4FFOA

Pylc in complex with phosphorylated d-ornithine
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
363
structure length
353
Chain Sequence
b'MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYGLEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVLKERFGAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PylC
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase/reaction intermediate
total genus 118
structure length 353
sequence length 363
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ffoA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ffoA01
4NH4A 3CMMA 1RM4A 1JN0A 3OJFA 4GMFA 4CLRB 2Q1UA 1AE1A 5KVSA 4S3MA 2C2YA 1CE8A 3GZ4A 4J1QA 3IKVA 2VWHA 3MTGA 4Q3DA 2YW2A 2PGLA 4BO9A 3RKRA 1K6JA 1H0KA 3DF7A 3ETJA 3H9QA 4Z3DA 3RBZA 5JMWA 2YZLA 4XEHA 5I7FA 3DR3A 3EYWA 3I23A 3AW8A 1EFLA 4TV8F 1SBYA 2VT3A 5C7LO 1FF9A 3K3PA 3TDKA 3Q1KA 1LUAA 3VH4A 3NGXA 3P19A 3EHEA 1KJIA 1D4FA 3VZRA 3MWDA 4FC6A 4HNTA 3IMFA 5L4SA 4X54A 5F1KA 3CXRA 2D3TA 4B4UA 3W1VA 5T5QA 1NR1A 4J90A 3QP9A 2IZ1A 4MV6A 3WYCA 1LC0A 2AQHA 1N1GA 4P4NA 3RVDA 2PWZA 4FDAA 1HZJA 3GVPA 3MZ0A 3GEMA 4WNCA 3WGTA 5T8KA 2DM6A 4XQCA 4AL4A 3DZGA 5T6BA 2EIHA 2QK4A 2CNVA 5MDHA 3CINA 1BXGA 1T4DA 4DPMA 3I4CA 1YL7A 1PL8A 3HHPA 4CV2A 3QVTA 4GI2A 3JQDA 2VYVD 3CKYA 1OBFO 3P2OA 1ENZA 3VPGA 4I9HA 2VHWA 2I66A 2VR1A 1UXHA 3BG5A 5CHEA 4HFJA 1VSUA 1DFHA 5A5FA 5A03A 2X22A 2GZ2A 3WTBA 2DIKA 5C7OO 2RH8A 1KUTA 4IJUA 3ETEA 1T2DA 3OUZA 2E82A 3OF2A 4WLUA 1X1EA 1I2ZA 2DBVO 2FP4A 5GONF 2FSVA 3CZMA 3QWFA 5CG2A 4KWIA 1T26A 4MDHA 3ENNA 1OFGA 3JQBA 4UVIA 4QO8A 2UAGA 4CLHA 2D59A 3K2EA 2NU7B 3JQ9C 4GX1A 1H5QA 1M76A 3CPSA 3RU9A 5JE8A 4ZHSA 2YZNA 2P5UA 3HNPA 1L1FA 4BO6A 2JAPA 4FC7A 3QVXA 2O4UX 1KJ8A 4WLNA 4PZCA 1EYZA 3CUKA 4ND2A 4UUNA 4E0BA 4INAA 3PQDA 1O89A 4GL4A 3LZ6A 4GKVA 2PZJA 3HO8A 4XYLB 5JW6A 3PLRA 4IQ0A 4IDEA 4RQTA 4DVJA 1Z2NX 3AOGA 1GV1A 2NTJA 3QE3A 3OIFA 5GY7A 1BMDA 1FDUA 1IE3A 1U3WA 1WW8A 3E5MA 3QSGA 4B79A 3QWBA 5IDXA 5F21A 3O03A 4QO7A 1B16A 3RBXA 1I7LA 1CEQA 5KVCA 2UV8A 2I67A 4HFNA 1F12A 1MXHA 3WBBA 3BTVA 4R1TA 2WJPA 1NM5A 4YB8A 2VYVA 1NWCA 2D4AA 3QIVA 4MV8A 3HWRA 4GSLA 3HDJA 4J4BA 1X0VA 4WNIA 2X9NA 1ZW1A 2O3TA 1UH5A 4L9RA 4BNNA 1VRWA 4XR9A 3JQ8B 4XWYA 4R3WA 3WGGA 1ZO8A 2J8ZA 2AG5A 1U3UA 3DAPA 5EJ2A 3NYWA 2DBRA 1RYDA 3C7AA 3I52A 3SEFA 2NVWA 2GPTA 1X13A 3M2TA 4UVHA 1BSVA 3FNEA 2YZMA 4OO3A 1BDBA 1GZ4A 2G17A 1I24A 3ABIA 1PJQA 2B4RO 2PVPA 3OH8A 4XGKA 1PJBA 1P31A 3RUHA 4RVDA 4AJ4A 1PWXA 3I9JA 3T7CA 1DJNA 1I10A 1NFFA 1DIGA 3ZU3A 3H2SA 4W6ZA 2BFMA 4FS3A 5IDWA 1NHWA 5CPFA 2YDYA 1WPQA 3K2BA 1VLLA 2HK9A 1EBFA 1I3NA 4G65A 3OBBA 4CM8B 1E6EA 2I9PA 4IJKA 1S7CA 3W4IA 4YWJA 3E18A 3LVFO 2NV6A 1RKXA 3ZDFA 4LSWA 4XKJA 1A7KA 1QYXA 1NVGA 2RHRA 3Q0EA 3ITDA 5TC4A 1EQUA 1ZSNA 3TL2A 4BMNA 3DL2A 4ZGWA 4OXYA 4ZOLF 1C1DB 2EKQA 3AUTA 4MA0A 4FOOA 1GSAA 3G1TA 4BKPA 4E4YA 4WGGA 4CPDA 3RV3A 4O0LA 2HMVA 1OAAA 3ICPA 2W2KA 4YACA 3WMWA 2FPIA 2XD4A 1IYZA 3JQFC 1I30A 2WE8A 2X8LA 5IN5A 1IPEA 1D7OA 1H6AA 1ZK3A 4TRJA 3FD8A 3GPDG 4ALLA 4MV4A 5COAA 1Y8QB 4WLEA 1KJQA 1B6RA 1LDYA 1ZK4A 5CAEB 1J6UA 4MVJE 3KEOA 1TT7A 1KVTA 4PLVA 3TL3A 2V65A 1ZUD1 5G2OA 3PP8A 4FGWA 1T2FA 3LP8A 1MP0A 1EQ2A 5FI3A 2EP5A 5ENDA 1NPYA 1HYGA 2GLXA 1F06A 1GYPA 4WE3A 1GEEA 2OORA 5TNXA 5TQVA 4YQZA 3RCBA 3TFQA 2R7KA 1YQGA 4YT4A 3GF4A 3WSVA 5BT9A 4O82A 2G82A 2P4QA 4Y9DA 3ZHZA 1PZHA 2YV3A 3DMTC 4N54A 4AJNA 4GAEA 1W73A 2RAFA 2Y0DA 1KEVA 1UXKA 5LP6F 3HJAA 3G0OA 3JQ7B 4ZQGA 3ZWBA 3MJSA 1JLLA 4JJGA 4DQVA 1U8XX 4J1NA 4HNVA 4ROSA 2GRAA 2NSDA 3GHHA 5CEFA 2DT5A 4Y98A 3K5IA 5DBFA 3UOGA 4F46A 3ANMA 5C5IA 3ONFA 3V1UA 3GH3A 1U1IA 3S2GA 1EFKA 3Q2KA 1Q1NA 3UW3A 2ZATA 2HJWA 4CUKA 4UUPA 1E5QA 2JJYA 4PIVA 3PTZA 3WBFA 3PEFA 4YBZA 1BRMA 1IOLA 1PJ3A 4LCEA 3RC2A 3P7MA 3TIGA 1BDMA 4WKGA 4CLOB 4BNLA 1EDZA 4E5NA 3SVTA 4B4VA 1LNQA 3OJLA 4MA5A 1SCUA 4OKNA 3RWBA 2C5EA 3IAHA 2Y93A 3GQVA 3OIDA 1B3RA 3GNSA 3LT4A 3R0IA 2B4TO 3EK2A 4PLFA 3WX0A 3S2IA 2XAAA 4RF4A 3I6IA 5JDIC 4MV9A 3WNZA 4DUPA 1WMAA 1EK6A 2EERA 1HDXA 1HETA 4NR0A 1Q0QA 2XCLA 3BMCB 1K6XA 1UDBA 2NADA 3FPCA 4RVGA 3D3EA 4U8GA 3MWEA 3AI3A 4Z0TA 3WG9A 2HRZA 4EUHA 2R82A 3JV7A 1DHRA 3NT4A 3RBVA 2V6BA 1KVQA 2VYND 4QTZA 3WICA 2QRLA 1DRUA 5DMXA 5A9SA 4CV3A 4LVUA 2YWVA 2ILTA 4NJOA 3WGZA 3Q1LA 4I5EA 2X1HA 4FJ0A 4GPD1 5DNAA 3CMCO 3ORFA 4EDFA 4UVEA 4Q9NA 3U0BA 4EUEA 2ZB7A 4BV9A 3KAKA 2EV9A 2PH3A 4NJMB 2HO5A 1BVUA 1KEPA 3BXXA 3AM4A 4O59O 1VM6A 1VJ0A 2VHVA 4R1SA 5IDQA 1ZSVA 4WCFB 4I8XA 4GVLA 2J9GA 1MB4A 1CYDA 3EVTA 3IUPA 1VJTA 4MP3A 4AJ1A 2CNBA 1YBAA 4OGWA 3OMLA 3AI1A 1FJHA 1E0DA 1T2CA 4RLSA 4J0EA 1U4OA 1Z45A 3QHAA 4DRYA 3VH1A 2VQDA 1HYEA 1PGOA 1QP8A 1T24A 1WP4A 2VRCA 4A27A 2WDZA 3NAQA 3WJ7A 2YHIB 3CZRA 3DDNA 3PGXA 4RLHA 2VHYA 4CLXA 1I8TA 4R16A 2HMWA 2NNLD 2YZ7A 3KSUA 3OEWA 1EUDB 4RDIA 5G0WA 4D43A 1JWBB 4TVBA 5FEUA 1VKZA 2UYYA 4RPJA 4DC0A 5L7WA 1ZFNA 2HQ1A 3VZPA 2D8AA 1U4SA 1Y8RA 4I9UA 3ZNQA 3VPHA 1DIAA 4Z0HO 3VPBA 2JD1A 4UVDA 1HDYA 3AFMA 1SO8A 1WDLA 1YKFA 5H82A 2DTDA 3C3XA 4HADA 4ALIA 1PGPA 3MTJA 2R00C 1JDBB 1QMGA 1UZNA 3ZNPA 3ROQA 2X9VA 1E3WB 2ZB3A 