4FFPA

Pylc in complex with l-lysine-ne-d-ornithine (cocrystallized with l-lysine and d-ornithine)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
363
structure length
353
Chain Sequence
b'MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYGLEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVLKERFGAVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase/product
total genus 119
structure length 353
sequence length 363
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ffpA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ffpA01
4FU0A 3RC2A 1LC3A 2VRCD 3K30A 1IPFA 2W70A 2NUAB 5TJHA 1T4BA 3C8MA 1GSOA 5IDQA 2AMFA 1KJQA 4UEJA 1H93A 1ZK1A 2ZQZA 4YQYA 5JAMA 1E5QA 1NQAO 2CNQA 2D5CA 4A10A 4HNGA 3V5NA 3A4VA 1T25A 4ZHSA 3H2SA 4FFPA 2YW9A 1DB3A 1E7WA 1P0CA 5B4TA 1IE3A 1WP4A 1KC1A 1O89A 5KTKA 1VE9A 3WFJA 4R16A 1U5CA 4CLOA 1RM3A 5BNTA 4R3NA 4BV8A 3TOXA 3S2GA 4J7UA 3ST7A 4BO4A 1NQOA 3AOEC 1BNCA 4PLFA 1H9BA 1BXZA 2HRBA 5C1OA 1YVEI 4NU6A 5T6BA 3ZW8A 2WE8A 4CLOB 3TQHA 1DDOA 3I1JA 1J49A 3V1TC 3PIDA 5AXAA 3JSAA 1WPQA 3IKVA 4HWKA 4NH4A 5BSHA 1MLDA 3FWZA 3ANMA 4PCVA 3DHYA 1BWSA 1LX6A 3WTCA 1IZ0A 1EFLA 4OMUA 3EYWA 4XX0A 1DAOA 2O7QA 3RQSA 1KJ9A 1BMDA 2DBVO 4DPLA 1P9LA 2VUTA 2JL1A 2ZYGA 4Y98A 1ADGA 1IPEA 1HDCA 1BXRA 3PHJA 2Y1FA 3DOJA 4XX0B 2OL4A 4UVHA 3R0IA 4WEOA 3BAZA 3MJVA 3EY4A 4HNHA 5BNIA 4KTTE 2OORA 4RVGA 3ZU4A 1YONA 4H16A 4JJIA 3SC4A 1A9ZA 4CV3A 4XYMA 5C5IA 1DPGA 3HSKA 4IJUA 1MB4A 4BB5A 1QR6A 1UDAA 1MXHA 4HQ6A 3C85A 5B12A 1JDEA 5GZ6A 1DOHA 2YW2A 2C7VA 1W96A 5KNLA 1T26A 3KV3O 3PDJA 5F21A 2HUNA 4BIIA 4CODB 4XYMB 3WJ7A 2HLPA 4EDFA 1LUAA 2ZIZA 2V59A 3NDRA 5U4QA 4CM6A 4IJWA 2Q1WA 1NQ5A 5JVLA 1KERA 2JFHA 3ZV6A 3V2GA 3ROKA 4ZA2A 3TNLA 5JQWA 1ZK0A 2BMAA 3S1LA 3VVCA 3DMTA 3UKOA 1LRKA 3C7CB 3DZGA 3STHA 1HTBA 3PGJA 1ZMTA 4D46A 2VZ0A 1J6UA 1KVUA 3O03A 1C0IA 4BKUA 4MAMA 4LW8A 1EE2A 4ND3A 1PS0A 4TROA 2P9EA 4BNYA 4ME6A 2WWRA 4YB8A 2O3JA 3K73O 4TRNA 1KEPA 4ID9A 1Q0HA 5IF3A 2W2KA 5HS6A 1Q0LA 5MGBA 1LI4A 4FOOA 2DC1A 3VH1A 2R7MA 4E4TA 1SB8A 1NBOA 4CL8A 4XR4A 2DBRA 3LC7O 4YB8B 3QSGA 4ALKA 2CNUA 5IAAA 2QHXA 1U2DA 3I6QA 2W2KB 1O9BA 4M55A 3CSDA 2AA3A 1A4UA 2X5KO 3WR5A 3FNHA 2Q99A 4B4VA 4CM3A 4M89A 2HMVA 2X86A 3KYDB 4ND1A 3I9OA 1R0LA 1B14A 4D45A 4DYDA 2C5AA 5J2UF 1XDWA 2ZKLA 1I24A 2Q2VA 3QLJA 4BS9A 4DIOA 4DBVO 4MVJI 5A05A 3IOYA 3TRIA 3C1TA 4Z0PA 4CR7A 2E37A 1LDGA 4K28A 4DIBA 4GMGA 2JD2A 1V35A 2NADA 3P19A 4LISA 4F46A 3O8QA 4FCCA 4ND2A 3G3EA 3V1UA 5K6AA 4FQ8A 1SEPA 5ER9A 3ZV4A 3PIIA 5ICSA 1HT0A 3LVFO 4GLLA 4ZQGA 1FK8A 5G0WA 1NAHA 4YR9A 5BSGA 3O8QB 1NAIA 3DDNA 5JSFA 3H9GA 3TQTA 5KJCA 3E18A 2EGHA 1VL0A 2UAGA 1ADFA 4IIJF 3GGGA 2J3IA 4YAIA 4LN1A 4ZJUA 3HN2A 1B3BA 3TW6A 5JS6A 4YCAA 1QV6A 3VTFA 3H65A 5HA5A 3B1KA 3GEGA 1NR1A 2RAFA 1VBGA 4ZQHA 1KUTA 3TPCA 2SCUA 1H0KA 4ND5A 3GHHA 1ONOA 2VWPA 5BT9A 4AJEA 5HRUA 4E21A 1PK8A 1DIAA 4TVBA 1EVIA 5C3MA 3Q1LA 3ROPA 4B3HA 2HCTA 4XJSA 2SCUB 1W8DA 4CM7A 4NR0A 4RQUA 2OBYA 4CM9D 1H2HA 3UN1A 1VKOA 4EI2A 2P91A 1KJIA 5IZCC 4AJLA 4B8WA 5H80A 3GFBA 5DT9A 5A06A 3LQFA 4FSHA 2VQDA 1P33A 3WFIA 1SC6A 4J2HA 1SCUA 2VYVD 3SBOA 4NBTA 1LU9A 1BTOA 5EN4A 1GUZA 3GK3A 1EVYA 1QG6A 1KBZA 4R1TA 3CE6A 2CY0A 4PG5A 2JHFA 1G0OA 3DBLA 2DTXA 4IS2A 4Q39A 2QF7A 2P4HX 4OQZA 1SCUB 5U1PA 4OSPA 4FJ2A 3TL2A 3QRWA 1DFHA 2CNVA 3F6YA 3DBLB 3PQEA 2NTJA 4XGIA 4AJNA 2VT3A 1PWZA 4A7PA 5KVVA 1QYWA 3I6IA 2WSBA 3HUDA 2YZMA 2EHDA 2C07A 3NKLA 2RH4A 4IJKA 4RGBA 1DXYA 1EUDA 3NGXA 2QK4A 1O6ZA 2ZB8A 4IM7A 1HL3A 3ETDA 5H81A 2BFPA 2QYTA 4B7UA 4CV2A 4LSMA 2AQKA 2W6MA 6LDHA 4NK5A 1A5ZA 3MEQA 4RZIA 1NWCA 5TF4A 4CM1A 1PGJA 2V7PA 1L7DA 1Z45A 1WDKA 2UYYA 1EUDB 