XA 3M1YA 4X93A 4D6XA 3PEWA 1TQ4A 2E5WA 1N0WA 2D59A 2UYYA 4XKJA 2UVQA 4XYGA 4MV1A 1WNTA 1WZUA 1XQ9A 2WJHA 4QLAA 2A1TS 5HA5A 4CKCA 4RJTA 2WIFA 1U0JA 1NXQA 2EWVA 2DPMA 3GJ7A 4ALNA 1KBQA 2DFNA 1CQIB 4XJSA 3WK4A 2ZIWB 4Q24A 5JANA 3K53A 2Y4RA 2MR6A 3WWEA 4G8BA 2A1UA 2JJ2D 2NXWA 3T61A 5BXQC 1ZEJA 4ND7A 4ARZA 1FZTA 2VPYA 3FUCA 1Q1GA 4BGEA 1VL5A 2I4LA 4ZYTA 2VTBB 1CR2A 2REBA 1TK3A 4BO7A 4JQSA 1Y33E 2EXXA 1I1NA 2AWOA 4R3WA 4A10A 1HE3A 3PQCA 3MTIA 2PMCA 4Z53A 2I6QA 3GVIA 3Q7SA 1Y8RB 1ZP6A 4MWTA 2O07A 3O92A 3K6SA 5EWJA 1QAMA 1RFLA 1E4YA 1U1EA 4OJYA 2PVCA 4FYVA 3SMVA 4XWOA 1R64A 3CVYA 2XDWA 4U7PB 4H18A 1Z3CA 3FHOA 1BXRB 5JNRA 1JHYA 5I60A 1N5DA 1NY5A 2ZSHA 4GGOA 3RFVA 2C9ZA 3TBFA 2Q4EA 4WNAA 1HYGA 2FPGB 4I55A 4Y2QA 4ALKA 4F71A 3G2JA 3KOZA 5ENZA 3SGLA 3D8TA 5IBCA 4KQ2A 1WSDA 2ZAGA 3F3KA 3E9DA 4I9NA 3C3MA 3RKSA 4ER3A 2ATVA 4JMLA 2C1EA 1Q0UA 2RBKA 4OP2A 1ST3A 1A7KA 2BKAA 4XYLB 4L50A 4UCWA 3T3DA 2ZXUA 2O19A 1I5EA 3KQSA 2ZYUX 3A9UA 3CLVA 3QMWA 1L4NA 1WUKS 3LUFA 1L1FA 1MW8X 4JJ8A 2WPDD 4UAVA 5JIBA 5IM5A 1PGQA 5B53A 2BGTA 1E7MA 1JU3A 4CV1A 4YMVA 5CD9A 3CCFA 1FXWF 4GVLA 1QIFA 1XF1A 1YDEA 3B7WA 2MSDB 2VT7A 4B6EA 1Y7PA 4YXWD 3CVWA 1L5GB 5LMUB 2ZU6A 3VI3B 1T1RA 3PC8C 3D8BA 2UZAA 4FXPA 2ZTMA 4BTLA 4OEHA 4EDHA 1QGDA 4QUKA 3EPJA 1EX9A 1YDWA 1L5HB 3AHJA 3EZFA 4AZ3B 1KR5A 1A04A 1DWOA 5IAOA 3P26A 1VMEA 4O33A 3FHLA 4JFRA 1A5BB 3GQVA 2G36A 3U3ZA 2GEFA 3JQAB 2G70A 5EJIA 1J06A 4Q7JB 4MI3A 4LDPA 1PVVA 4OSPA 3X1DA 4ZVMA 4WTOA 3NTLA 3IMCA 3OPNA 3ZQJA 1GKUB 3C6KA 3WDKA 3EDRA 4ARUA 1N8TA 2BGGA 4DR2B 4EJSA 2FI1A 3IESA 3NEYA 4IDBA 3CZ9A 1OAAA 3FTDA 1CY8A 3IVGA 4GUDA 3ZNQA 