3I5MA 3DBLB 1HTBA 4IGEA 3P2YA 4C7KA 2BGMA 1T2EA 2OO5A 4HFMA 2GASA 5DF1A 4ZI7F 1W4ZA 1OBDA 1VKOA 3WGOA 2IODA 4J6FA 4EYEA 1NPDA 1ZEJA 4CR6A 1UAYA 5TLSA 1E1KA 4E5KA 3ZV6A 4YXFA 3IS3A 1HE3A 4OXNA 1ISGA 1GADO 3O8QB 4IDBA 4FE2A 3LDHA 1EUCB 4YJGB 3TNLA 3H9GA 1DIBA 5L9AA 1Z82A 4O7RA 5JLAA 3OA0A 2VTDA 2Y1EA 3K92A 5A9TA 1SEPA 2EP7A 4D45A 2HCTA 3EVNA 3IP3A 4O7TA 2CNQA 2Q4BA 5EL0A 2EW2A 5JC8A 5JDCA 5KWEA 1A4UA 1E7QA 3L4BA 1T4BA 4DIOA 1GQYA 5JO0A 3OUUA 4CQMD 3SBOA 1FMCA 1XR3A 1UXIA 3WYEA 2V5AA 4ZICA 1BVRA 4TRMA 3GG9A 3F5SA 4RJTA 4Y8VB 2IEDA 4QFDA 4DLBA 2O3RA 4KDFA 4C5AA 3RIHA 1NNUA 2DUUA 4Q3CA 3ZU2A 1IOVA 1HF3A 2NU6B 3WQRA 2W6ZA 4CM4A 3GVHA 4PVDA 1DJQA 5DT9A 1DPGA 4OAQA 1TVEA 2O7SA 3LQFA 2PN1A 3ZU4A 4ME6A 4CQLA 4CMBA 4ZQIA 4QQRA 2AEFA 1LLUA 2ZDHA 3A9WA 1CETA 1IL0A 1M66A 4MIYA 3QRWA 3KAJA 4II2A 1GSOA 4PLTA 3PWSA 3E1KA 4ID9A 1FDTA 3JD4A 4R9SA 3C8MA 2X7HA 3GGGA 3M2PA 4KUGA 5TJ9A 4QSHA 4BNKA 4IXWA 4Z3KA 4RDHA 3WR5A 1PZFA 3FNGA 1KEUA 5A9RA 2O3UA 1GQ2A 4BNFA 1SEVA 1T1SA 5ILOA 3LWBA 1G0OA 2HMUA 3Q9UA 4GH5A 2Z1NA 1C0PA 5EERA 3QFFA 4O83A 4LW8A 6LDHA 5ICMA 1GD1O 3MJ4A 1E4EB 4NFYA 1PSDA 3JQ9A 3DZFA 2XPCA 3X2EA 3WNVA 4RPKA 2VT2A 1NYTA 3AM5A 4II3A 3DZIA 4QX6A 4BGUA 5JVLA 3OICA 4LSMA 2FPGA 4CQMA 2HJSA 2NM0A 2PR2A 3VPSA 2H6EA 2PKQO 1PGQA 3KOUA 3NV9A 1PTJA 3TOZA 4XIJA 2YDXA 1B14A 4BB5A 3BHJA 1T25A 2GQRA 5CP8A 1UP6A 1E3JA 1C30A 2I8CA 1V3UA 3ZZNA 3RUCA 4N7RA 1H2BA 3WIDA 4CLRA 2D5AA 3W8EA 5JXWA 1CF2O 1B15A 1WR2A 5MGBA 1HL3A 2PD4A 3E6AA 2C0CA 3QVOA 4ZD6A 1NVTA 4XA8A 5B12A 1AXGA 4RVHA 5G4KB 4O81A 2F1KA 4E21A 1D1TA 1N2SA 1K0UA 2CDCA 5BMVF 4RCVA 4O7NA 5A02A 5JMPA 4MIOA 3GEDA 3K73O 3M6IA 4ND1A 3KYDB 1GDHA 3KALA 3COSA 1VBHA 2P91A 4ALNA 1TA4A 1Y1PA 3I12A 5KKAA 1IHYA 1ISFA 3ZN2A 1A9XA 4IJWA 2W8ZA 2Y0CA 5B37A 4RQUA 2BELA 1QYWA 2VHZA 3KRTA 4IDDA 4Q39A 4RVSA 4MVJD 5B4VA 1A7AA 1QORA 1DSSG 3B20A 3DAGA 4PLGA 2DC1A 4TRRA 4ZA2A 5IFLA 3L4SO 5HBRB 4NNJA 2OGUA 1V0JA 3KTDA 4MO2A 3GY0A 3UICA 1SAYA 4IDGA 2XOXA 4YAKA 1GL3A 4O4LF 5ILGA 4BNXA 4YA6A 4IIUA 5CDYA 4EGFA 5JH7F 2AHRA 1U9JA 4L4SA 4JK3A 3ZI0A 3F1KA 4R01A 4DMMA 5JNLA 2FWMX 1PJCA 3B1KA 1KEWA 1NXQA 1VBGA 2ZB8A 4UREA 1NASA 4EI2A 2ZQYA 3X2FA 1LA2A 4FQ8A 3F3SA 2CZGA 1QR6A 4B7XA 2VUUA 3MOGA 2Y1OA 3VPCA 1PJLA 1B2LA 3GK3A 5KNLA 5A1TA 1M6WA 5U9CA 5BNIA 3EDMA 1ZZEA 1DLIA 2B5VA 4R41A 3PI7A 5EMHA 4A73A 4PLHA 4RF5A 1YJQA 5GZ1A 2QW8A 2D2IA 5LYJF 3GAZA 1YGYA 2AA3A 2GQSA 2BLLA 3FR7A 4D44A 3Q3CA 1DB3A 2BI7A 1LTHR 3KYBA 1LDGA 4IPTA 3TINA 4UUOA 3L9WA 3R3JA 1XEAA 1RM3A 2PH5A 4J1TA 1GEGA 2AG8A 4TZKA 4O6VA 4BO4A 1AHIA 2X6TA 1YL5A 4C4OA 1K3TA 3OECA 1A48A 4AJJA 5I7VA 1BXZA 3JQAA 1KVRA 1A5ZA 4YDRA 3GNQA 3JQFA 4ZJUA 2GPWA 3HBLA 4WBNF 1V3TA 5IJZA 1GGOA 3WWZA 3DBHA 3JD0A 4RORA 1ZNQO 3NJ4A 1TT5B 3WMXA 4AG3A 2X0NA 4OQYA 2J3KA 3ROKA 1TEHA 1GV0A 5JCJA 3KHUA 2VRBA 1Q0HA 1E7YA 2FHSA 5JYEA 4E5MA 4YJFA 1F8FA 2WD7B 3BMOB 2A94A 3HB5X 4BOYA 3E03A 3IL2A 1LRLA 3CEAA 4HNUA 1MG0A 1R16A 4CLDA 1EBUA 2EKPA 1UAGA 4GGPA 4K6FA 1ENYA 1O94A 2V6MA 4WEQA 4E13A 2NUAB 3DBRA 4EJMA 3RROA 2PGDA 4JBGA 4QUKA 1D1SA 2RBEA 1H94A 1BW9B 2BGKA 1QV6A 2IE0A 1LDEA 3AU9A 4XYEA 1JVSA 2H5LA 4W4TA 1W0CA 1P1HA 3SC6A 2C82A 3ORQA 4B3JA 5EINA 1KVUA 2HSDA 3DMTA 4G5HA 3PJFA 1DAOA 2R6JA 3VVBA 1DLJA 4P8RA 5KTKA 1L7EA 5C1PA 4DTIA 1HSZA 2YUTA 3ZU5A 5GZ6A 4K6CA 1I0ZA 4YJ3F 3HB9A 4NG5A 4RZHA 3KM0A 3QVSA 4N18A 2Y99A 4ZRMA 5ER6A 3RUIA 4DLAA 5KVQA 1YB5A 4JBHA 1RWBA 5AXBA 3E5RA 3PJEA 4O7SA 1CQJA 2GZ1A 3DXFA 3GN1A 3BMQA 4ZVVA 2PA3A 3OJ0A 3ZNNA 4DREA 2GDZA 1JKJA 4OYRA 2VZ8A 3PHJA 3U54A 4IGFA 3P5SA 4FFPA 2P68A 1G0NA 2PGJA 4TQGA 4FBGA 1O0SA 1XGKA 5JAMA 2JCYA 3RQSA 3JRXA 1G6KA 4L1KA 1B26A 2BFOA 3ADOA 3GDGA 2YV2A 3L07A 4WOJA 3DAFA 3TIIA 5HWSA 4CV1A 4DA9A 5JBIA 3G8CA 1KC3A 2J3HA 3WLEA 3RFVA 3RUDA 4DIFA 4BKQA 2EW8A 3H8VA 4JGBA 2QZ9A 5JDIA 1R4NA 1WDMA 5LA6F 5LCXA 1ZSYA 3HFGA 3IJRA 1EMDA 1XHLA 1I32A 2I99A 1P1KA 2NQ8A 1CQIB 1E92A 3VDRA 3PDUA 1JA9A 2PD6A 1F14A 3TW6A 4RGBA 4DLLA 4MV7A 3KYCB 4EGQA 3PHHA 3LT2A 4N5LA 4NBTA 3JQCA 4J7XA 4BNTA 1OC4A 3PWKA 3WFIA 1QV7A 3UAGA 1K89A 4JNKA 5JY1A 1AUPA 4W9NC 3PQEA 3VKVA 3NGLA 4PLZA 3TZKA 1ZVMA 5CB4F 1LSSA 3NJ8A 4WJZA 3ZHXA 1ZH8A 2WTBA 1I3MA 3F4BA 2JCXA 2Q45A 5ITWA 3N6RA 1Y8QA 1LBEA 5AXCA 3ZW9A 1VE9A 5EESA 1UDAA 2HK7A 1N9GB 1DIRA 2O3QA 4J2OA 4FD3A 3K30A 4LVCA 3IJPA 4B4WA 3KB6A 1GCUA 4XQEA 2R7MA 3L77A 4CODB 4J7CA 3JQGA 2OUIA 2NVBA 2FR1A 5C8YF 4G81A 3VTZA 4E33A 4OIMA 3NX4A 3V2GA 2VTEA 2PFGA 3B1JA 3EMKA 2HJRA 4TROA 1WAMA 3T4XA 4YAJA 3HDYA 4LRTB 4W82A 4CUZA 4WLOA 4AVYA 1NQOA 1Z2PX 1ZCJA 1XWFA 5CA1F 5I8WA 1C1XA 2FOIA 3HADA 1DRVA 3PGJA 4HV4A 1K6IA 4TKLA 2AQKA 3JYLA 3UHAA 4ALJA 4FGRA 1P3DA 3LF1A 2YRWA 3GZNB 3I83A 3ZNOA 4CMIA 1W6UA 5GMOA 4NU6A 4P22A 5J23A 1E1LA 4U0JA 3ADPA 1AUXA 5H83A 2OP0A 5CEEA 4FB5A 5CDUA 3SX2A 2W2LA 3OETA 3DO5A 4IDAA 4TUYF 3AY3A 1MLDA 1R6DA 4CLOA 2W6PA 2J5KA 1HE2A 4CR8A 1SPXA 1I01A 1EHIA 3CIFA 3QWIA 3RC7A 4MKXA 5TRTA 7ADHA 3FNHA 1ML3A 2CF5A 5ER9A 2GSDA 4FN4A 2CDBA 4ND5A 4PZDA 1XCBA 3GT0A 4J4HA 1MXFA 5HTOA 1ZK1A 4D42A 1N5DA 1PS9A 1ZK2A 4YTEA 5KVVA 5CA0F 3V1TC 3K96A 1QSGA 1X14A 