3A28A 3HJAA 4I9UA 5L4SA 4O86A 1NX6A 2V6GA 2Q45A 4NBVA 4GGOA 2O3RA 4NFHA 4R51A 4I9HA 4NBUA 3HQ4O 2GUGA 3QP9A 3VH4A 4JJGA 4GMFA 2Y0EA 3EVTA 5CDSA 4A5OA 3AUAA 1CETA 2FPPA 4GI2A 1YRLA 3B1JA 4OJNA 1MX3A 5G0UA 3GY0A 3L9XA 2P9CA 2A94A 3T7EA 4ZQIA 1T4DA 3SLKA 4DC0A 1UXJA 4UULA 4QT0A 3X2FA 5JAQA 2O4CA 1C0PA 1NPTO 3K5PA 3KOUA 3ZNOA 2FPPB 1YBMA 1YS4A 3WGZA 4WPGA 3AUUA 4Q3CA 4J7CA 5EZYF 1KVTA 1ZCJA 3TZ6A 2ILTA 3U4DA 5T8KC 2VYNA 2D2IA 4IDEA 1ZNQO 3UCFA 1M6VA 4XDYA 3BMNA 1TXGA 3VZRA 5DZSA 1HE4A 4TUYF 3Q11A 4MVJD 2YQ5A 5A02A 2Y93A 3AM5A 1EUCA 4MVJP 4O0LA 5DF1A 3I5MA 4K26A 5JCJD 5LOVF 2QG4A 1GLVA 4AJHA 2W4QA 1P74A 3GGOA 2VCYA 1QMGA 1F8GA 3BMNB 3G79A 4KDEA 4L73A 1Q7CA 1BRMA 1J4AA 3ETJA 1I10A 3WNZA 2EG9A 3Q0EA 3PZBA 1EUCB 5DP2A 2DWCA 3O9ZA 3PLRA 3RUEA 4HFJA 1U4SA 3PHHA 4AJ4A 3JV7A 3IIEA 1M67A 3FD8A 1R37A 1I01A 3PPIA 5I9MA 4XQ9A 4YAKA 4WCFA 2HAEA 3WQQA 3ENKA 1DRWA 4O84A 3QQPA 4YACA 4BKQA 3OJFA 4XGNA 1EBFA 5I9LA 5MDHA 3DOCA 5AXDA 3RROA 1AUXA 2PFGA 2WTBA 1EUZA 4ALMA 1PL7A 1KEUA 3F4LA 3ZWPA 5DOVA 1I8TA 4YAKB 4WCFB 4FGRA 3ASUA 5T67A 4E2XA 1GYPA 4I8XA 4M1QA 4QTZA 3ANNA 3WGTA 1DEHA 1NVGA 2XXJA 5GY7A 3CMMA 4YVFA 3TZCA 1PGNA 3P7MA 3WBFA 4CMEC 4WBNF 4E2ZA 4BNGA 1H94A 5L3ZA 3MJ4A 5G2OA 1PX2A 4RCVA 4MP8A 1DRVA 3DFZA 3RAJA 4CM8A 1VC2A 1V3UA 3Q2OA 3VPGA 3QVOA 2Q1SA 4I5EA 1PZFA 1GL3A 4RF5A 4RORA 3K31A 1ENZA 2IE0A 5DCYA 3LT0A 4JBHA 3BTSA 4UUMA 3W6UA 4CM8B 4HFNA 1Z2OX 1YQXA 4UVIA 3ZDFA 2PZJA 1M6WA 1DIKA 3PYMA 4CUJA 2BI8A 3ZWWA 2QZZA 1U3WA 4OAQA 3U4CA 3L6DA 2EJVA 1U7HA 2DLNA 4WK6A 4CPDA 3DBHA 5HBRA 4NZ9A 2DQ4A 2BLLA 3OM9A 3E9QA 3PWZA 3PQDA 3F47A 3OFSA 4DLLA 1LDEA 5HV6A 3GPIA 4JBIA 2PH5A 1E3WA 1I7LA 4PFJA 3WICA 3U4IA 2QRJA 1NR7A 3DBHB 4W6ZA 3AY7A 4Q3AA 5HBRB 3LZ6A 4XQCA 2EWMA 2OXIA 4L8VA 2R84A 2AHRA 1E3WB 1HDYA 1NQTA 2FN7A 5A4DA 1DLJA 4J6FA 3OHSX 4B7XA 2ZCUA 1BW9A 2O7SA 3OH8A 4FE2A 4O6VA 3TJRA 2HJSA 3AW8A 1LDNA 1FDTA 4M49A 3RWBA 3U55A 1TVEA 4PLTA 2V6MA 5DBGA 4HFRA 5JAZA 3WGIA 1EYZA 1BW9B 4E31A 4BNIA 3RKRA 4E3ZA 3HE3A 2X9NA 4LCEA 1L7EA 1UP6A 3JYNA 2CNBA 3AM3A 3NTRA 1NHGA 2O3QA 4NJMA 4FS3A 5CHEA 3F5QA 4YEDA 4O7NA 3WGQA 3IS3A 3RKUA 3N74A 1OI7A 2V58A 1BDMA 4DREA 5JDIC 3KXDA 3OIGA 4BHTA 1AUVA 4MOWA 1I3MA 3H7AA 5CB4F 1M2WA 4WASA 3WGGA 3CXRA 3G49A 1JVSA 4HNVA 3TOZA 4NJMB 1CQIA 4YDRA 2B69A 3C7AA 5AXCA 2IZ1A 1EMDA 2GERA 3FWNA 1HLPA 1EVZA 1BXGA 1YH3A 1Y5MA 1RYEA 4DPKA 5T64A 1H2BA 5U9CA 3WYCA 4CMKA 2WE7A 4EW6A 1GR0A 1F8FA 1CRWG 1ARZA 3CIFA 4FFMA 1S6YA 1CQIB 3QVWA 5TJ9A 4E5YA 2BKAA 2C0CA 2Z02A 3KAKA 1BXGB 3RFVA 4WOJA 4JLWA 1VBHA 3GGPA 3O26A 3TDKA 4EUHA 5G4KB 2AW5A 2Q1UA 1EFKA 3GNQA 4PZDA 4L4RA 3GQVA 5JY6A 2RH8A 4E2WA 3JYLA 4XCVA 4HP8A 5K0ZA 1KJJA 3NYWA 3OP4A 1X15A 4X54A 4IINA 3DF7A 5LCXA 1XKQA 2PGLA 3ABIA 4XIYA 1E3SA 4Q9NA 4YJDA 1JLLA 2DIKA 3NAQA 4R69A 3GPDG 1MA0A 4R41A 2IYPA 1B8VA 2VOJA 5HTOA 5JC1A 4R68A 1QRRA 3LYLA 3U5TA 4KQXA 4Z9FA 4HUJA 4DWVA 4E13A 4EUEA 1E6WA 1HE5A 3PDUA 1JLLB 2GLTA 1X14A 3GMDA 3QVSA 3H2ZA 2ZB7A 3PHGA 3WGHA 4H7PA 1IULA 3ADPA 4RPJA 3WSVA 4I5FA 3PTZA 3IKTA 5BPFA 4WUVA 3DMTC 4IGEA 1WR2A 5HM8A 1MFPA 2JKVA 2GR9A 4O5OA 1QYVA 4UAGA 4E5NA 3OQ6A 5JLAA 2GRAA 3CH6A 4BV9A 1A9XA 2QRLA 3M1LA 4IHJF 3DHNA 2GN9A 3ONEA 3H5NA 4DL9A 1IZ9A 3NTOA 4F45A 1M76A 1P44A 2CZCA 3C3XA 1NFFA 4TQGA 4UEKA 4QSMA 3HB5X 1ZBQA 3WX0A 3OICA 4I1IA 2DPGA 3I4FA 1ZVMA 4K9DA 5DULA 4CMBA 4D79A 2GD1O 2ZTLA 3LK7A 1NXQA 4EGJA 4WLNA 1UP7A 3GVHA 1MC4A 3FBTA 3WQSB 1FDSA 2UDPA 2WJPA 2CDCA 5C8YF 4G81A 2C00A 1MGOA 2AEJA 3JQAD 5FWNA 4CLXA 3EDMA 1RPNA 2Y1CA 3BYZA 4BMVA 2QQ5A 1QYXA 4CM5A 4JGBA 3TFQA 3I12A 1OOEA 1T2EA 5DDIP 3UCXA 1E1LA 4XRRA 4DA9A 1P1IA 5CFZA 4PVDA 1TEHA 4EEXA 2W98A 3WWYA 