1ZM4A 4K46A 2PK3A 1I10A 1YB7A 3BH0A 4LXTA 5EUCA 1V43A 2X5XA 4ZVNA 3CWZA 3KR0A 4RVHA 3O1JC 3BRWA 4URXR 3UJNA 1YCDA 1EX6A 1PT6A 1YOBA 1QTIA 2I22A 4DIEA 2Z6QA 1RMQA 1GTZA 4L16A 2BGUA 3OQIB 4P08A 4PPFA 1XQVA 2XHEA 3CVUA 2XDAA 1IBRA 4U9HS 4WBNF 1DZIA 1RWKA 4YLYA 3KZOA 4YREA 2NACA 1JFSA 4DLSA 2D1YA 3SICE 4GOND 2CNBA 2NOAA 4R2XA 3PT9A 5DNVA 3DGEC 5F7JA 2D00A 1AX9A 2ZB8A 3K92A 3LDHA 1FX1A 5IJ0A 2NADA 3H05A 3NC4A 3L18A 4XSHA 3RUFA 3RYCB 3UPUA 1A72A 2LP4Y 4YCAA 5AJVB 1GXSA 1UDCA 3ELWA 3OZIA 1K4YA 1JW9B 2JG3A 3B52X 2GSDA 4DC1A 3F5SA 5JBQA 1XTRA 2JCGA 4BEJA 1P7VA 4D9NA 2X2FA 4H1WA 3ABRB 3M6VA 4Z4FA 1NBWB 4OFBA 1E0KA 3INYA 4JI0B 4MV5A 4LJRA 5EHIA 3ZK7A 1GLGA 2A78A 1HDCA 1HO3A 1NJ5A 1WMFA 2NGRA 3CLRD 4LXYA 3KDAA 1RP1A 3EVEA 3C74A 1O97C 1SOMA 2H07A 4OG2A 2W2MA 4KW7A 4OYLA 1WXIA 1JBEA 1URPA 3EPRA 5MN5A 1L2TA 3W5BA 1L5KA 1GZUA 1U9CA 1L6RA 1FUUA 1SHJA 3KJXA 4CM8A 3WRYA 5BW4A 2D2IA 1WF6A 3FG9A 5A7HA 4LA4A 1SRQA 4QYSA 2E4UA 4O7ZA 4JY7A 4KRXA 2AXQA 3P32A 5KTMA 4EHDA 1O94C 1AQUA 1SUAA 2A5FA 2HBYA 2P4QA 5CVTA 4OXIA 1ECPA 2WVJA 3KXDA 3LBIA 4EHHA 2CMGA 1IVYA 1UK6A 4NEQA 3PITA 1BGWA 1C3LA 5JD5A 4DLRA 4UAGA 1PSWA 3DTYA 1TCUA 1Q77A 4WXRA 4AO8A 1F8GA 1OE0A 2F3RA 1WB4A 2WPDA 2WF8A 3DXXA 3PJDA 4WKPA 4Y6LA 1RABA 2BCEA 4GZMA 2F8LA 4REQA 2IVFA 4YMUA 1K63A 1IN7A 3L8GA 2CNWA 2GVZC 4I4TA 4Y2HA 1T4CA 2HJSA 3QU2A 3UATA 2SICE 4EL5A 1Y42X 1CQJB 1GL3A 2RH5A 3F97A 1Y1SA 2VUTA 4R1OA 2WAXA 5BWCA 1OTHA 2KPOA 3P96A 3OPYB 4EW3A 5CJ2A 3T7KA 1GM5A 3V8NA 3OQ1A 1CJKC 4GH5A 4ZFNA 3DUFA 2IPLA 4K7JA 4AMUA 2BFPA 3NRBA 4A0SA 4MWSA 2VNIA 2C0PA 3MMXA 5EERA 1H2FA 5BWNA 4PR3A 4NNJA 2GM3A 