2AE2A 2WYOA 1J49A 4XZ3A 2GF2A 2DWCA 3PFFA 4WECA 5A3VA 3AJRA 3VOSA 4HNGA 2FR0A 5LDHA 3FWZA 3JQ6A 2D5CA 1LQTA 3ANLA 3MWDB 3GDOA 4IMRA 4A0SA 4AJPA 3ONEA 3GEGA 4BO1A 1PGNA 1E7MA 2X0JA 1P9LA 1YJ8A 3VH2A 4XJTA 3QV1A 3NTOA 4R51A 1MFPA 2E49A 3GGOA 3M1LA 5A5EA 3NDRA 1NWHA 2P9CA 2J5QA 3SJUA 1DOHA 1AUVA 3Q6IA 3PYLA 2WYVA 1DV2A 1XYGA 3F5QA 2IDZA 1B0AA 4GX2A 4DPLA 3BTUA 1GSHA 2VCYA 3LC2O 5HA5A 5KOIA 4DWVA 1RPNA 4NFHA 4KWHA 4Y6PA 4BQRA 1V8BA 5K6AC 4BIIA 3RFTA 1BXGB 1E5LA 3ZWMA 1PEDA 2GN6A 3GDFA 2LDBA 3EZLA 2XF8A 2PKRA 4M8SA 3RU7A 1KJJA 3VHRA 3ASVA 5I9LA 3INGA 3ZGYA 1YS4A 3DFZA 1Q7CA 1QYVA 1E6WA 2IYPA 5BR7A 5IXYA 3AUSA 1DHTA 4O4IF 3JYOA 4RV9A 4DC1A 3UFXA 3KSDO 1NVMB 4ND3A 4E5PA 1KBLA 2ZK7A 4XQ9A 4NPCA 2O3JA 2NU9A 1Z74A 2PK3A 4WLFA 2FP4B 2DTXA 3LC1O 2YL2A 4J7UA 5F1PA 4B7CA 4C5CA 3RUEA 2DUWA 4YYZA 1VI2A 1D3AA 4IMPA 3QQPA 2DLNA 4LMPA 2HK8A 4XYMB 4AJLA 4BGVA 3ASUA 1YO6A 5KIAA 4DBVO 1VL0A 4BHTA 3V8BA 3K5HA 1Q7BA 1YBMA 2E6UX 3RJ9A 1V35A 1HDZA 1ZMOA 1OMOA 1WWKA 2JKVA 4YT5A 4DQUA 2BD0A 3FRJA 1O95A 1GCOA 1ADGA 5TGDA 3AI2A 2Q2VA 4GSKA 1W8DA 1E3WA 2VPQA 3KSZO 3VA7A 4TV9F 1WLYA 2Y68A 5EQDA 3C24A 1NFQA 4RPHA 3AK4A 4RF3A 1JVBA 3WWYA 1HRDA 1N92A 5JQGF 4OSPA 3L6OO 3M1AA 1WNTA 2V6GA 4CM9A 3AUAA 3I6QA 4BO0A 2R84A 4O7ZA 3TZCA 5FI5A 4FU0A 4JIGA 3F1LA 1T36A 1C0LA 1NQAO 4J0FA 4KTTE 1EUCA 4BNHA 4YB8B 1LX6A 1F8GA 4I55F 2A4KA 4EG0A 2VRCD 3F46A 4XDYA 3VMMA 3B1FA 4YJGA 4CMCA 3W6UA 4BQPA 3ZCXA 4CMEC 3ZWAA 1J5PA 3KO8A 3LU1A 2BGLA 3DB2A 1DBVO 1CERA 3VPFA 5AYVA 5KJEA 4P4LA 3TOXA 4R68A 4E30A 2CVQA 1EVJA 2CD9A 3EGOA 1KY5A 3TFOA 5A05A 3IKTA 3MJTA 3DONA 1KERA 2W98A 4TRNA 2G0TA 2C2XA 1CRWG 1EDOA 2X0SA 3GRKA 4I5FA 5T8KC 2ZTMA 4FFOA 4JP2A 4NU5A 3A14A 1GZ3A 4RVUA 1GPJA 5KJFA 4BNUA 3PIIA 2NU6A 2YFQA 1PR3A 1N7HA 4XRRA 5G0UA 2ZYAA 3OA2A 4I5DA 2HMTA 1LLCA 4R1UA 4DGSA 3WIEA 4R5HA 3C1TA 1P1RA 4BGIA 3TZHA 2Q1WA 1DFIA 1E7SA 3D5TA 4C7JA 2B0JA 1R4MA 1ZXBA 3R6DA 2F00A 5T64A 2Y66A 3FHLA 3A06A 1LJ8A 4L74A 4PG4A 3D3WA 3IP1A 3AUUA 1DRWA 2XXBA 1HKUA 5GZ3A 3AY7A 3R5FA 4E4TA 5FWNA 3V5NA 2VNSA 4E2ZA 1JTVA 3EUWA 1GQQA 2AQIA 4KQWA 4JP3A 2X0RA 1RJWA 1SB9A 3KUXA 1VJ1A 4YRDA 2W2KB 3BMNA 1ONNA 3NDIA 4XQGA 3FNFA 4E12A 1M67A 1ADCA 3U5TA 2BHLA 2EWMA 2XXJA 3N7UA 2CFCA 1GYQA 3SJ7A 1ZBQA 5C37A 5J2UF 3A28A 3N8DA 3K31A 2JAHA 2E4AA 2VNAA 2VZ0A 3ZWCA 3E8XA 4H16A 4NFSA 5BPFA 2DTEA 2PV7A 2J3IA 5KKCA 2FPPA 4MV3A 1YVEI 1J0XO 1M0TA 1C0KA 2O2SA 4F6LA 2PZKA 5IZCA 4JXKA 2SCUA 3NTQA 1PK8A 5BSFA 5JC1A 1TI7A 4WLVA 1ADBA 4MKRA 3DTTA 2X5KO 3BHMA 1Y7TA 4AFNA 4M55A 2X4GA 3EY4A 3OM9A 3S2FA 5BSGA 1ZJZA 1QYDA 3QWAA 1HSOA 1PU2A 1F0YA 2FZEA 2VWQA 5DULA 4TWRA 1C0IA 1DC5A 1UP7A 2PLAA 4DYVA 4CMHA 3JYNA 3TZ6A 2CZCA 4KTVE 3WFJA 3JRWA 3OP4A 4MKZA 2BKAA 4BO2A 4O4JF 2WMDA 2C7VA 1I33A 1WVGA 4FFMA 3GA0A 2G76A 5DOVA 4CV0A 4EW6A 3DOOA 3CH6A 1R66A 2YQ4A 4JROA 2ZYDA 1MC5A 2W6QA 1XA0A 3C7CB 3HN7A 4FFNA 2HGSA 1PQPA 1KC1A 1ORRA 5DP2A 2O7QA 4YBZB 1BTOA 4IDFA 4BL5A 1EE9A 2CNUA 1SZJG 3RASA 5L40A 1R0KA 3PFWO 3PVZA 1YDWA 4MJLA 5A06A 2C20A 3Q2OA 1BWSA 1EZ4A 2VWPA 3G3EA 3HSKA 3Q2IA 2EKLA 2VUTA 4R4JA 1A71A 3D64A 3VDQA 5JY6A 1SCUB 4YAEA 3RV4A 2X9GA 3TJRA 1DEHA 7MDHA 4WCFC 5K9ZA 3UCXA 2ZKLA 3V2UA 2TMDA 3TQTA 3H3JA 1QKIA 4OOFA 1C14A 4I4TF 3OHSX 3IDSA 4R3NA 3DOJA 3WGYA 4PG8A 5DOZA 4I50F 3PQFA 2OFPA 4FFLA 4RF2A 1LSOA 5U4QA 3PDJA 1P0CA 5IN4A 2FSSA 3R3SA 5JO9A 1PR9A 2C07A 2DFVA 3D0OA 4EEZA 3MWEB 2I76A 1J4AA 2Y1GA 1XU9A 1BGVA 5BNTA 2W4QA 4FJ1A 3I9KA 4XX0A 2ZIZA 5B4UA 5A9SB 3ST7A 4U5QA 2DLDA 2D0IA 3GAFA 4HQ6A 3E48A 3I9NA 5EIOA 2DU8A 3ZWOA 4EEXA 3F47A 1E3EA 2TMGA 3H3FA 3H9UA 3NTRA 4E32A 1SC6A 4OHUA 1X1TA 3UCEA 1GR0A 1DAPA 1NTOA 1NPTO 4KQXA 4W9NA 2CSUA 3C1OA 3OJOA 3E9QA 3FCOA 4E2YA 3NT5A 4J43A 3S2EA 5C7IO 1LDMA 4BNGA 5JCXA 3U09A 3G1UA 2NU8A 3RI3A 4WOKA 4GGOA 1YONA 1EE2A 1LRKA 2EJWA 2O2YA 3H5RA 4O63O 4GLOA 1Y5MA 5G0VA 3MJFA 1DFGA 1ZIDA 3I1JA 5HRUA 2Y1FA 4XYGA 1JAXA 3AX6A 2DFDA 1UXJA 4HNHA 3JD1A 4MPDA 3RFCA 1X7HA 3KETA 4DLKA 4R1NA 3E5NA 3AY6A 2ZQZA 3FTNA 5B4TA 1Y9EA 5TT1A 1HDRA 2YS7A 5ES3A 1TB4A 2IXAA 1PX0A 3PPIA 5KJ1A 3FBTA 3ROPA 1EEHA 2I80A 3DHNA 3PXXA 4OJNA 3UN1A 1GYRA 4M9UA 2P2SA 5BSEA 5L95A 3INTA 4IINA 1DC4A 4XGIA 2IYOA 1BG6A 2ZDGA 2I3GA 3A4VA 4B8WA 1UR5A 1YB4A 4O7LA 1Y8RB 3AOEC 1HWYA 2O23A 3UF0A 3K5PA 5AOVA 3H9EO 4RO0A 1ZK0A 2RH4A 2X58A 2Q50A 1YH3A 1N7GA 1PGJA 4OMUA 2FY8A 3JQAD 3VAZA 1JKIA 3G17A 5LOVF 2OBYA 2WEKA 3IIEA 1LRJA 3OEYA 4XCVA 5COBA 5F1OA 3EAGA 3V1YA 4TVOA 2Z02A 2BI8A 2GCGA 1GPDG 3N58A 4BKUA 5JCJD 3DFUA 4Q3BA 4XD2A 4PZEA 3W8FA 3GOHA 4YPOA 1HDOA 1IB6A 2VOJA 1ENPA 3INRA 4J16A 4XB2A 5L53A 5I7SA 4YJHB 3D4OA 1CIVA 2Q46A 2FZWA 4MP8A 4MV1A 1U2GA 1P1FA 4RL6A 5H81A 1LDNA 2NWQA 2OHXA 4QFCA 1TLTA 2DZDA 4Z0PA 3U3XA 3MJEA 2PBZA 4O2AF 4XDZA 3W8DA 5F5LA 1XDWA 4WASA 4TZTA 5AXAA 1JWAB 3MCVA 4A10A 4MINA 1B7GO 2P4HX 1MFZA 1MG5A 2GYYA 3ETDA 5JVDF 1CDOA 1HEUA 2AMFA 2HDHA 4IHJF 3GRPA 3JCZA 4XYBA 3IUSA 3D5QA 1F17A 3R9RA 1Y6JA 5THQA 1H9BA 2W70A 1NQ5A 1IZ0A 2OP1A 4EJ6A 4A26A 1U3VA 4UAGA 1E77A 2R7NA 3L0DA 2RIRA 3I9LA 3PHLA 1KC7A 4YCAA 1N8KA 1X0XA 4PG5A 2NU7A 2B83A 2IRWA 4JCOA 1OOEA 1PL6A 