2Y0CA 3D3WA 2JHGA 4Y6SA 2YRWA 3WGOA 4QSHA 4BNVA 2BELA 2PN1A 2DTDA 3RFTA 1RWBA 1NVTA 2FSVA 2GN6A 4QFCA 4TZTA 1MFZA 1YJQA 1YBAA 4DLKA 1UZMA 3D3WB 4BB6A 4ITUA 2EP7A 1N5DA 3G8CA 3OBBA 1PJ2A 1IY8A 3MJCA 4JROA 4YAGA 2W90A 4RVDA 3DC2A 1X1EA 4RVHA 3UFXA 4XRGA 1FDUA 1IB6A 3FI9A 4L4XA 2AXQA 4D7AA 1SMKA 3WSWA 1A7KA 1C1XA 3DZFA 1UP4A 4IDBA 2VPQA 1I33A 2QYSA 3E9MA 4TRMA 4WNIA 3DL2A 3RUDA 3UFXB 9LDBA 4ROSA 3GIDA 4GAEA 3S8MA 5AQ1A 1HZJA 3GLKA 2IEDA 2V5AA 4FN4A 2IXAA 4UVGA 3ZH2A 1C3OA 1C1XB 1MG5A 1N7HA 5A9SA 4TKLA 3JQ8A 3VKUA 5EMHA 2DLDA 4C5AA 2AQHA 3NEPX 1E3IA 2PBZA 1ULSA 2RHCA 1I3LA 3B6ZA 1MP0A 3VA7A 1H6CA 3H6KA 3MTGA 3JD1A 4KP7A 5A9SB 1LC0A 3SJUA 1QORA 1VL6A 2JAPA 5K9ZA 3JQ8B 3TF5A 4WGGA 5A03A 4CUKA 1E0DA 4GSLA 2GZ2A 3NGLA 3PQFA 2YZNA 2JFFA 3NTQA 1T2FA 3NJ8A 2FB9A 1ENPA 4ALIA 5IZ4A 5G0SA 1NTOA 4L9RA 3WDSA 3F4BA 3GR6A 3AUSA 1YJ8A 2X7HA 4B8ZA 4TRJA 4GH5A 2O3TA 2IDZA 2HO5A 3AWDA 3ULKA 1EDOA 4QXMA 1PSDA 4Z9XA 5LDHA 8ADHA 1OC4A 1EEHA 1ZSYA 2VRBA 4MA0A 1U8FO 2W6ZA 2W71A 1WAMA 3GA0A 3ZU2A 1HWYA 3HB4X 4BNMA 3WQRA 4O2BF 2Z1MA 4O7YA 2YYYA 5KJ6A 1MXFA 5EPOA 4D3DA 2VHYA 1H6BA 4AJIA 4DQUA 2NV6A 3L4SO 5JDCA 4IDAA 4BKOA 3B20A 4ONEA 5DNAA 3JRXA 1WDLA 5FF9A 4PLVA 3KVOA 2DFDA 1LBEA 4BNUA 3QWBA 3DONA 1JWAB 1ULUA 3OA2A 1ISFA 5JH7F 1J5PA 2I67A 4KZPA 3BIOA 1BVUA 5ITVA 4RLSA 1YKFA 4XWYA 2X23A 3KB6A 2B35A 4OIMA 5JO9A 2I9PA 4LMPA 2VRCA 3ZU5A 2PNFA 3RC9A 3W4JA 2OMEA 3BTOA 4XD2A 1TT5A 2EF1A 4WLVA 3VPSA 4PZEA 5F1KA 2VZ8A 3WMXA 5COQA 4XEHA 1YO6A 4JNKA 2XPCA 3GEMA 4URFA 2FY8A 5JXWA 1IYZA 1S7CA 3L77A 2LDXA 1TT5B 3PK0A 1YDEA 2DBQA 3LF1A 5CG2A 1I2ZA 2NM0A 3BMQA 4DPMA 4MP3A 4RZQA 4M9UA 4FC7A 1C0LA 2NTNA 2BRUA 2Q46A 2X6TA 1PJCA 2TMGA 3ICCA 3WBBA 4P38A 4YRDA 4BNXA 4OHUA 5LYJF 3DZIA 4IQGA 2WD8A 1GADO 3RFXA 3BMQB 4DQVA 4AG3A 4R9RA 1R0KA 5B4VA 1DLIA 4GX5A 3AFMA 4CMAA 1ZXBA 3S2FA 1QXSA 2LDBA 2RHRA 3RIHA 1VJ1A 4UUPA 3RBZA 4NG5A 4TRRA 3HFGA 4FFRA 3CKYA 1PS9A 5JE8A 2V6FA 4LRSB 4YJ3F 4BGUA 4W4TA 4BO9A 3SVTA 3H5RA 4WCFC 1UDBA 3VMMA 1WNTA 3NDIA 3Q1KA 5IDWA 3X2EA 2YS7A 1ZEJA 3KZVA 4ZQEA 1ZXLA 3RC7A 1A27A 3U0BA 4BO5A 5TLSA 5EERA 3DBVO 4PLGA 5B4UA 1EQUA 1E3EA 5LDGA 2PA3A 2X22A 2JJYA 1WW8A 1HF3A 4NMHA 3AI3A 5IN4A 2FPIA 3JQ6A 2VTDA 4H3VA 5CEFA 1MUUA 5I8ZA 5L9AA 2HQ1A 1OBDA 3GNTA 1XIVA 4R5MA 3K5HA 1GU7A 3LSYA 5THQA 1X0XA 3E5MA 4ESOA 2E82A 3KYDA 3U9TA 1VLLA 4XDZA 2AE2A 2NVBA 2FPIB 3F3SA 1ONNA 3JD2A 3O4RA 3WTBA 3FNEA 4ZRMA 1LQTA 1PJ3A 4WLUA 4WCDA 1FMCA 3FF4A 3T7CA 2HMSA 2V6BA 2EXXA 3WIEA 5L95A 2WMDA 3DB2A 4I4TF 2NWQA 2P4QA 3L6EA 3OF2A 4J4TA 4O59O 3VZQA 1T2DA 2Y66A 2ZB4A 3Q3CA 5TT0A 1I0ZA 5EQFA 3I52A 1LDBA 3ZWAA 1B8UA 5BQFA 4XJTA 1Y9EA 2AEFA 1PS8A 4MVJF 1XEAA 5L51A 5F1OA 2EW8A 4QECA 1E1MA 1NM5A 3K2BA 2BGMA 2FR8A 4IQ0A 4PG7A 2EKPA 1KVRA 2J9GA 4LMRA 4TKMA 3WXBA 3I9JA 1IOLA 1HXHA 1KVSA 4NBWA 1XELA 1XYGA 1YBVA 2ZJ1A 1HYEA 3EHEA 2Y67A 3RUHA 1OBGA 3GVCA 3H5AA 4EGFA 4JK3A 1ZSNA 1FF9A 4FC6A 2VWHA 4MO2A 1MG0A 1ZK2A 1DFIA 2H9IA 3W6ZA 1NFRA 1R16A 2H5LA 2B83A 2XOXA 2Q3EA 3QHAA 5ENDA 2C54A 3D5QA 1DRUA 3NV9A 4LVCA 3QW2A 4FOSA 1P1HA 4RL6A 3ZNQA 4YWJA 2B0JA 1IL0A 3MCVA 4JN6B 3LLSA 1PTJA 1YGYA 3EAGA 4BNJA 2BGLA 3OSUA 2EJWA 3MWEA 4A26A 3E9NA 5JCXA 3HBLA 2GPWA 1R12A 1B2LA 1RJWA 4KOAA 4HBGA 4I50F 3LT2A 2QZ9A 3CMCO 1N1EA 2O3UA 4CJXA 5JNLA 4BO6A 2AQIA 3AI1A 5KJFA 5FNVF 2WD7A 2GZ3A 4JIGA 3MWEB 4PRLA 3EC7A 3LU1A 3RUCA 3EMKA 1PL6A 4LVUA 1EVJA 3VZPA 4E0BA 4DTIA 2ZDQA 4FIZA 4Z3KA 3U62A 1PEDA 2WD7B 2IP4A 7MDHA 3IDSA 5FFFA 1M66A 3D4NA 4RDHA 3LWBA 3OIDA 4QEDA 3T4EA 1PWXA 3LP8A 3F9IA 4JQCA 3DR3A 4GGPA 4U8GA 4GWGA 1YQGA 5BR7A 3K2EA 2PD3A 2X5OA 1NWHA 3F1LA 3GDGA 4MPDA 3VPFA 5CDTA 5L7WA 4P4NA 3IJPA 2W6OA 