5LZ7A 4CIXA 3UBTA 3USCS 5EJGA 2X14A 1H66A 2CFRA 3OQMA 1SQGA 4F8EA 4I1YA 4RD2A 3U13A 1KO7A 3B1FA 3HKCA 3VQTA 4IFBA 5ES4B 4O84A 3WJ2A 3FXAA 5FFNA 2OE2A 3BXXA 5GINE 2EKBA 3U4DA 2WJ3A 2VN8A 1Z0DA 5DSXA 4ESOA 2FWIA 1LDYA 3BACA 2BFNA 1EXNA 4JELA 2WWGA 1KIMA 3CQ9A 3T1HB 3T3MB 4DV5B 2EKZA 3EWNA 1T1GA 2AEFA 3VH2A 4QAJA 2G3YA 4BKPA 4I1IA 5DHQA 2YDXA 4X84A 3V8PA 3IQFA 5FBRB 1OY1A 1P2TA 2I4MA 3SBXA 1G2OA 4NJMA 3NS7A 5DISC 1XF9A 4M9CA 2D5AA 2FEPA 4NCNA 3QUAA 3PD0A 1S1MA 4L4XA 4GMHA 4K6GA 4JT2A 3KUXA 3KHKA 3M6IA 1P9OA 1SVKA 5L95A 2AYZA 2WICA 3M5WA 5I47A 2GOYA 1W4ZA 1CJSA 4D5EA 2BDEA 1JQAA 4JEUA 3H5TA 1MPTA 3OZDA 3MCVA 3SQMA 2WY2D 3AEZA 4ZQCB 1MFZA 3HY4A 1LCIA 3B3GA 2JIOA 1RYBA 3N2NA 3NT5A 1IDN1 2ZIGA 1I1OA 1SEPA 3PX3A 4IHKA 4GP7A 2VQSA 4OJTA 5FV7A 3RT1A 5AESA 2JAQA 4H15A 4BLUA 2H1LA 3GFSA 2HTFA 4C0LA 2G88A 4NCBA 4HNAB 3RU2A 3LQ4A 4C3UA 3B51X 5H68A 4BMOB 3DDZX 4L51A 4UBIA 1D0SA 2D3WA 1L5OA 3CLSD 1UXIA 1I1QB 2PJRA 1MAVA 3O3MB 5G3YA 1TPYA 4QGSA 2ZRLA 2FR8C 1E5LA 1FDTA 3RFTA 1NF9A 5KYWA 3SF8B 3VR4A 4IVPA 2HK9A 1BIFA 2V03A 3LHFA 4DNFA 1AZLA 5LKAA 1YMUA 2B30A 2DUJA 2EKLA 2IUTA 1SCNE 1G8SA 3L46A 3OVMA 4TN5A 1FFEA 2H9IA 1WMDA 4RPGA 1R6UA 1S1CA 4EOGA 2H1OA 3AZQA 3N58A 2B69A 1GL7A 3RLIA 4C6SA 2IUSA 1AXGA 2WP0A 4MW0A 1SG9A 1DKOA 4J3FA 4OXQA 2PX8A 5EZSA 4ZICA 5KMGA 3LYLA 4OHCA 1IQUA 3G6WA 3AHFA 5ILGA 2ACKA 4MRMB 4S05A 1O9GA 4ZDWA 4C0KA 2ZJOA 2HA6A 3CEMA 3ZE0B 4EKYA 4M53A 2CNWD 3PDHA 4HRAA 5GJBA 4DT1B 2VLBA 3GHHA 5F21A 4RVNA 4P84A 4HRVA 2PFSA 4MW5A 3ETDA 2FLKA 2REQB 1Z3IX 3ET5A 1GTJ1 3ROGA 1G8PA 4CVNA 3Q4GA 4OU4A 3KPVA 3UJDA 4E7PA 2OCPA 2YX1A 3UH1A 1R9NA