4G2NA 1ADFA 4W7IA 4CM4B 3RD5A 1YWGO 1UJMA 2VN8A 4GWGA 5K6AA 3BHIA 4CQLB 4MVJM 4PRKA 5IG2A 3DBVO 2QZZA 4UEOA 4O2BF 3K9QO 4BNWA 4XYLA 2JL1A 3JD2A 4RVFA 4A2CA 4OSOA 5AQ1A 4A03A 3OQ6A 1P1IA 3DZHA 3WOHA 1O8CA 5C1OA 2CY0A 1GFSA 1UZLA 2DVMA 2NVUB 3TZQA 4S1VA 2EJVA 5IAAA 1Z7EA 1I3LA 1VL8A 3KEQA 8LDHA 4IM7A 4Y67A 5BNFA 5L4LA 3U4IA 3ICCA 1PIWA 1XG5A 1ENOA 4K26A 4IIVA 4UEJA 4D41A 3W4KA 2W71A 4I1IA 2DAPA 5L3ZA 4CM6A 1WMBA 3ZV4A 5EPOA 3GIDA 4CL8A 1Y9AA 1ULZA 2QYTA 2NQTA 1E3IA 2R7LA 4M54A 4Q3AA 3V4ZA 5I8ZA 1DIHA 1KVSA 1SOVA 3JQ8A 4M89A 3GVCA 5THKA 2FPGB 1IY8A 4CQMB 3GMDA 4NK4A 3H5NA 3DZBA 3GVIA 4GMGA 3K6JA 2QYSA 1PJ4A 4IDCA 1HLPA 3QVWA 4ZQFA 1YQXA 2IZ0A 2Q99A 3R5XA 1NR7A 1E3LA 1YXMA 3D7LA 3AFNA 3QLJA 3WSWA 4I9NA 4LISA 4ALKA 4J1SA 6ADHA 4Z9YA 1LQUA 1E1MA 2Q3EA 2ZTLA 2R86A 4KZPA 5DDIP 1EK5A 2C59A 2UUOA 3KXDA 1M0WA 3FF4A 3PYXA 4XR4A 2CF6A 2Y05A 3DHYA 4LN1A 2WE7A 5DCWA 2C54A 3F6YA 4JN6B 5JYDA 4ONEA 1U2DA 1X7GA 2NLOA 1E3SA 1K5HA 4YRAA 1XQ6A 5DBIA 4YAGA 2P0AA 3JYQA 2HMSA 3U55A 4ITUA 1W93A 4HXYA 1H6DA 2B69A 1R15A 4IZHA 4XGNA 3W4JA 1NX6A 1VC2A 4PFJA 1KIFA 4KDEA 5JDCC 4CM8A 3L4BC 4CMEA 1EZ1A 1Y5RA 2CMDA 2A92A 4W7HA 2UDPA 1XU7A 1DIKA 4IXTA 5EN4A 3WQSB 3VZSA 1ZJYA 3SE7A 1OC2A 1YDEA 4J2HA 3WXBA 1C1DA 4CM1A 1PJ2A 3PIDA 2ZJ0A 4P38A 2HLPA 3BTOA 3DOCA 1ONPA 1YB1A 5G0SA 1TXGA 4ZQBA 2JHFA 5ENVA 3CE6A 4F45A 4YAKB 4CM7A 2Z1MA 1YOVB 1IUKA 2W2LD 3ANNA 4PG7A 1B8PA 4ZRNA 1DDOA 3PJDA 1CJCA 4MVJP 1Z7BA 4QEDA 4FOSA 2B37A 1UUFA 3LT1A 4ALMA 4PG6A 1AGNA 1EVYA 1HDCA 4TMFA 1FDVA 3NT2A 1SB8A 4HY3A 2PTGA 4XB1A 1DC3A 5CAEA 5I9NA 3ZWXA 4DBZA 4WPGA 1E6UA 1ULSA 3HG7A 2GN4A 1HDGO 1Y81A 4NHEA 4URFA 3NRCA 1ID1A 3HDHA 4PLWA 5JPIA 3TN7A 1MUUA 4XRGA 2ZCUA 3V2HA 1JQBA 4WCDA 3CSDA 4CMKA 3PWZA 4ZHQF 1BXRA 1IZ9A 2UVDA 3N74A 1UP4A 1GTMA 1KEEA 3LK7A 4IY1A 4IQGA 1G1AA 4XYMA 3ETGA 1XIVA 3DWFA 4YVFA 2AEMA 4Y6SA 1Q0LA 3Q9NA 4HBGA 3ZH2A 4GX5A 1IULA 2I87A 4MVJG 3U4CA 1A9YA 3JQ7A 3RJ5A 4PN3A 3GN2A 3K8ZA 3ZHYA 3JQAB 4CL3A 3E9NA 2A9FA 4L4XA 1UDCA 1M2WA 4OKIA 3ITKA 3DBHB 4Z9XA 3WO1A 5F5NA 3NKLA 4GQAA 5KJCA 1P33A 5LDGA 4EZBA 1GU7A 4FFRA 4WUVA 4YJFB 2YZGA 3EW7A 4BB6A 3U9LA 1LSJA 4Z6KA 1WDKA 5ICSA 2EG9A 4B3IA 2EGHA 1Q2XA 3ZWVA 5C3MA 5A3JA 3OIGA 4A5OA 3ULKA 4E31A 4AJOA 2BFAA 3WJAA 3DBRB 2FB9A 3KVOA 2O48X 2Y1CA 4M86A 4CR7A 2UUPA 4MVJI 1CS0A 1HZZA 2R00A 3GG2A 4M49A 2G1UA 3VVCA 5IZ4A 3GHYA 4RZIA 9LDTA 1CWUA 5L51A 1OBGA 3KZVA 5TSDA 2DKNA 1X7DA 4N5NA 1E1NA 4YR9A 1X15A 4YJDA 5ITVA 2Q4EA 1V3VA 2GN9A 4TSKA 3H9JA 3H65A 3BMCA 2OLSA 3H4VA 3WO0A 3C1AA 4B4OA 3Q11A 1NHGA 2B5WA 4AJEA 4JX8A 4BKOA 4OOEA 4U6SA 4E6PA 3G8DA 4BO3A 4GVXA 2JHGA 4O1MA 1CQJB 2B35A 3BMQB 4PVCA 1JKJB 1H6CA 1A72A 2Y67A 8ADHA 3BIOA 3WGHA 1NAHA 4EBFA 2BMAA 4WK6A 4QSMA 3G79A 3QA9A 4R5MA 2OOSA 3AW9A 2OMEA 4WEOA 1Z2OX 2YW9A 3MJVA 5TX7A 3UXYA 3ZWNA 1XSEA 1A4IA 4NJMA 2Q1TA 4IQ8A 1ULUA 4NBUA 5TS3A 1UXGA 4R69A 3WLFA 2JFGA 4F3YA 1I36A 3LT0A 4O84A 3FN4A 4WCFA 1YE3A 4J9UE 4UUMA 5COQA 3RAJA 2QHXA 5IDYA 5JAIA 2W6NA 3DZJA 2LDXA 2CVZA 1R4NB 4HUJA 4CM9D 1Z6ZA 1DC6A 3FTPA 3H6KA 4RPLA 3DC2A 5JFOA 1GUYA 2QQ5A 3HE3A 3WDSA 4OL9A 1R0LA 4D7AA 1M6HA 4JBIA 1H6BA 4HFRA 4O7YA 3L9XA 1QYCA 5JAZA 1W96A 4MAMA 4UVGA 4MVJF 1PQUA 2YHIA 2DBZA 1B3BA 2O50A 4ZQEA 3DTYA 2WYWA 2FR8A 3VOTA 2GPSA 3PK0A 2EEZA 3U9TA 5BPHA 2Z5LA 3UVEA 1EUDA 3O9ZA 3PHGA 2QRKA 3HB4X 1PQWA 4K28A 3T4EA 5CEJA 2JFFA 2P9EA 4AJ2A 1HT0A 4O7WA 3PRJA 4PLCA 5DZSA 4BNYA 5U1PA 2EXXA 4D0RA 1GZ6A 2GNAA 2FMUA 3JQGB 1LLQA 5DP1A 1XKQA 3GUCA 2QIOA 5TF4A 5JSFA 5CPBA 3WB9A 1EVZA 1H9AA 4IBOA 3H2ZA 1LDBA 3FSRA 4NIMA 4YAJB 3ZWWA 4NZ9A 3DBLA 4QT0A 4YRBA 4JQCA 2H63A 4NQZA 2I3AA 5T57A 4L4RA 1C1XB 4B8ZA 5KKNB 2BH9A 2I5PO 1HYHA 4PGFA 2PZLA 3FBGA 4UULA 2P5YA 4AJKA 4RPGA 4OXKA 3RUFA 1R0SA 1HE4A 4E5YA 1WXDA 1QLJA 4BO8A 4GX0A 3O8QA 3IQDB 5AVOA 2J6IA 1U7TA 2RCYA 2ZTUA 1U3TA 3C7DB 3U4DA 4CMIB 3TF5A 4I08A 2AQ8A 1NBOA 4YT8A 4DPKA 1O5IA 4BMVA 1GAEO 5CDGA 3AOEA 3CTMA 1OI7A 5J2TF 2PD3A 3LC7O 4GBJA 5KJ6A 3UGKA 4R54A 4MVJH 1PX2A 2FRDA 3TWOA 1KYQA 5ADHA 3SC4A 2WM3A 3ENKA 3PHIA 4BNVA 4EITA 1QRRA 1FK8A 2Y0EA 1RYEA 3ORRA 2NACA 1PWZA 3PYMA 2VZ9A 4BMSA 4LGVA 2HU2A 4Y6RA 4CM5A 1B8UA 2E37A 2QF7A 1RM0A 4Y8VA 3NUAA 4ZN6A 4P4GA 2V6FA 5JS6A 3QJ5A 2W6OA 2O4CA 4MOWA 1HE5A 4DMLA 5DBGA 1DO8A 3TRIA 1QXSA 1KY4A 1L7DA 1LI4A 1KOLA 3U4HA 4D46A 4D3DA 4DYDA 2ZDQA 4XZ3B 2YS6A 4E2WA 5CDSA 4IZOA 3GC6A 1R37A 1GY8A 1I2BA 4A7PA 1LEHA 5FYDA 2GUGA 4O86A 1H2HA 2BFPA 2YYAA 2H9IA 3JYPA 2OL4A 2YY7A 4KUHA 1JAYA 2GLTA 3STHA 4CJXA 1MC4A 3BA1A 3D1LA 3RC9A 2RHCA 3SLKA 3PZBA 5TJHA 3DQPA 1E7WA 3U49A 2ZB4A 1GLVA 4L0QA 4TKMA 1WZEA 2BRUA 2EF1A 3JQBC 4Z9FA 2HRBA 4FW8A 4PCVA 4L76A 4AICA 1H93A 4C5BA 2E48A 2HKIA 5HS6A 2X5JO 4CUJA 1NQTA 3AM3A 1KS9A 5L45A 1HLDA 3RKUA 2FPIB 2AXQA 1U5CA 1E4EA 4H7PA 4CMGA 1HXHA 2D1YA 2YYYA 4IUYA 4DIBA 2G5CA 2W90A 3JSAA 1ISJA 3S55A 4CMAA 3OQ1A 3VZQA 3NDJA 4JJIA 5DCYA 4Q3NA 1RM5A 2R2GA 4U6QA 4D0SA 4FJ2A 3F4LA 4O7VA 1A9ZA 1JW9B 1K2WA 5FFFA 4BNZA 1JKFA 4DL9A 3O4RA 3UFXB 3B70A 3FPLA 1ZKMA 3NUGA 4BVAA 2R87A 1EVIA 2NU9B 4O4HF 3PZRA 4RZQA 2V59A 2YHUA 1IOWA 3WGQA 5G4KA 2X5OA 3F9IA 