3QVTA 1W0CA 3A9WA 2P68A 3INRA 1DC4A 3AX6A 4JXKA 3IL2A 1B3RA 1ONPA 2R82A 4D0SA 1KOLA 1QSGA 4RO0A 5CA0F 4Y67A 1DAPA 5ER6A 2CF6A 4E30A 3DBRA 3H9JA 3UOGA 3B70A 4MIEA 5IN5A 4B7CA 2F1KA 1JDBB 1PQWA 1YQDA 1DC6A 3ONDA 3JCZA 3TFOA 4Q3BA 3SC6A 3AU9A 4O1MA 2Z04A 3INTA 2I76A 4Y6PA 3M2TA 2I5PO 1R4NA 2XCLA 1ZJZA 3DBRB 3JZFA 1P1FA 2ZDGA 4CMGA 2F00A 4YT2A 3JQ9A 3RUPA 1FXSA 3LF2A 1P31A 4YAJA 1HDXA 3NRCA 4J43A 2Q2QA 4P22A 4GLOA 1R4NB 2B4TO 3BHMA 2R00C 4YAEA 3W8DA 4CR8A 3QWIA 4ZOLF 2B5VA 1PZEA 2CDAA 3N8DA 1KC7A 2VYND 2BFAA 3OUUA 4YAJB 3TIIA 2BFMA 1D3AA 4EYEA 1UDCA 3M2PA 4YBZA 3VDRA 1LDYA 3AOEA 3BTVA 3KAJA 4JX8A 4W99A 3RUAA 1VKNA 4GX2A 2PKQO 1YL7A 4A03A 3WO1A 3ICPA 3FSRA 1GPDG 5H83A 4I55F 4BOYA 4YBZB 1L1FA 1PJ4A 5COBA 2GGSA 1HDOA 2DUUA 3FNGA 3I3OA 2VHVA 4HNTA 1PR3A 4FFLA 5ILOA 3DHEA 4N54A 4ZRNA 3PGXA 2BGKA 4PLPA 3QWHA 5FI5A 3S55A 3C7DB 3WOHA 1U3TA 4F6LA 9LDTA 2G82A 1ENOA 1LSOA 2CUKA 3HDQA 1D7OA 4U6QA 4YXFA 3GN2A 1C30A 3QVXA 1GEEA 2DUWA 1N7GA 2CF5A 2JD1A 1HSZA 1C14A 1Z2NX 3BZUA 2AE1A 1VL8A 3EK2A 2ZK7A 4YTEA 4WLOA 1MV8A 3RSHA 4ZQFA 3V2UA 2PKQP 1ZK3A 3GMSA 3JQEA 5EINA 4YQZA 5LC1A 2FMUA 4FDAA 4BO8A 2FRDA 2C20A 3G17A 2YFHA 3TZHA 1QLHA 3V2HA 4ALNA 3JQFA 4OXYA 2Q2WA 3MOGA 3K3PA 4CQMD 2QRKA 2HK9A 1P3DA 2CFCA 3D0OA 2HSDA 5AOVA 4C7KA 5KVSA 1I7NA 4PLZA 3VKVA 1K5HA 4AVYA 3ZHZA 4BNWA 4CLEA 1DFGA 1TI7A 4CUZA 8LDHA 2NLOA 3PZRA 1TA4A 3BTUA 1TLTA 2I3GA 4YRBA 4I5DA 1Z74A 1RKXA 1UAYA 3R9RA 2GO1A 4EBFA 2PVPA 4TV8F 4ZHQF 1GQYA 1KETA 1ZFNA 1Y5RA 3JQBC 4MVJA 3HB9A 2CMDA 4W7IA 4E33A 4DIFA 3CPSA 1GY8A 3K96A 3CTMA 1QYDA 2EGGA 3ZNNA 3Q9UA 2DPHA 3PVZA 4CMHA 3KO8A 4CV0A 2EIHA 3IUPA 3GF4A 4TZKA 3OUZA 2OOSA 3QIVA 1U1IA 5C7IO 3VPXA 1AN9A 3KSUA 5D8DA 1H6DA 1CERA 1OBFO 1U5AA 2HMTA 4Q3NA 4ZN6A 3IUSA 4KWIA 1Y1PA 5JFOA 4NPCA 3GVPA 2CD9A 3N7UA 3W8EA 1JAYA 1YOVA 1V3VA 1JU9A 2NU8A 4B4WA 2I66A 1GZ6A 1GYRA 5TSDA 3VTZA 2GDZA 3VH3A 2GPSA 4BGVA 4P8RA 5DMXA 2J5QA 4XGKA 4J0FA 2E48A 4L74A 3UVEA 4KWHA 2NU8B 1YOVB 3WS7A 4RF3A 1GZ3A 4B3JA 3PRJA 3GN1A 3JRWA 2YHUA 1ID1A 4N5MA 2FR0A 3RV3A 2VR1A 4R1SA 1B8PA 4XB1A 1LXCA 4PLHA 3WWZA 3AM4A 2FWMX 3ZHXA 4YPOA 4CM4A 3JD3A 4J7XA 3ZWNA 5DCUA 3V1YA 4MV3A 1QP8A 3H9EO 1M0WA 3ZHYA 1WMBA 4PRKA 4MVJE 1U7TA 4WE3A 3RCBA 3OETA 3D4PA 1QYCA 4CM4B 4TVOA 4M87A 3DFUA 1LNQA 1C0KA 1NVMB 2GZ1A 3GC6A 2HRZA 3OA0A 4KTVE 3WLFA 5TT1A 4BQPA 4B3IA 4FFNA 3I4CA 2ZQYA 1C3VA 4MV8A 5JDCC 4LK3A 1N92A 4IBOA 2EW2A 4M86A 4A73A 1Y7TA 3GFGA 2FZWA 3OEYA 5CDYA 4IDGA 5EIOA 4AL4A 3KSDO 3VOTA 2PK3A 4JP3A 1U3VA 3L6OO 1SO8A 4O7LA 3OQBA 4AJ1A 4LGVA 3R3JA 1DV1A 2X4GA 1BG6A 2AG8A 4BO1A 1KIFA 1PQUA 4A2CA 1WZIA 3T4XA 4ALLA 5G4KA 1CJCA 4JP2A 3KBOA 4ZU3A 3HWRA 2A92A 2GPTA 5G4LA 3WO0A 5IZCA 5L7TA 4E32A 4AJJA 4RVSA 3HN7A 3OEWA 5IXSA 1XQ1A 1R0SA 2W2LA 4DLAA 5G0TA 4BUCA 5AYVA 2DT5A 3KYCA 2RIRA 1LLQA 1P77A 1JN0A 1XU7A 3KUXA 4U5QA 3IAHA 4O63O 4M8SA 1PGPA 3W4KA 3ZWXA 3VPCA 2WYOA 4NDNE 4BGEA 2EERA 3ROMA 3W8FA 4IGFA 3M6IA 3Q9NA 1ZKMA 1HRDA 4Y8VA 3TN7A 3GG9A 2QW8A 6ADHA 3KYCB 1JTVA 4QQRA 4FB5A 1O95A 2JAHA 2YQ4A 1CF2O 4O4LF 1F17A 2WYUA 3C1OA 3L4BA 4R3WA 1T24A 3ZCXA 4Y8VB 1UH5A 4PLCA 4E5MA 1ZIDA 2P2SA 3GH3A 4GSKA 4IMPA 2VHXA 2Y1GA 3ZZNA 4KUGA 3ZWYA 5EJ2A 3GZNA 4RPLA 1UUFA 1PGQA 1UZLA 1AE1A 3NT4A 1M6HA 3U54A 1KY5A 4NQZA 1J0XO 1K89A 4O7SA 3VZSA 2PZLA 3JD4A 3GZNB 4NBRA 2YYAA 4CLHA 3DMYA 1NFQA 3IQDB 4PN3A 3ORQA 2NSDA 3AY3A 4KUEA 4OO3A 4U0KA 1LRLA 3FCOA 4OL9A 4NFYA 3OMLA 4CQLB 2G17A 3ZWCA 5KJ1A 3PYXA 4DLBA 2YZ7A 1E7RA 2D5AA 2R7KA 2HMUA 4NJOA 5DCWA 3L9WA 5JW6A 2C59A 3GDOA 4ILKA 2Y0DA 1H5QA 4BKRA 3H4VA 1CWUA 5L4NA 4FGSA 2AG5A 2ZATA 1PZGA 3QJ5A 1GYQA 2GCGA 1B16A 2Z1NA 1N9GA 5C1PA 1GSHA 2C82A 2AQ8A 3HADA 4NK4A 3VH2A 4CLRA 4E6PA 1BXKA 3DTYA 1GGOA 2W6QA 2I99A 2VWGA 2O23A 3PLNA 4U6SA 3AFNA 1H6AA 4RF2A 4TV9F 1P45A 2X0RA 3CINA 3UHAA 1GV0A 1N9GB 3FBGA 2O50A 5FI3A 4Q3EA 3LC1O 1A72A 4CLRB 4QO7A 1E4EA 5T8KA 2OP1A 2X5JO 3W4IA 2Y68A 3PFWO 4O7ZA 1NPYA 2EKLA 4O83A 3BMOA 2C2XA 4GX0A 4QFDA 1Y8RA 1ENYA 2A9FA 2PKRA 5K6AC 3FTNA 3ZWOA 4YJHA 3KTDA 4HKTA 2YHIA 1Z2PX 2I6TA 1E4EB 1D1TA 4MDHA 1V0JA 2XXBA 3BMOB 3TZQA 1LDMA 5FYDA 1Y8RB 2O4UX 4YJHB 1ADBA 1JKIA 1GSAA 2OBNA 2PGJA 2YHIB 3ZI0A 4BGIA 1T36A 3OJ0A 1R6DA 2BF7A 2HU2A 1IUKA 3HZZA 1MC5A 3JQAA 4S1VA 2UUPA 1GFSA 1R66A 3BHIA 4ZVVA 1Q0QA 2YY7A 5CAEA 4J16A 3ZWVA 3K6JA 3NT2A 5L4LA 5TGDA 4OM8A 3JQAB 4O7RA 1GQQA 3ZNPA 1WLYA 2X8LA 4Z3DA 1GQ2A 4ZI7F 1N1GA 5EQDA 5CAEB 2UVDA 3BG5A 2HGSA 3H3FA 1W73A 2B37A 4MVJH 3F5SA 1GD1O 2J5KA 4YT8A 4C7JA 3Q2IA 4CMEA 1NHWA 3OECA 1OAAA 5A1TA 4MVJM 4Y9DA 4OXNA 5BNFA 2BD0A 4GVXA 1E7MA 3TIGA 2D3TA 3AOGA 3K92A 1QLJA 2DFVA 1RM4A 1ORRA 3L0DA 3U9LA 3ZV5A 5KKNB 1XGKA 1FDVA 1T1RA 2FZEA 2VZ9A 3NDJA 2VUUA 3SXPA 3KLMX 5FEUA 3P2OA 1DC3A 2W6PA 3CUKA 2IYOA 1PGOA 2UV8A 1Z82A 1JA9A 1WDMA 3RVDA 1SBYA 1X7HA 3JQ7A 3UXYA 1Z73A 1ZK4A 4MIOA 3GLQA 2I3AA 1K2WA 4WOKA 1OC2A 3IMFA 2HDHA 1KEVA 4ZD6A 3JQ7B 3OJLA 3EGOA 1T1SA 1YB5A 1OZAA 2JFGA 4P4LA 4Z6KA 2JCVA 4GKBA 1ML3A 3WMWA 5ICMA 2YV2A 1LQUA 3E5NA 1B0AA 3ITDA 3ONFA 4BL5A 3R6DA 1M0TA 3CEAA 2VHZA 3I9KA 4QX6A 1EE9A 4UUNA 2IODA 3H9UA 2B5WA 4Z9YA 3DZKA 4C5BA 4J0EA 3GRKA 3JQ9C 4E5KA 1DBVO 1Z7EA 3E5RA 2G1UA 5L53A 4BNHA 1DIGA 1CQJA 1I5RA 1SEVA 2DM6A 1H9AA 3MTJA 1PU2A 5B1YA 2P9GA 1P1KA 5DOZA 5TQVA 4IS3A 5ES3A 4DYVA 1E6UA 1JWBB 1I30A 2YWVA 3JQDA 3KLPX 3GZ4A 1IHXA 4XA8A 3Q6IA 4YYZA 2G0TA 4PG6A 1CQJB 1XR3A 3WYEA 5JDIA 2WM3A 3LC2O 5JC8A 3DXFA 5GMOA 1E7YA 3NUAA 3GOHA 2XD4A 3FRJA 1E77A 1PJTA 5I7VA 5JYDA 4A0SA 5IXYA 4MV9A 4A27A 3DOOA 3UCEA 1K6JA 3RU9A 2YFQA 5JO0A 1IHYA 2PGDA 1U2GA 3AK4A 4FD3A 3H3JA 5KIAA 2Y1DA 4FW8A 5TIIA 4J9VA 4J1NA 5L7YA 1GPJA 5CPBA 1TT7A 1JDJA 5TS3A 3VDQA 3D5TA 3PI7A 4O4IF 4D41A 4DXHA 4NFSA 3ZU3A 2RBEA 4IXWA 2P5YA 3E82A 3VC7A 1OMOA 1ADCA 1XU9A 1SOWA 3HNPA 2A4KA 1Y6JA 4OKNA 4W9NA 1KVQA 2OZPA 4KUHA 1BGVA 3C24A 1B15A 2OGUA 3G1TA 3GEDA 2EEZA 2YDXA 2GQSA 2Z95A 1EHIA 2CZGA 1GUFA 2QIOA 2VNSA 3PHIA 4D43A 3JQFC 3R1IA 2PD6A 5ILGA 1PJSA 5TX7A 4NYEA 5CPFA 5CDUA 5H82A 1ISMA 1SPXA 2VNAA 3I9MA 3BA1A 3JYQA 2I80A 4XKJA 3R5XA 4EUFA 3D3EA 7ADHA 1A48A 1E5LA 2H1SA 4B4UA 1LJ8A 1HKUA 3IJRA 3D7LA 5JY1A 2HMWA 3KETA 1JQBA 3TINA 3OJOA 2PZMA 3SX2A 1CYDA 1K6IA 2D1YA 1U28A 2IZ0A 2GN8A 3HDHA 5HS4A 3NT5A 1CS0A 2D0IA 3HDYA 2EP5A 1B6RA 2NACA 4WLEA 3SE7A 4BMSA 4EG0A 1BVRA 1C1DA 5J23A 2NTVA 4YT4A 4O81A 1NYTA 3AW9A 4IZHA 2NVWA 3ZHBA 3WNVA 3I23A 3PFFA 4RF4A 5C7OO 2ZB3A 5JBIA 4MV6A 4S3MA 1D4FA 1C1DB 4FJ0A 1LRJA 2POQX 4OOFA 4DUPA 1UJMA 3UAGA 3UICA 4GL4A 3U49A 4GVLA 1VKZA 4RQTA 3WB9A 5I7SA 3B1FA 5A3VA 3TSCA 2C2YA 1HYGA 2OLSA 1BHSA 2OHXA 3U9SA 1WMAA 2YDYA 4Z0HO 4BO7A 3VPBA 2PWZA 1HE3A 4BKPA 4EJ0A 1D8AA 3K5IA 3EW7A 4EZBA 1BDBA 2CVZA 1G1AA 3A14A 1NP3A 2X58A 3S2IA 3EUWA 4J49A 4R1NA 1KBLA 1R15A 4DQXA 3AJRA 3ZGYA 5I7EA 4FFOA 2FR1A 4TMFA 4RV9A 4O4HF 5KX5F 1CIVA 3KEOA 3MJFA 4U7WA 1YL6A 5BPHA 1AHHA 3FPLA 4TSKA 1HDRA 4XYBA 1A71A 2ZCVA 3MJEA 1LTHR 3QY9A 1E3JA 4N18A 3GVIA 2R2GA 3GAFA 2OFPA 3KSZO 4INAA 1YWGO 2D4AA 2IZZA 5BMVF 4M54A 2IXBA 4AJPA 3KM0A 3ZN2A 1ISIA 4IQ8A 4HX5A 1Z6ZA 1GUYA 4BNKA 4GBJA 1XQ6A 4NHEA 4GKVA 5CEEA 1UXHA 1VSUA 2J3HA 2NU9A 3ADOA 5DBIA 1VRWA 1HZZA 2BHLA 2VHWA 2Z5LA 1PJBA 2FOIA 3JQCA 1WZEA 1SOVA 5ADHA 4XIJA 2PY6A 5T5QA 4XYLA 2NU9B 4IUYA 5CP8A 1YXMA 2TMDA 4AFNA 2YL2A 1LSUA 2VTEA 4BO2A 4O7VA 4UEOA 1JAXA 4XZ3A 3E1KA 1EBUA 1UAGA 4FBGA 4K6FA 4JCOA 2XAAA 4MINA 4XYLB 