2DQ4A 4U0KA 4H15A 3ZW8A 4H3VA 3GUYA 3KYDA 1V9LA 4GKBA 4E3ZA 1U5AA 3V4SA 1MX3A 4L8VA 4NBWA 3T7EA 2R85A 2VYNA 3R1IA 5CDTA 1IPFA 1KJ9A 1JLLB 1N1EA 2IXBA 4BUCA 4DQXA 3R5HA 4UEKA 4BNMA 2CUKA 3H7AA 5IYZF 2Q49A 1WZIA 5AXDA 4HP8A 1I3KA 3KLMX 9LDBA 4DXHA 1C3VA 1PZGA 4MP6A 2A35A 5HBRA 5EZYF 1BNCA 4K9DA 3U62A 3MOIA 3EZYA 2GZ3A 3RUAA 1ZXLA 5LC1A 1LLDA 1UZMA 5H80A 1T2AA 3HQ4O 4IJVA 2X23A 1AHHA 4YJHA 4KOAA 2P9GA 1P77A 4FSHA 3E82A 1P45A 3HUDA 2HAEA 2QX7A 1QLHA 3GNTA 5CG1A 2O3SA 2GN8A 2Q1SA 4IS2A 1SNYA 5DN9A 3OSUA 3RSHA 3PLNA 3BTSA 1FDSA 2ZCVA 3GPIA 4I5GA 3DMYA 3LLSA 3TPCA 2PKQP 5I9MA 1LU9A 4F6CA 2WD8A 3I9OA 2J5RA 2WSBA 2YV1A 2Y1DA 5LXTF 3HN2A 5TIIA 2EGGA 2GERA 5FF9A 3GLQA 3KLPX 4N5MA 1I7NA 4YJ2F 2C7GA 4HX5A 1B8VA 3JTMA 1KETA 1BXKA 1FXSA 2C29D 1Q7GA 3LF2A 4OQZA 2I65A 1QG6A 1JDEA 1T1RA 2JD2A 1LC3A 1P74A 2IP4A 2VUSA 1XQ1A 3FWNA 1PS8A 3QW2A 1Z75A 3JZIA 1MA0A 3JQEA 3UCFA 2B36A 3GFGA 3ZHBA 3ONDA 2WYUA 3ROMA 1ZMTA 3HFSA 1MGOA 1NP3A 5A04A 2GD1O 4E2XA 4NBVA 2IEBA 5KX5F 3VKUA 4D3FA 1GUZA 1YBVA 1TT5A 1XLTA 3BZUA 2ET6A 1YL6A 2ZTVA 2BF7A 4B7UA 3WGIA 1VL6A 1R4MB 4NDNE 2WD7A 4YQYA 1ISMA 3BMOA 2AEJA 5TT0A 3EC7A 2X0IA 2Q2WA 3BAZA 2CDAA 1PS0A 3D3WB 5BQFA 2YRXA 3KREA 4LMRA 4W99A 3O26A 1U8FO 3GR6A 2NVUA 4OH1A 4ZU3A 2C00A 4BNIA 2NUAA 2QG4A 3SXPA 5D8DA 3OJEA 1BW9A 5KCZA 3LLVA 3H5AA 4HWKA 1DXYA 2H1SA 3HDQA 3QY9A 1JU9A 2V7PA 1O9BA 1SMKA 4LK3A 4LRSB 3ZV3A 3PJGA 2OXIA 3HZZA 3TQHA 3B6ZA 1I5RA 3BMNB 4FCCA 3L6DA 3VTFA 3ZWPA 4FPXA 3I4FA 3DEYX 4J49A 1O6ZA 2Z95A 3TSCA 2AE1A 2PZMA 3DHEA 2DPGA 2AW5A 4B3HA 4EGJA 4NMHA 3ZV5A 2GO1A 4GLLA 2CVOA 2GGSA 2X86A 4DIMA 1U7HA 2FPPB 1BHSA 1E7RA 1IHXA 2YFHA 3VC7A 4QXMA 3SLGA 3JZFA 2VHXA 4ND4A 2QRJA 3GVXA 3UUWA 1PZEA 4YAIA 2SCUB 1ONOA 1YQDA 2I6TA 4XJSA 3KBOA 1M75A 1NFRA 4R9RA 1OZAA 4YT2A 4FGSA 3RC1A 1PL7A 3G49A 2EHDA 3I9MA 4FIZA 4OM8A 3ETHA 2VQ3A 3E9MA 1B6SA 1R12A 2W6MA 2OZPA 5EQFA 3RFXA 4GWKA 3D4NA 1EUZA 3VPXA 3QWHA 4J3FA 5A4DA 3WQQA 1D8AA 5G0TA 4IZIA 3FR8A 3GLKA 4HR7A 4YEDA 4FR5A 4D79A 4ZQHA 1P44A 3RUPA 3D4PA 4BS9A 1DV1A 1M6VA 4M1QA 2IZZA 1CQIA 2POQX 1P0FA 2WWRA 1AN9A 1ISHA 4KP7A 5T67A 3KYCA 3ZWYA 5JAQA 5IXSA 2OBNA 3I3OA 2Q2QA 4O5OA 5IF3A 1YOVA 3W6ZA 3DZKA 4BNJA 1V6AA 2JFHA 2JD0A 4J9VA 2ZJ1A 2Z04A 4K1LA 4BGEA 4BKRA 4BV8A 5JQWA 3MJCA 3OFSA 3S8MA 4BO5A 5FNVF 4JJFA 4L75A 2B4QA 1N9GA 4AJIA 3UKOA 4PRLA 1PJTA 4BO7A 4KUEA 1MV8A 3LYLA 3S1LA 5BSHA 1XELA 3UH1A 3WTCA 3O38A 1P1JA 5G4LA 4EJ0A 4J4TA 1GUFA 5F3RA 1LSUA 3FI9A 4D3SA 4CM3A 4IS3A 1ISIA 4J91A 4XIYA 1PJSA 2FN7A 3AU8A 4PLPA 1ARZA 4NBRA 2ZYGA 4XX0B 2GR9A 2NTNA 1LXCA 2VOEA 1VSVA 1FDWA 2HUNA 5HV6A 3U9SA 2PNFA 1S6YA 5L4NA 4ILKA 4LCJA 2JCVA 3MEQA 5L7YA 5B1YA 2VWGA 3GGPA 3LSYA 3OQBA 2NTVA 3NEPX 5HM8A 1U28A 2YQ5A 4NYEA 4L73A 2DBQA 4NI5A 4U7WA 3GZNA 4MVJA 5I7EA 2NU8B 3WNQA 3WYBA 5HS4A 5IZCC 1ZEMA 4NK5A 3C85A 1C3OA 3WS7A 3VH3A 3ON5A 2YJZA 4JLWA 1VPDA 3BYZA 1VKNA 4MIEA 4QECA 4ESOA 2DPHA 4PLYA 1AXEA 2J3JA 3KV3O 3GMSA 5K0ZA 3A1NA 5L7TA 2V58A 4HKTA 1SOWA 3JD3A 3L6EA 5DCUA 3R23A 2PY6A 3IOYA 4KMSA 4CMJA 1JDJA 4Q3EA 3GFBA 3AWDA 4AJHA 1KBZA 4CLEA 1A27A 4EUFA 3IC5A 1Z73A 5CFZA 4M87A 4IIJF 1NAIA 1YRLA 2C5AA 1I2CA
chains in the Genus database with same CATH superfamily
1ISRA 4QOGA 2P6RA 3OJFA 4W8GA 1W0JA 3ZLVA 3EIWA 2QSZA 4DQKA 3A9TA 2GXAA 4H77A 3F7TA 1XL1A 2C2YA 1Z4PX 1MOPA 1Z4QA 3MTGA 5KSZA 2YW2A 1EX6A 3FMOB 3RKRA 1H0KA 5LL6P 3DF7A 1TQHA 3HEBA 5HGJA 3RBZA 2YZLA 2ZYIA 5FPSA 2QVLA 5BWOA 4F84A 4YHHB 1ZOIA 3DR3A 4HDRA 3I23A 4ZOBA 3AW8A 5DJ5A 3RSGA 1RKBA 5L6MB 2PZAA 5C7LO 1FF9A 4QPPA 3A2NA 3TDKA 4ESHA 1I2LA 2RGYA 4NBSA 3P19A 5DFAA 3LMKA 3FYTA 3MIZA 4LBZA 1QH8A 3K0CC 3MUOA 4O3MA 5B3JA 1KJIA 1QH1A 3MWDA 2NZYA 4FC6A 1N5JA 1RAHA 2Z6VA 1ZN8A 2GPAA 4IOLA 2PGNA 4I55A 1XVTA 2FWIA 4HI0E 1VMDA 4PE5B 1VSBA 4FCTA 5EI5A 1P19A 2OLKA 4R05A 4B4UA 4DXAA 5FPQA 1UT8A 4XARA 1NR1A 3QP9A 4EF6A 2XYPA 1JIUA 2AOUA 4ZYUA 2Z2ZA 5CFNA 5J2TA 2M9MA 2CFIA 4MV6A 2ENWA 3Q3VA 1AM4D 1N1GA 4P4NA 1JHRA 1IC6A 2AXNA 4W5NA 3C5VA 4FDAA 3BILA 1JLSA 1HZJA 3AH8A 1YAJA 2WJIA 4JB0A 4Q1FA 5AUQA 5T8KA 3WGTA 3U7HB 2YKGA 2OV3A 2QK4A 2JFWA 3RVJA 2HPHA 4BFCA 3UUFA 3U3OA 4DV1B 2CNOA 3AQ4A 1T4DA 5SZHB 4B6OA 3I4CA 1YL7A 4DPMA 2RGUA 1O3YA 3CUSA 3LW8A 4GI2A 2R8ZA 4GPTA 3K35A 4ZPJA 1MPXA 2G70A 2HLDD 2VK2A 2BEKA 1OBFO 3P2OA 4RCZA 4YRMA 4I9HA 1QIJA 5TMEA 5AVYA 1UXHA 2VAWA 2AW3A 1AKRA 1DFHA 3MD9A 3N53A 4UOQA 3IALA 2X22A 1M34E 2XCRB 1QFZA 3VGPA 3WTBA 1COWD 5FDFA 1VLVA 1Q3HA 2P2CA 4C14A 5T7BA 5HCUA 3KNZA 4WLUA 2PPLA 1Y4DE 1I2ZA 3KLOA 4Q9IA 1LZKA 5GONF 2HPAA 2I6SA 1A1VA 1GFWA 3NWJA 4XLTA 5TPZA 3TLXA 1ELOA 3UMBA 2O5EA 4HNQA 1ZNWA 2AN5A 2VUIB 1L5OA 4GUDA 4QO8A 4ZVUA 4BN5A 3B1XA 1JIIA 3O91A 3SJCA 3K2EA 1KI9A 3EVDA 3FYUC 3B48A 2MSKA 4PRYA 3JQ9C 4MMXB 2V1XA 4GX1A 3ZDXB 2B82A 2AVDA 3HNPA 1Z08A 4BO6A 1K4MA 2F3QA 3BJZA 4FC7A 4Q4AB 3QVXA 3HXQA 4WLNA 3RU3A 4PZCA 5DISC 3AIMA 1CRQA 3CUKA 4UEQA 3KYIB 4KGZA 3S99A 3HXTA 3EC2A 3HO8A 4QE3A 5J5CA 2C4NA 3UNXA 2BHTA 4OHVA 2V9ZA 3PLRA 3PXGA 4HWPA 1F7VA 4HAWA 3GH1A 2C03A 2XE6A 5D87A 3W1WA 4L9AA 3S1AA 4UHHA 1TK9A 4GR4A 1RHUA 4UOEA 4YLYA 5I7WA 1A76A 1MJGA 