4IMRA 4MJLA 1I36A 3RJ5A 4BO0A 3QA9A 4J9UE 4MVJG 2GLXA 4AJ2A 1DIBA 4IDCA 3FR8A 3VOSA 1DHRA 4L76A 2D59A 1VJTA 1NASA 4XZ3B 1VSVA 4DIMA 2ZTUA 3GAZA 1A9YA 4CM9A 2PD4A 4IZOA 1PJLA 2G76A 4IDFA 1UR5A 3GHYA 3V4ZA 1UXIA 1VJ0A 1Y8QA 4HADA 4DGSA 5IYZF 3WIDA 4JJFA 4N5LA 3FN4A 4ND4A 4OH1A 3EZLA 1B6SA 1U4OA 5B37A 1XLTA 3S2EA 1Q1NA 1UXKA 2YRXA 2VYVA 1DJNA 4NI5A 4OQYA 3L4BC 4XYEA 1Y8QB 4FJ1A 1V9LA 3QE3A 4FR5A 4MIYA 4UUOA 4R54A 4XR9A 4PZCA 4YJGA 2VN8A 4OXKA 1B26A 4EJ6A 5A9RA 4CMJA 1ZW1A 1HEUA 1XHLA 3H9QA 2O48X 2YJZA 3QFFA 4W82A 2J8ZA 4R5HA 4EJMA 4YJGB 3AI2A 1JKJA 2XF8A 1LEHA 4AJOA 1E1NA 4MV4A 2HK7A 2R7LA 3JTMA 4WKGA 4IDDA 4DMLA 2PZKA 3ASVA 3GUCA 3QWFA 5AVOA 4BMNA 1GDHA 3D64A 1AXEA 1JW9B 2V65A 1AHIA 2GASA 2O2YA 3D4OA 4G2NA 3DAGA 4RPGA 3JQGA 1JKJB 3KEQA 5A04A 4WNCA 4NU5A 4BVAA 1LLUA 1PIWA 4F6CA 3DEYX 1LLDA 2QX7A 4DBZA 1EDZA 3PEFA 1CEQA 5IJZA 1O8CA 1VI2A 1AGNA 2FHSA 2DU8A 1W93A 3JQGB 5I7FA 3DWFA 2C29D 1I2BA 4I9NA 3W1VA 4XYGA 1N2SA 4L0QA 4ZGWA 3ORRA 2VUSA 3V4SA 2CDBA 2DZDA 1X1TA 3RBVA 3L07A 1HETA 5KKAA 4O7TA 1AXGA 4YJ2F 2AEMA 2Y1OA 4IJVA 3WYBA 3BHJA 3WLEA 2NU6A 3RU7A 1EK6A 4MKZA 1E7QA 1I3KA 3DZBA 2VQ3A 4R9SA 1P1JA 3JYPA 4YA6A 5KVCA 3M1AA 2NVUA 1KY4A 3VVBA 2NU6B 3G0OA 4N7RA 2B36A 3WJAA 1KEEA 4JBGA 3DAFA 1E92A 3INGA 3JD0A 4LSWA 1O94A 3RV4A 1PL8A 4BNTA 3ETEA 3FPCA 3SLGA 1ISGA 1LLCA 1OFGA 1PR9A 3O38A 4FGWA 2NVUB 3SJ7A 1KJ8A 1KC3A 2X9VA 2Y05A 2PV7A 3ETGA 1IOVA 1WVGA 2OO5A 1ISHA 4D0RA 4YT5A 4IY1A 5EL0A 3PHLA 2X0IA 5JCJA 1F0YA 4Q3DA 3RASA 5CEJA 1P1RA 3LT4A 1YB4A 4XB2A 5F1PA 5EESA 1RYDA 3C1AA 4J3FA 3BMCA 2W8ZA 5IDXA 4E5PA 5TC4A 4KQWA 2E6UX 5F5LA 2GSDA 1GAEO 2ZTMA 1PQPA 4MP6A 1I2CA 1NPDA 4DMMA 2E4AA 4HR7A 1D1SA 2EKQA 2I65A 1DHTA 3BMCB 2DAPA 5KJEA 4CQMA 5G0VA 4E4YA 3OIFA 4F3YA 1Z7BA 4J91A 4BQRA 4I08A 3VAZA 5CA1F 1NNUA 2X0JA 1T2AA 4PVCA 4PG4A 3WGYA 5KWEA 2R85A 4LCJA 4II2A 4AJKA 1GEGA 5CG1A 4CQMB 2ZDHA 4XQEA 2G5CA 5GZ1A 5DN9A 1KYQA 3I83A 4J90A 4OGWA 2J3KA 3GDFA 3AUTA 2FP4A 2PLAA 1PX0A 2GQRA 1YB1A 2DVMA 2DKNA 4II3A 4Z0TA 1XSEA 5JMPA 1DJQA 3HG7A 4O2AF 4G5HA 4HV4A 3K9QO 1VPDA 3RC1A 1DC5A 1JKFA 2YZLA 4MV1A 2JD0A 2C5EA 1DSSG 3MWDA 4C4OA 5C37A 5CDGA 2Q49A 3PJDA 2FP4B 2FPGA 2IEBA 2X1HA 4BNZA 3K8ZA 3R5FA 1RM0A 3KREA 2JCYA 1CE8A 5DBFA 1O5IA 4BNFA 4RZHA 3MWDB 3IP1A 3KYBA 2D8AA 2H6EA 2FPGB 1LA2A 1SZJG 3FR7A 4GQAA 4IXTA 5C7LO 1X0VA 2J6IA 1QV7A 5JPIA 4D42A 4E2YA 3CZRA 3UUWA 4WEQA 1RM5A 2ZJ0A 4IZIA 1U3UA 2FSSA 1Q2XA 5A5FA 3ZW9A 3KRTA 1HYHA 3ZWMA 1CDOA 3GRPA 2E49A 2W2LD 1JVBA 2J3JA 3N6RA 3JYOA 4J1TA 4UVEA 1FJHA 3WNQA 1K0UA 2HJWA 1GTMA 1E7SA 2R7NA 5BSEA 3NJ4A 1Z75A 2I87A 1SB9A 3MOIA 3V8BA 5KCZA 1F14A 2YUTA 2B4QA 3OQ1A 4RLHA 3PYLA 2NQTA 2PH3A 3E8XA 4YRAA 4RJTA 4CV1A 1V3TA 3CZMA 3GUYA 4BO3A 2NNLD 1GCUA 3VHRA 4RVFA 4XQGA 2WYVA 1LSJA 1G0NA 4LRTB 4OKIA 3TZKA 3U3XA 3GVXA 1XA0A 2IRWA 4D3SA 3U09A 5DP1A 3ROQA 3PP8A 2VOEA 2C7GA 2DBZA 2BFOA 2ET6A 2Q1TA 3PWSA 1X7DA 1XCBA 3HHPA 3ETHA 5A9TA 3UF0A 3JZIA 4W7HA 3VPHA 3KHUA 3ORFA 3WG9A 4MV7A 1EK5A 3COSA 3QV1A 4HNUA 5JQGF 5ENVA 4CMIA 5L45A 3G8DA 2GF2A 3NX4A 2NQ8A 4PG8A 3R5HA 1B7GO 2JCXA 3QWAA 1W4ZA 3R3SA 4RVUA 4CLDA 4E12A 1AUPA 2W6NA 5IG2A 1F06A 4FPXA 2X9GA 4W9NC 2A35A 4D44A 3MJTA 2WYWA 2BI7A 4CMIB 5JMWA 3H8VA 5LA6F 4R01A 1HE2A 4K1LA 1LSSA 2B4RO 4CQLA 1ZMOA 5LP6F 3DTTA 3GNSA 1XWFA 3UGKA 4ZICA 1F12A 3F1KA 4O82A 3RD5A 3BXXA 3ZV3A 2UUOA 3FNFA 4CL3A 4J4BA 3GG2A 3I9LA 3OJEA 1XG5A 1T2CA 3ON5A 3RUFA 2YV1A 4O7WA 1R4MA 1ISJA 2Q50A 3MJSA 3P2YA 1K6XA 2DTEA 4J1SA 3PJEA 1V6AA 2R00A 3UH1A 2Q4BA 1UXGA 5COAA 1M75A 5IDYA 3RUIA 3G1UA 1R4MB 2R87A 1WXDA 2Y1EA 5IFLA 1P0FA 4NIMA 4I5GA 1HDZA 1Q7BA 3GT0A 3PXXA 4P4GA 1G6KA 1I3NA 3ITKA 3F46A 3E48A 3SEFA 3LDHA 4GX1A 3IC5A 3Q2KA 4RDIA 1A4IA 2WDZA 1X7GA 2GYYA 1V8BA 2HJRA 3DQPA 3PJFA 3DAPA 5KVQA 5BSFA 4HXYA 3A1NA 3LT1A 4EITA 2X0SA 1SNYA 1E1KA 4EEZA 5L40A 4WLFA 1GZ4A 1DV2A 3FTPA 4ALJA 4QUKA 1YDWA 5F5NA 4HY3A 3IP3A 3PWKA 4R1UA 3DZHA 1ZO8A 1WWKA 2HK8A 3I9NA 2ZYDA 5GONF 1ZEMA 3R23A 5JYEA 4CR6A 5T57A 2H63A 3ZWBA 4H15A 3ENNA 4K6CA 4PLYA 4J1QA 2P5UA 4G65A 4AICA 2CSUA 4J4HA 4HFMA 1FDWA 5GZ3A 5KOIA 5THKA 1VM6A 5ITWA 1ZZEA 4MA5A 4DC1A 1DIRA 4YJFA 1EZ4A 5I8WA 2RCYA 5KKCA 2PR2A 4D3FA 4IIUA 2BH9A 1QKIA 1TB4A 4ZQBA 1ULZA 1YL5A 4N5NA 3RJ9A 1Y9AA 1ZUD1 2YS6A 4EGQA 4PGFA 2PTGA 3TL3A 4WJZA 2GNAA 4C5CA 3AY6A 4B79A 4UREA 3RFCA 3TWOA 4UVDA 2OUIA 4YJFB 1U9JA 2P0AA 3RBXA 4B4OA 1W6UA 2R86A 2CVOA 5J2TF 5TNXA 2X0NA 1Y81A 2OP0A 3RI3A 4GWKA 4OOEA 2EV9A 2J5RA 5AXBA 4L1KA 2O3SA 2NU7A 1KS9A 1SAYA 2CVQA 1HSOA 4MKRA 3KALA 2Q4EA 4DVJA 4L4SA 1K3TA 5JAIA 1EQ2A 4R4JA 1HDGO 2ZTVA 1E6EA 1ZSVA 1ZJYA 3FHLA 4IIVA 4BNNA 2YV3A 5I9NA 2NU7B 3JQBA 4OYRA 5F3RA 1GV1A 4KMSA 3EZYA 3PJGA 2R6JA 2O2SA 4TWRA 4CMCA 3MZ0A 4J2OA 5LXTF 1N8KA 3EVNA 3AU8A 3NUGA 2YZGA 1A7AA 2GN4A 4PLWA 1HLDA 1I32A 1KEWA 1PJQA 3P5SA 5JVDF 2VT2A 3ANLA 1E3LA 1U8XX 4BNLA 5A5EA 3HFSA 2I8CA 1PZHA 1UZNA 4KDFA 2Y99A 4L75A 4MKXA 3DZJA 4IPTA 4QO8A 4U0JA 4WECA 5A3JA 4GPD1 3HO8A 2HKIA 1X13A 3LLVA 4PIVA 2VWQA 5TRTA 3U4HA 3D1LA 2WEKA 4O4JF 3HDJA 4OSOA 4RPHA 4Y6RA 3A06A 3UW3A 3E6AA 1IOWA 2ZYAA 1DO8A 2NUAA 1GCOA 1YE3A 1EZ1A 1O0SA 4NNJA 1DIHA 3N58A 4DRYA 3DO5A 4RPKA 5HWSA 1BSVA 1ZH8A 1Q7GA 3E03A
chains in the Genus database with same CATH superfamily
1ZLXA 2VSQA 1LC3A 3BSWA 3SOZA 3R9WA 2DPMA 1J21A 5LZ9A 5KOYA 3G2IA 1S02A 1PG2A 1T4BA 2Y8EA 5DNUA 1H85A 3S29A 1IBRA 4UEJA 1KJQA 4GLXA 1DWPA 4YQYA 3UYYA 3TDMA 4LF4B 5DE3A 2Z83A 4OXQA 3FSEA 2JAOA 4IUCS 1Y3IA 3A4VA 4F3KA 3EF1A 5JU6A 4ZTZB 1FTSA 2OHFA 2FSHA 1DB3A 1XK5A 3NM4A 3DZCA 4YCJA 1WP4A 3AHCA 4URUR 1FP4A 1JHAA 3G1UA 1O89A 3QVVA 4X24A 5D5QA 3WFJA 1FX0A 3WGHA 4CLOA 4UAJA 4C2UA 5BNTA 1EKPA 3HYCA 1AU9A 1OREA 1P1CA 2Q6TA 3MB5A 3JW8A 4HL6A 4PX5A 4E1AA 1JI0A 4BO4A 2Z57A 1Z25A 1VKJA 2I7CA 3H1TA 4KXWA 3NHJA 1U1EA 3AOEC 1VBFA 4QGSA 4CKYA 2QRPA 3DTVA 1NDQA 1UOOA 4GOMD 3TQHA 5K0CA 2AXPA 1J49A 3ND5A 2EGUA 4ACBA 2GZMA 3PIDA 1WPQA 3IKVA 4EHKA 3BA6A 2YIVX 3DH0A 1PYDA 3AZQA 3DTNA 3K0AB 3VOBA 5JQGB 3LWZA 1O96B 3H1GA 4MJXA 2H85A 5LA6A 5JAOA 1JMVA 3MWGA 1AY0A 4ER5A 3COJA 4P5DA 1EFLA 4OMUA 1JXOA 5EXEA 4UE6A 3QBJA 2YCBA 4KR7A 2YUIA 3L0CA 2BFWA 4PBCA 4XD7D 2VTVA 3HCWA 2HR1A 4Q82A 4INOA 4Y98A 1IPEA 2XT6A 4UXHA 1AV7A 2GJSA 3PHJA 3C6ZA 2ISQA 5GOZA 2C1EA 3VNSA 4TZ6A 5DXFA 4TLCA 4MB2A 1BQEA 3BAZA 1NJ2A 2VAMA 4C03A 1JPJA 3W5IA 1OROA 1MC1A 2PZBA 4KTTE 3LYUA 1CJTC 2OORA 1PNTA 5LIPA 4FWIB 3AERA 1W0KD 2Z98A 1YONA 4LSGA 4B34A 4DJFC 2WSLA 3A1EA 1YK1A 4FHZA 4XYMA 4Q4DA 3OCYA 1DPGA 4MYCA 2M9MA 4UUAA 4XLLA 1MB4A 1W36B 1MXHA 3OZEA 3HJGA 4HQ6A 3CLRC 5B12A 3GJYA 3OQIA 3SE0A 1WX1A 4FQ5A 2JK0A 2HHFB 2NOAA 2HMAA 3KV3O 3PDJA 4OHZA 3FI0A 4CTNA 2J4FA 1XLWA 1UBLS 2HLPA 3N70A 1QF9A 2ZIZA 4I1PA 5K4GA 4IJWA 4LPKA 2C31A 2D5IA 2B78A 4QRHA 1X86B 3DFIA 3PEEA 1L5LA 1T5BA 1GNVA 2FRXA 4S2EA 1R8QA 4DAEA 3RK1A 3V2GA 2BDTA 2C4HA 3ZK7A 1P0QA 2XT9A 2IX3A 1PFYA 4FX5A 1U0BB 1JTFA 3K4QA 3C7CB 4BJ6A 3C14C 1XJ5A 2Q28A 3HKCA 1USVA 3PGJA 4LSZA 3REQB 3LBHA 1ZMTA 1D2HA 3H4MA 4COOA 4PXSA 2WJ3A 3PQ4A 4QGAA 2F8SA 3IPRA 1FFXA 4GMHA 1T3ZA 3K73O 2QY9A 4TRNA 1KEPA 1E4VA 3ROFA 1K5PA 2DR2A 1JNYA 1RXCA 1LI4A 1ELOA 4FOOA 1QM5A 2SICE 4IOLA 3NM6B 3C1UA 4TN5A 5EFOA 4CL8A 4HDNB 3WLRA 5AJVB 4L8FA 3QPCA 2HADA 4YB8B 3MQ4A 4B4OA 4BX0A 4C7MA 2W2KB 4M55A 3CSDA 5DLDA 1E3QA 3BIFA 1JEEA 3FSJX 4OB6A 4ZT5A 2MR6A 2PX4A 4CM3A 5FRDA 5BQPA 2X86A 3KYDB 