3L7LA 5GY7A 1BMDA 3KL4A 1U3WA 3ZZUA 3QSGA 1KO1A 4B79A 3PE4A 4XTRA 1UBCA 4LHWA 1FPQA 3ZOKA 3O03A 4K6NA 3OE7D 1B16A 3RBXA 1X8KA 3M9WA 1KYZA 4CC6A 2Q4DA 2I67A 1MXHA 4R1TA 1G4HA 3IV6A 1KRWA 3I6ZA 2E87A 4YB8A 1H3FA 1NWCA 4FE3A 5KNCH 3ABOB 1EHCA 4MV8A 1IH8A 4LOAA 1X0VA 1TZJA 1E2EA 1ACJA 2FSUA 2JCBA 3AHDA 4X1KA 1UH5A 2WTNA 4GEKA 1AKEA 2R1VA 1ID8A 2ZVQX 1ZO8A 1U3UA 2EX1A 2WJYA 3ZTWA 4LX8A 3WQHA 3MSXA 3CVJA 3VKGA 2DBRA 3C7AA 4UCUA 3I1FA 5E6RB 1MO2A 1ZINA 5F4BA 4BFSA 1K75A 1WQ3A 3F5MA 3G9QA 2Q1XA 1RIFA 4TOIA 1BX3A 2CLHB 4OO3A 3RVLA 1F2DA 1GZ4A 4OI2A 3ZCPA 4J0JA 1PJQA 2W0SA 2K7ZA 4DQ0A 1PJBA 1P31A 1Z3CA 2BR4A 1PWXA 2ZWVA 3FWHA 2O52A 1I10A 1PR2A 4EHKA 5BYAA 4WZBA 1DIGA 4MLDA 3TFWA 4TPKA 2C5BA 1WMFA 4MW1A 4A91A 3UK1A 2OWOA 5C35A 2F62A 4R6WA 1R9JA 2ECQA 3A1TA 5CD1A 4A6DA 2HK9A 1EBFA 2QV7A 4WL0A 2VCHA 3FKQA 5F64A 4G65A 3OBBA 4CM8B 2QU8A 3ZQ4A 1XCOA 4ARCA 3R5TA 3W5BA 1RNLA 1ULTA 5FUWA 3UT5A 1VHJA 3UW1A 3CUEF 3LBIA 1RKXA 5HE9A 3RYHB 4CU2A 4LSWA 2WKSA 1QYXA 1KGSA 3CV3A 4X9XA 2RHRA 2WF9A 2XDQA 3O1LA 1GAQA 3VR4H 4PYQA 4Q00A 4GIBA 2OC9A 1T0UA 5CYGA 4ZGWA 3MM4A 4ZOLF 3KSRA 1G7RA 4K6HA 2WJGA 3WL4A 4I4TA 4B83A 4I99A 1G2IA 3EOAI 1KO7A 3G1TA 3T9DA 3G0DA 4RH0A 4UNPA 2WW8A 3M83A 4E4YA 5JATA 5LXTA 2GZHA 1ORWA 2FOLA 2QAGC 2XUIA 3FKSD 4O0LA 1C1YA 3OURA 3ESXA 2FMFA 3DAOA 3ICPA 4HGYA 3V9PA 3W5IA 2Z2IA 2PVSA 1I2KA 1O5TA 2XD4A 1TM5E 1WO8A 2WFMA 1I30A 3ED1A 3LXUX 4TL8A 5ILQA 1IPEA 4G9EA 1H6AA 1ZK3A 1WW2A 4TRJA 5GQSA 4DKJA 4ZT3A 3Q41A 4G0UA 2C4HA 4J94A 1QQAA 4I3HA 4NF2A 1A4XA 1G6OA 1P72A 3GROA 3HLTA 4P7BA 4V03A 3RSHA 1B6RA 3L1HA 3KB1A 3FFBA 1ZK4A 2VPXA 1BD3A 1J6UA 1Z28A 3MWGA 4MVJE 5FTMA 2D5BA 2R7AA 1EHYA 1QGZA 3D2LA 2WU3A 3KEOA 4TT3A 1ZUD1 2QRZA 1GRVA 3D7SA 1G4AE 3I2YX 1O7JA 1G8JA 1T2FA 1J0BA 1MOQA 3AVXA 1M2OA 5FI3A 1W36C 1PR1A 4ER3A 5LQDA 2FSPA 3LCRA 5F12A 2EJ2A 3KQMA 1BXRB 1GEEA 4DJFC 1QRUA 3TFQA 3RCBA 2R7KA 5GP1A 4QGSA 1QHNA 3FPBA 1QE5A 3T9EA 5BT9A 1V16B 2G72A 3K6SB 1QE3A 1VLHA 4Y9DA 3VDNB 2CFMA 3B5EA 3FB1A 4N54A 2V7EA 4GAEA 4UXJA 5B58T 3GBVA 4KMRA 1XZKA 4PYNA 3ZHVA 1VJ5A 2RAFA 2Y0DA 4JB8A 2ZUFA 2MYTA 3HJAA 5KVAA 5EXEA 3F49S 1F2UB 1JLLA 2KM1A 1XTIA 3MJSA 4TMTA 1YJ5A 2PXHA 1R8SA 4K9SA 4EATA 3ROTA 1H2FA 1W19A 4RJLA 5EIAA 4CKEB 5BNWA 5ALYA 3P2KA 2CB9A 4KSCA 3UJHA 4MQ5A 4A0FA 2Q3HA 4I1UA 3ZE1B 4QQFA 4HDNA 1CKNA 2V7XA 3G2LA 3UW3A 1G4UR 1IZYA 1G8AA 2JJYA 2PUHA 2C3UA 3PTZA 4B5KA 3OZGA 3DE0X 4FZ3A 2DWPA 2JJ2D 4DCVA 4DHWA 4YBZA 5KC8A 1W7AA 2C83A 4GE0A 5IH3A 4GQIA 3U4QB 3DPSA 2VHQA 1E62A 3BK2A 3TIGA 3I8SA 1BDMA 4CTMA 1D0VA 1UL1X 3KKLA 2FWJA 4UHJA 1CS0B 1T15A 3SVTA 2PUVA 3ANTA 3NOVA 4MA5A 2ISSD 2AI3A 3RWBA 3IQEA 1E9CA 3GQVA 5KREA 2G8LA 1B3RA 2RHTA 3COVA 3LT4A 3R0IA 1XAJA 2B4TO 2OTCA 3EK2A 1ZX1A 3KT0A 3GLGB 2Q3CA 4HYYA 4ZJZA 4MV9A 2Y71A 3NUQA 2HZ7A 3WNZA 4TXNA 4R6XA 3V4VB 3QYAA 4C4PA 3EWSA 1WMAA 2CSXA 1TEVA 4E6NA 1LD3A 2EERA 4TTJA 1IWPB 1DARA 3PXEA 4F8EA 3NNNA 1I13A 2NADA 3FPCA 4U8GA 2VXYA 4H6PA 3RTBA 4L2IB 3WG9A 3MINB 4LFAB 2HRZA 3NT4A 4UJ5A 1KVQA 3UJ6A 5LNK1 4NBKA 4YCSA 3LOQA 3SR4A 3LZCA 1Z0SA 1HR0B 3AHFA 3L49A 1YI1A 3AGQA 3HRHA 4LDZA 2BMDA 2ILTA 4B8YA 2CW5A 4O4JB 4NJOA 3Q1LA 3KWJA 1T34A 1XD9A 2FN8A 4FJ0A 3TTUA 2W2PA 3EDYA 3ORFA 4EDFA 3IDAA 4RY9A 4UVEA 3U0BA 4A8PA 2Y8EA 1NF2A 3ADCA 3Q8LA 2EJ3A 4D1YA 1QCCA 4NJMB 3DE2X 1Q19A 1KEPA 4OX9B 1D6JA 3OZ7A 4AKEA 3R8XA 3DFFA 5JTTA 4X1IB 4B6EA 2YWCA 1TTTA 1JB1A 4HDOB 4R1SA 5IDQA 2ZJ7A 4B71A 3FVRA 4OHWA 4AY6A 1TUGA 4KBFA 2COGA 1GAWA 4WCFB 2J9GA 1P73A 5JD6A 3U3ZA 4IHJA 4L6AA 2AFIE 4JZYA 4KVAA 4MUGA 3IUPA 2GN0A 5KNDA 1VJTA 4MP3A 2CNBA 5IJ0A 4H3SA 3JU3A 4NEGA 3RADC 1F8XA 4OGWA 4TTIA 1UMCA 3JTEA 5JV5A 3CVWA 1T2CA 2BBSA 3EG9B 1CR4A 5T4EA 3ISTA 2IBMA 3U31A 1R6VA 1UMBB 3LUBA 2I8LA 2YWGA 1IQUA 3PRHA 3DTFA 4A27A 4BRZA 3U44B 4NXMB 5E9QA 4M37A 3T41A 2VEDA 2WDZA 3H7IA 1RPJA 3K0FB 3ZGZA 2ZGIA 5BSMA 2F1RA 2NYUA 1KFBB 4KXVA 3L2OB 1KE1A 4B32A 1E1CB 5J63A 3CW9A 1NI5A 1U98A 2HMWA 1HQDA 3JWHA 2O20A 1Q0PA 2IEZA 1EUDB 1S1MA 4RDIA 4IFTA 4IKEA 2UYYA 4HCJA 4RPJA 4AP5A 1WSBA 1M33A 1ZFNA 2Q8QA 1R6TA 1TU4A 3LQ1A 2RB5A 3UB2A 1XN4A 4D9MA 4C2UA 2VF8A 4NPAA 1XEFA 3ZNQA 4H1UA 4Z0HO 8MHTA 4PX3A 2FZ4A 4P92A 5EJEA 4YAWA 3PRKE 1JXAA 3S5JA 1LBSA 2QTHA 1KU6A 5D6OA 1EFVB 1GPBA 1U31A 5GJBA 1U0EA 2R00C 4LHSA 1JDBB 1JEAA 1XPJA 3KQPA 4ETNA 3AL0C 3OLYA 1DJPA 3L7BA 4ZJUA 2QJTA 1UKZA 1QGDA 3LL4A 4RWZA 4PYLA 1T2EA 5JS8A 5WRFA 3CONA 1PYOA 1Q91A 2NT4A 4ZI7F 1VKOA 4YUXA 3DUFB 3QG5A 2FEOA 1HE8B 4KXUA 5JAPA 4CE6A 1MJNA 1NPDA 2GB4A 4BVGA 2FW0A 1UAYA 2XW6A 5I5VA 3BHNA 4TWZA 5JRZA 4PYKA 1SXHA 1HE3A 3AJDA 4L5CA 4BGDA 1LTQA 2ZZKA 2C2ZA 1CR2A 3DP9A 4EAAA 4FE2A 3ILSA 1X39A 1LF5A 4HWRA 3DVLA 4PGGA 3IDQA 5DYNA 1ZXXA 3V1LA 1XDGA 3VR3D 1FX0A 3AXTA 3KQQA 5JLAA 1IHDA 4I4LA 3U56A 2VTDA 5A9TA 1N32B 2EP7A 2CLOB 1J2YA 2AIRA 1Z68A 2HQOA 3EVNA 4LVNA 2ZSDA 4P3PA 2Q4BA 3V46A 1WXFA 3N2YA 3OTHA 5JC8A 5BN5A 4L9SA 5JADA 1BCRA 1A4UA 2CE7A 3K0CA 2HBQA 4YQEA 4KPFC 1ZH0A 2GBPA 5DTRA 3OUUA 3VO9A 3SBOA 1XR3A 1X9NA 4ZICA 4D4GA 3ECSA 1JDNA 3F5SA 3GGDA 2FKNA 4L15A 4DTCA 4Y8VB 2IEDA 1M74A 2SHKA 3QPAA 4H6XA 3HY4A 4R84A 3RIHA 2CHFA 3CBGA 3TS1A 2PMEA 2PWPA 1OXXK 2LXNA 4KNWA 2AKAB 3HYNA 2IFTA 4CM4A 1NVFA 4EW3A 5E6SB 4M1WA 2D62A 3D2CA 5K5EA 1XMJA 3IA7A 4OV6B 1I4LD 1OIWA 3IIJA 3LYUA 3UWSA 3AZQA 3K9HA 4MS1A 3LQFA 1TLFA 2PN1A 1ZS9A 4N39A 5DN6A 4ME6A 3O31A 1UEJA 4CQLA 1E2QA 3ZIDA 4PN7A 5CLJA 1YCHA 3D8BA 5KNBD 1OKKA 1RYZA 3RPEA 3VFDA 1IL0A 4MIYA 4B3BA 2P11A 1WCWA 2FWNA 1GL7A 3CLKA 4O2AB 2Z83A 1X7XA 4RVCA 3W8NA 3PF8A 5CU7A 4MB0A 5EHIA 1NE7A 5KNCA 3GLHB 5KWSA 4II7A 1E4OA 5EMNA 5B36A 1XRPA 4RS3A 2HHCA 2JRCA 3RYCA 2OC4A 2QM3A 5D5PA 4QSHA 5TJ9A 5BV0A 4BNKA 2WM2A 4HB0A 4IXWA 1EX9A 1PZFA 3R7SA 1E9DA 1UBJS 1KEUA 2WC1A 3AJEA 4KB5A 1HUQA 2X8JA 3GFFA 1MPTA 1QTNA 1XRRA 3BS4A 4KPGA 1RHQA 1LB1B 4W1QA 4B1FA 5ILOA 4GH5A 2GM4A 1UZAA 4IGIA 4UAVA 3FNIA 4O83A 1GPH1 2N9UA 4JB2A 5JNRA 3JQ9A 3DZFA 2Q9BA 1P9NA 1ANKA 4B73A 3NP9A 2CLEB 3RRNA 3N0TA 3DZIA 4II3A 4V3BA 2IUSA 1DRKA 2REQA 5EG5A 4OXQA 3VTKA 1JDBC 5JCOC 4XX1A 1N3YA 3ZCSA 3NPAA 3MERA 3KOUA 3NV9A 4BB5A 2FMXA 2P9QA 2GQRA 5FWXB 2ZPUA 4XPIB 3ZZNA 1CZOA 2COJA 1T8PA 1H2BA 2QZSA 3HHEA 3ZY6A 1QE0A 4OA5A 1WR2A 1R6XA 4X6UA 2VPIA 1P8JA 3E6AA 1H2XA 1KSFX 1NVXQ 1NVTA 2C0CA 4FWBA 1AXGA 1Z37A 4XA8A 4O81A 1GRQA 3RQIA 4UPDA 3QE4A 4NAVA 1W5BA 2CDCA 3IXMA 5BMVF 4RCVA 1E1QD 5JMPA 1M73E 1RWKA 1JGTA 1QPBA 3BIWA 3KJNA 3M6IA 1TYCA 4Q7JB 3DNFA 3VR4A 2DFPA 3RIEA 4EUKA 4A16A 1S3FA 5KHLB 1VZ3A 3WISA 1PN3A 1VBHA 5EE9A 3QKTA 3PRYA 1QHEA 4TXHA 3AHGA 1IN7A 3IQHX 4ALNA 2QNRA 5JYCA 1ORVA 1Y1PA 5JSUA 1HNXB 1VECA 1EEXB 4Y3UA 1Z5ZA 3DEHA 3EQ6A 4TYNA 2Y0CA 4DAOA 4RQUA 1PYDA 1T5DX 3ETNA 3EVEA 2HMAA 4Q39A 2PYDA 1S9DA 5FBRB 3RG8A 3KSMA 2VBGA 3I05A 1QORA 1SG0A 5YASA 3L1JA 1DSSG 2DRIA 3DAGA 4I8DA 4OFZA 4QBHA 5HBRB 4HH3C 3WNBA 4GOJA 3MCWA 5D7BA 2H4JA 1O97C 5IAGA 1V4VA 1SAYA 4YGYA 4L4ZA 2HHFB 4QM7A 2AUTA 5EQTA 1GL3A 2HCRA 1WF3A 1MC8A 4JT2A 1GRRA 3MBIA 4M8NE 3M4ZA 3P2JA 4H6WA 4YA6A 5ITZB 1KOJA 3NDBB 4CTOA 2IVFA 2PS3A 4D9FA 4JK3A 1ESZA 2W6JD 4Q4HA 2FWMX 3MS2A 2GAJA 2VNJA 4UQLA 2VLIA 1NXQA 4EI2A 3IA2A 1LA2A 2CZGA 1QR6A 2O8VA 2VUUA 1NE2A 2Y1OA 3MOGA 1B2LA 4EJFA 2Y92A 1U2EA 3OU2A 1M6WA 5A1TA 3TGWA 4CCSA 4HVCA 2HBZA 1NMEA 1W34A 2Q4TA 5IAEA 4P3KA 3E7XA 1H05A 2HHHB 3QPBA 4KLNA 4NSNA 4PLHA 5DCLA 3SJBA 1JF8A 3E05A 4BBAA 2RGWA 4URVR 1LX7A 4D44A 3QU7A 2PMDA 4TKZA 4CF3A 5ED0A 4IPTA 1OWNA 2PCLA 1QIHA 2QLNA 1WCYA 2ZBPA 1H8HD 1RM3A 2PH5A 3TNDA 2AG8A 4UAUA 2JIBA 3CVOA 2ZT8A 3QM1A 2QAGA 1AHIA 1Z35A 2X6TA 4R3UC 3C8UA 3TJMA 3OECA 1A48A 2OE2A 2WNSA 3T9FA 1W4AA 5I7VA 3LGAA 1S8OA 2HWXA 1KVRA 4GECA 4GKAA 4QDTA 2VDJA 2KMLA 4OJKA 3V97A 3HBLA 1QKKA 1V3TA 5CLHA 3JVIA 3DBHA 3JD0A 3PUHA 3WMXA 4TYQA 1TT5B 1PNRA 5DEOA 1NDUA 1OTXA 2F1OA 3DDZX 5JANA 4FILA 4DF3A 4M60A 1Q0HA 4UZSA 4B6GA 2BKXA 2WD7B 3LNCA 2A94A 2WAXA 3EOBI 4K03A 5BUCA 3PEEA 4B3DA 1M34B 2HWWA 3I1YA 4Z9AA 4HWGA 3FTEA 1LRLA 3CEAA 3IEVA 4ZGBA 4OXIA 4GGPA 2B98A 2VP5A 4GP9A 1HE1C 4E13A 1VPVA 4BV3A 4DA6A 5BMOA 2GCNA 5EKDA 3FOCA 1JYSA 3AF4A 1D1SA 2RBEA 3OZWA 2HHLA 5EKSA 1LDEA 4JVNA 3V7WA 1JVSA 1XTRA 2NYRA 2MMGA 4OB8A 3STWA 5L3QB 2O2ZA 3UJ8A 2Q7XA 1Z5UA 2A7XA 2O1WA 3SC6A 3MRVA 2HSDA 1EBBA 3KKKA 3A6PC 2EAUA 2WFAA 3DZCA 3VVBA 2ACKA 4UM8B 1Y9JA 2B2CA 1L7EA 3O8DA 5KTKA 2XMRA 4D74A 4DTIA 1XE3A 1C80A 1HSZA 4GOND 3ZU5A 2IZ7A 3FZNA 1QPZA 4U02A 4YJ3F 3H2GA 3QXSA 4UBJA 3GFOA 4J07A 5DHUA 3GUVA 3QJGA 3D6TB 3Q85A 3NEJA 3R3ZA 5KVQA 2CK3A 1YB5A 1RWBA 2AN9A 1Q84A 3AIIA 5CIYA 1CQJA 2RBKA 3A36A 1CC1S 1N2CA 3BMQA 2PA3A 3HPQA 4LOJA 4QUDA 3E53A 2GDZA 4UOZA 3RRFA 1QJ4A 3BL6A 1WZNA 2GEBA 3HCRA 4BP3A 4Y0VA 2V03A 5I9IA 1PDOA 2PGJA 4QUGA 2DX7A 4GZ5A 3G8AA 3NC0B 4TQGA 4ZVSA 5KYWA 3AKCA 2HTEA 4OX9Y 4RIHA 4EX7A 4JI0B 2ATCA 1B26A 2QVZX 2BFOA 3EYAA 1Z4KA 2OCGA 4FWIB 3O82A 2YMQA 2YV2A 3G7NA 4WFQA 4N0EA 4WOJA 4YC7A 4CV1A 1C0EA 1FTYA 3G8CA 2Q9AA 2X15A 4IH1A 1IDOA 4DA9A 1KC3A 2XNHA 4PZLA 5LQMA 3OTOB 1VFPA 1SOMA 4MTCA 2HI0A 3CGGA 5EZQA 3H8VA 3JAMA 2P3LA 1XN1A 2QZ9A 1GGNA 4QYIB 5CGZA 2WNIA 5BUZA 4MH0R 4YMGA 2J9YB 1M1NA 5A5GA 1UBHS 3B53X 1XHLA 3HFGA 4G86A 5EJAA 4DMRA 5CK4A 2I99A 5LFAA 1OE0A 1Q7RA 2YHSA 4XASA 1DAKA 5CXQA 2YIDA 3CNOA 2GWRA 4KR9A 3DZ8A 5AVVA 1GPWB 2WQ6A 4DLLA 1CK4A 1U8ZA 4KVZA 5EFZA 4N5LA 4O1IA 4Q82A 4C7VA 4JCCA 3GJQA 5DASA 1SHKA 1X8XA 4UQOA 1RWXA 2H3EA 3H99A 3PWKA 5ERXA 1VG0B 4A2WA 5JY1A 2FEXA 4FFDA 1AUPA 5FWAA 5MN5A 1EVQA 2I4OA 4P0TA 5MN6A 1Y1LA 2J6HA 1YIAA 4BLQA 3ODPA 3Q8KA 3TZKA 2W2MA 2AZ4A 4GPAA 2C99A 4WJZA 1A5SB 2H2DA 2OK8A 3ZHXA 1BJTA 2VA9A 1I3MA 3F4BA 2J31A 4MUNA 3SWWA 4XM1A 2CXPA 2O6HA 3P9QA 3U6KA 1XLTC 1T5TA 4G07A 4KX3A 2HK7A 2X40A 4LTDA 4N9WA 3S24A 4ZU1X 2D0DA 1Z38A 2R5FA 4LVCA 1J2EA 3P32A 3V42A 5IKOA 4XUGB 1E2HA 4AMBA 3K72B 3MLBA 3EIQA 3W2IA 2HG8A 4OBBA 4D82A 2HFJA 4WESB 1NC3A 2RHGB 1PHRA 2PL5A 3FXAA 5SYAA 4JI1B 2E0IA 2BEUB 5AM0A 3V2GA 1K7CA 3FPGA 1I9GA 3B1JA 3NI2A 2WTAA 4W82A 2ZXEA 3R3YA 2AR9A 3K6SA 4EG1A 3KKZA 4QJ4A 2IIBA 4EB6A 2DFNA 4I1OA 3G8BA 5LMUB 5EZ6B 5I8WA 1C1XA 3RNLA 3FHCB 3BXOA 4E1BA 1K6IA 3WL3A 2HYIC 2FF7A 1L8OA 4ALJA 1HT1E 5IX8A 4JC0A 4ZV9A 2PUAA 4XFKA 4QXPA 1ZZGA 1OVMA 2X19A 3NXSA 4MPPA 2QN3A 4RD4A 4ZI5A 4BZZA 4CMIA 3NBAA 1C4XA 5ELXA 4P22A 2BM1A 5J23A 1DXHA 3ZQKA 1E1LA 2PFSA 2D54A 2G28A 3TBFA 1AUXA 3KWMA 2DE0X 4FB5A 1S0UA 1PJ8A 2ZRKA 3BXHA 2ZIGA 3LZDA 1I51A 2N75A 1N8SA 4NJEA 5EMKA 4OBWA 5EWJA 5B1SA 4MMZB 3S28A 4IDAA 2BKEA 1S9HA 5FP0A 5EEHA 4K0KB 2ODBA 4EHBA 4YRNA 1MA3A 2V1UA 3TY5A 1MJFA 1HE2A 3UTCA 1BE8A 3E2IA 3M4XA 1KQOA 3QWIA 3P9RA 3HJFA 7ADHA 4PC2A 3FNHA 3BJMA 3OEHA 4ZAZA 2XVYA 3FLMA 3OZXA 2CXSA 4FN4A 2JS7A 4XUDA 1M2VB 4J4HA 1MXFA 3Q0TA 3Q7SA 1T4MA 2C2KA 4LIPD 4YTEA 1MAWA 3HWSA 1VL1A 1JA1A 2CL6X 3K96A 1X14A 5AUOB 5LQJA 5B6IA 1J49A 4YYEA 4F4HA 2J5XA 3EQ8A 3N2KB 3FPSA 4OQFA 1LS6A 2DWCA 3ONVA 4WECA 1UF9A 2PLWA 4Q7LA 2W7TA 1FUEA 2PSJA 2FR0A 3D3QA 4HNGA 4ARZA 2D6FA 3FWZA 1DKMA 1Q0UA 2D5CA 1ZOOA 4NX2A 1E32A 3VSBA 2XZPA 3ANLA 3CX7A 5IANA 1X1AA 3NXKA 1XEWX 3RRJA 4AZTA 2ZI7A 4NE2A 1PGNA 1E7MA 2NZVG 1UJNA 1XJ5A 2A0KA 1YJ8A 3VH2A 4INJA 5LJLA 3A6HA 4PCLA 4RHFA 3NTOA 5FI0B 5M5BA 5CVTA 3HTXA 5IT9A 2E49A 5SZKB 5I5UA 4N0QA 1VKRA 4BE9A 2V7VA 2HA5A 4X71A 1YTUA 2R6ZA 1DV2A 4NEHB 2GBLC 4GX2A 5IC6A 1OBHA 2R6DA 4XIFA 1ZN9A 1ZU4A 3D3NA 5TR9A 1RPNA 2J3MA 5CT6A 2IOYA 4Y6PA 1V8BA 5K6AC 4YLEA 1M1ZA 4MITA 4Q1CA 1NQVA 2R60A 4B31A 3GFQA 3ZWMA 1JDUA 1XMIA 3Q0IA 3AWIA 3NOQA 2XF8A 4UUQA 1L9XA 5CVCA 3RU7A 1H66A 4GYWA 3QWUA 2E4VA 4QARA 3VHRA 4EOGA 4IZ6A 1XCLA 3DVSX 1QYVA 1E6WA 1U0LA 4JBXA 4DA8A 2CHVA 2PEZA 3JYOA 4FNGA 1T0IA 1SM4A 3K0FA 4L5JA 1RWVA 1TC2A 1PJZA 2ZK7A 3W6PA 4CYMA 3ZI7A 4XQ9A 1G5HA 2JF0A 3TLGA 3KJGA 1KORA 4PZ0A 1XCJA 1Z74A 2PK3A 4P35A 4WLFA 3N1UA 4BUZA 3L93A 3FJYA 5F1PA 1XNRB 4WBSA 1CQPA 1UOPA 4DLUA 4YYZA 2FUKA 6REQA 3DTVD 1CDDA 2WUDA 2DLNA 1IY2A 4IMPA 5G3YA 4KHZA 2F3UA 1G1MA 2AFIB 5TEWA 4BPBA 2H06A 3SDBA 4PC6A 2XIQA 5KIAA 1AU9A 1TQDA 1TF5A 4G37A 3LFUA 1KFCB 3K5HA 4UCRA 4FR0A 3U16A 3UHJA 3H5WA 4QOHA 2PAAA 1YCFA 2JKVA 3Q7IA 4DJAA 1GZDA 3HCOA 4DRXB 2PUEA 1GCOA 1ADGA 5TGDA 2JVJA 1CR1A 4MRMB 5JCOA 1TK3A 3AI2A 4MUEA 1I9CA 1SY7A 2ID9A 1W8DA 5AVXA 1I6LA 2VPQA 3KSZO 3SEQA 2NO4A 2AK3A 5EQDA 2Y68A 4IUDS 4RVNA 3C24A 1NFQA 5J2UB 1DU4A 5JQGF 1W4RA 1U11A 3IQWA 1K8QA 1YMUA 2L17A 2PSFA 2CDNA 1GGJA 2O2IA 3AUAA 4KQ1A 2B4AA 2P3QA 4LCBA 4O7ZA 3R3XA 4BMYA 4L3VA 4BAGA 2DPLA 2Q0HA 3TY9A 1NU6A 5CDFE 5AKYA 1NQAO 2A58A 3TSZA 3EWNA 4IYJA 4BNHA 2A4KA 4QNNA 4UTXA 4I55F 3GEHA 3F46A 4I1YA 3GUHA 4XDYA 4XOIA 5TQ2A 3DHWC 3CEHA 3W6UA 4BQPA 1TIKA 5KSYA 1NXOA 1RMTA 1T4CB 2MOKA 5K03A 3ZWAA 4M22A 2RKBA 3WVNA 4DCCA 5BP7A 2O57A 4K8RB 4MGEA 4KBGA 5DLPA 2X0DA 1KA9H 2BGLA 5DYGA 2BJVA 1DBVO 3VPFA 5AYVA 5KJEA 4AMVA 2IY9A 3W8RA 1XZMA 1YSCA 4C6TA 3IEUA 4G23A 5KYXB 4EMUA 3MJTA 2XOKA 4ZIRB 2AOWA 3C3EA 1Z3IX 5GOZA 2O8EA 1GPLA 2EIYA 3J7TA 1JPNA 1L5FA 1Y63A 3FMGA 1H69A 1YVDA 5DLYA 1ZCFA 2JIPA 2RGDA 5ALSA 1EDOA 2X0SA 3OCCA 4B6SA 2XB6A 5CFRA 5IU6A 4MRVA 3U3RA 2B6HA 4G5FA 4UDYX 1G42A 3MQ4A 2XYRA 3SKVA 4CL0A 1UKVY 4OIFA 1J5EB 4BNUA 2GNOA 1Z0KA 4KPUB 1R8QA 1Y1KE 2KQUA 2VC2B 4NDZA 2CNDA 2FP3A 2QD2A 4IQFA 5G0UA 3K9FC 2AF4C 3SIPA 3VR6H 1RMYA 1V37A 1V5FA 3OA2A 1MJHA 1SBIA 4I5DA 3L7AA 1LLCA 5E6UB 1E79A 4WDRA 4DGSA 5IK2D 3NV7A 4PO8A 1P1RA 2JDID 4L7QA 4BGIA 4WJLA 5LB2A 4O4LA 2EKBA 2P7IA 1ORTA 3V2IA 2F8LA 3L8EA 1AKTA 4A0GA 1AQJA 1ZXBA 2GESA 3R6DA 4EGAA 2AX4A 1FY2A 5IJAA 4FINA 1J2UA 4IG9A 2Y66A 3MWKA 3A06A 3M6AA 3HA3A 4L74A 3NO4A 3TLJA 1O96B 4GP6A 4K2AA 5BT8A 1UJ4A 1IRIA 5GZ3A 3BB1A 1LFAA 4IEEA 4GBED 2VJCA 4JOQA 5FWNA 1OFUX 3L7KA 1NF3A 2AR0A 2PBRA 3SXUB 5K0FA 5E0OA 2ZYVX 2BGJA 3FW1A 2EW1A 3OM0A 2ZIWB 1OPXA 1TZMA 3SNKA 3NR2A 1RJWA 2QY6A 1SB9A 2RHLA 1ZNZA 3A6DA 2K7FA 4RXUA 4YJ2B 1VJ1A 5CLQA 2W2KB 4WXMA 3RSFA 3O1JC 2CXTA 1M67A 1WNFA 1XQ9A 4E12A 3WL8A 1XQVA 3U5TA 2BHLA 3HEAA 3KKMA 3N87A 3N7UA 5B3LA 1GYQA 4UFPA 4YCCA 2TMKA 5C37A 5I4CA 4R8MA 3TH5A 2BV3A 1V5EA 5FUXA 3VHLB 4H16A 2IL1A 3EXHB 2DTEA 4NFSA 2J3IA 4MQ4A 2EFGA 3EPKA 3F3MA 3NHMA 2A9OA 4I1SA 4E46A 3EIEA 2OQRA 4KQCA 4N9QA 5JWRA 2H2HA 2PZKA 4KFUA 1WDTA 2PZ8A 4FNAA 3VC3A 1DAGA 2SCUA 4S04A 3THXB 1E2KA 1HOTA 5LN1A 3TLZA 4CIWA 4IHAA 1PK8A 3BVPA 1BQ4A 1O8BA 1Q14A 2XY4A 3DTTA 2X5KO 4Y2YA 3BHMA 1WUTA 1JNXX 1Y7TA 3A3NA 3PITA 2KHZA 4B0PA 2J30A 2R47A 2X4GA 1GN9A 3CKLA 3S2FA 1ZJZA 2QP4A 1QYDA 3IO3A 3ZK8A 3MUFA 2C97A 1PU2A 1F0YA 4C4ZA 2ZANA 5BVHB 5A1JA 2I34A 2ADFA 1T6XA 5E3JA 3ZPXA 2X6RA 4XD7D 5EWMA 4BC1A 3AJAA 5IP5A 1L7BA 4CMHA 3WIVA 3JYNA 5AKKA 3GJ6A 1R6UA 4HEJA 2QTAA 2NNWB 1MRSA 4MHOA 4MKZA 3MLEA 3ODGA 1VIMA 1QOQB 2W93A 4DCNA 1WVGA 5DOVA 4EW6A 2NP6A 4MGHA 2ZREA 4Q12A 4QWWA 3D43A 3ZQUA 4RK4A 2OM2A 1PFKA 1VYHA 1ZWLA 3DDUA 2PRSA 4LJAA 3OZFA 1Z06A 2H2FA 3VUEA 3MWYW 1PQPA 5DP2A 1ORRA 4BFTA 3QEBZ 2G1AA 2Y6UA 4IDFA 1BTOA 1X42A 3X1KA 4BX3A 3CHYA 2HHFA 1KF0A 4UD2A 4ER6A 2MDTA 5L40A 1RPAA 1R0KA 3WWPA 2C8VA 1Q6YA 2OBLA 5CNIA 3E8MA 4O2RA 3RRYA 5JNUA 2QP3A 3RAFC 2G3YA 4BXOA 3Q2OA 1TZCA 1EZ4A 3QX7A 3Q2IA 2EKLA 2GJ9A 1A71A 4S1OA 3G5LA 1Q2UA 2X9GA 4B3TB 1JHOA 2VG8A 5K9ZA 3UCXA 2ZKLA 4ZOCA 2ATIA 2TMDA 4XQ0A 5E9WA 1NP7A 3B7WA 1RHRA 3H3JA 1UFKA 5I5YA 4OOFA 4I4TF 3JQQA 4DLWA 1Z5WA 1SBCA 2C3MA 4F71A 5BWNA 1O6GA 3PQFA 3JASB 4RF2A 4OP1A 1LSOA 3IHWA 5EXSA 3PDJA 5U4QA 3SQWA 5BN3A 1Z22A 4P5DA 1U8UA 3FPKA 1CUYA 2OV1A 2I76A 1SVUA 4K6KA 3G7SA 3QNUA