2QTMA 3HJTA 4LQCA 4ND1A 1B14A 1CTQA 2GK3A 1GNPA 2VXBA 4A0HA 3NBZC 4ZIRA 5I7WA 2PQ0A 3EXHB 3GLGE 4BS9A 1I24A 2R8BA 2LRHA 4JSTA 3LXMA 5EE3A 4MWDA 3IOYA 4CMDA 3C1TA 1S2OA 3FHCB 4LY0A 1DG3A 3IXQA 1YBHA 4FZ5A 4Y9TA 4PO9A 2WJWA 1Z4IA 1T5OA 2NADA 4L8YA 4Q9IA 1DPFA 5E6RA 5LBUA 1G4HA 2OFFA 4BN0A 2ACEA 2OWEA 2C9CA 4F46A 3GROA 2VK8A 3EPLA 3OZGA 1CUAA 4CIDA 1IDN1 3KXPA 5DASA 2ODNA 1KYWA 1NIPA 2II6A 1FMTA 3CLKA 3VAAA 4GDFA 2XLCA 4ZQGA 1BMQA 4QOSA 2C57A 4BX3A 5HJ5A 3O8QB 1NAIA 3DDNA 4YDSA 2D7CA 3E18A 2EGHA 3LKBA 3GFSA 3JALB 3MINB 4KNVA 4NG4A 4MEAA 3ZWKA 2XYGA 1YRBA 4FGJA 5BXQC 2AVDA 4LN1A 4YAIA 4HDSA 3W5SA 4ZJUA 1B3BA 3TW6A 5SZKB 3C0KA 4BRZA 4YCAA 1QV6A 3VTFA 1NI3A 3BL8A 4HQRA 1MIOB 3B1KA 1KMNA 1P73A 3GEGA 4YLYA 4HWOA 1VBGA 2F43B 3JX9A 2B98A 1XTQA 2FYTA 2UYGA 2PMBA 3ESAA 4HNSA 4L0DA 3TPCA 2QU8A 5KTTA 1HA3A 5BT9A 5LPNA 3P2KA 4UBMA 4E21A 4TVBA 3JARA 3I0ZA 2GHRA 3QXCA 1JG2A 4KEAA 3ROPA 2VP9A 4IGKA 3RRJA 1Q1EA 3HR4A 2SCUB 4PCUA 4RQUA 2OBYA 3C6KA 3DSRA 2X1VA 1D0VA 4O4JB 2NO1A 3B36A 3F5MA 5TMEA 2BGRA 2LVBA 5GJCA 5IZCC 3PC2A 1Q5PA 3CONA 1VMEA 4AJLA 5H80A 4HH3C 4OD0A 3DEZA 5DT9A 4FSHA 2VQDA 5I5XA 1M74A 3LDUA 4MS1A 3RAGA 3WFIA 5KMGB 3HO1A 1SCUA 2IHYA 1PR2A 1XMVA 1EAMA 2VYVD 4R6WA 4YRRA 4KVZA 2G8NA 2J3MA 4C21A 1EVYA 2EFJA 5EGNA 4R1TA 5HSGA 4HDMA 3CE6A 5EIWA 3DBLA 1FFEA 4ZVOA 3TY8A 5FORA 3PUYA 4N3NA 4IS2A 2I22A 3C6MA 2HTEA 2GPNA 1RXEA 1K6MA 1TGYA 4OSPA 4MI3A 4ZO7A 3AV3A 3BXOA 4JMLA 1YHYA 1H3NA 1N9KA 3SEAA 4YQEA 2KBEA 4XGIA 3WMGA 4BFCA 5BWNA 2BBOA 2IYRA 1KQGA 2XODA 3Q3VA 2HT1A 3NV7A 2YBEA 5KVVA 4FMCF 4KAAA 4PTLA 1O6CA 2GCEA 3TB4A 2BSQA 2VPWA 5K01A 1A8UA 3MRXA 4JT4A 3CLTD 2QVXX 2YZMA 1RCTE 2RHLA 4N3BA 2C07A 3NKLA 4HDKA 2RH4A 3R9XB 4Q6WA 2X1MA 1YZYA 4AY5A 4MW6A 2V9PA 1X1DA 4HEJA 1HL3A 1JDUA 1SOUA 5H81A 2O7VA 5IAKA 2BFPA 2YR0A 4LKRA 2GN2A 1ANKA 1ULHA 2W0MA 1A5ZA 4RZIA 2XWPA 2AFRA 2FZLA 2VJQA 4RFSA 4KBYA 1ZN9A 2WU4A 5CVJA 4RSHA 4R7GA 1W35A 2V6GA 3W1GA 2R6DA 1S5PA 4M46A 2O3RA 1K86A 4UAVA 4R51A 1YJCA 4JC4A 4IQ4A 4I9HA 5LLSA 4DDWA 3W7AA 2VP4A 1S8AA 5C51B 4I8DA 3TKLA 3AESA 3T3EA 2YZ2A 3EVTA 5H4HA 1OLSB 3VR5A 1X9HA 4EATA 1CETA 2FPPA 1KMIY 3B1JA 5JRDS 1UJ6A 4H1TA 4L85A 5AVXA 1EXNA 4K9QA 1UXJA 2XDQA 5JAQA 2O4CA 1Z5GA 1ZN7A 3K5PA 3R5KA 3L49A 4MGHA 4MVXA 4RXMA 1YS4A 3MQFA 1N8TA 3ZNOA 3WGZA 5AVYA 5TB5A 5CXUA 1TVCA 1IATA 1ZRNA 1NR5A 1KVTA 4IDPA 5JZ9A 1ZCJA 3NWBA 3MOSA 4P7GA 4B17A 3ZY4A 2ILTA 1R18A 3EOBI 4OMFG 2I6FA 3QKUA 3G9UA 4IDEA 3WNDA 5JECA 1X8JA 3FMOB 1VI5A 1TXGA 2MSLA 3P1JA 5DZSA 4HJRA 3Q11A 3THYB 1NVEA 3V9AA 1U0EA 3SHQA 4X1IB 3NGMA 3U7QA 5A02A 1T9GR 1OYVA 2CWWA 1ORDA 2Y93A 3AM5A 3AZOA 4MVJP 4O0LA 3UMCA 3MF4A 5H59A 1XPRA 3CEPB 1LPAB 1GLVA 4MS4A 4F91B 3BMNB 2PVCA 3FYTA 3WFZA 1MAHA 2YVQA 4ND6A 1U1CA 4F84A 3PTAA 3AUFA 2MOKA 1I2MA 5DP2A 1CY1A 1C30B 3O9ZA 3PLRA 3RUEA 3HK2A 3LGSA 3Q0IA 3TEMA 3PHHA 4JNCA 4TM8A 4P7BA 3FD8A 1BS2A 2IZ5A 1LWOA 1I01A 3OCWA 1VGVA 4PPGA 3KQVA 3UK2A 3VR1A 3WQQA 3N5CA 1DRWA 4O84A 1XTJA 2G0NA 3DEAA 2ZUDA 3QQPA 1M6YA 1S2GA 5A0FA 1FXUA 1P3Y1 3L43A 1EUZA 4M0KA 4E5SA 1G3RA 3F4LA 1ZPDA 1R10A 2WRZA 4DSAA 2P6PA 2ODTX 1I8TA 4IH9A 3UHFA 3LX6A 1KP2A 2I2XB 1JE0A 2O05A 1R1DA 1MIHA 4WXEA 4RTJA 2BJVA 3CLSC 4HZUA 4L9AA 1EP2B 1C7IA 1UBSB 1T3SA 4M1QA 1TMOA 3R76A 3ADKA 4FYHA 1A7UA 1C81A 4I0WB 3UXEA 4R71A 4G26A 7GPBA 2MJLA 2BSXA 4H27A 4Z4GA 3NJRA 4E5UA 5J2UB 1FZQA 3CGGA 2JA2A 3HDGA 3TZCA 3U3KA 3MS7A 3TW4A 3WBFA 2C5LA 2BDEA 4CMEC 1H94A 5KNDH 4HYYA 4S0ZA 1BE0A 3MJ4A 1JSXA 1PX2A 2PFSA 1E2IA 1ECLA 1M0SA 3UAZA 3VPDA 2C8LA 4MP8A 3AL0C 3KQMA 3BM5A 3UPDA 4CM8A 3CZQA 3Q2OA 3FRHA 4I5EA 1G21E 1ZI8A 2C5SA 4L95C 5TQ0B 3BZBA 5GIOE 1FQJA 4Y0VA 3K31A 1FEZA 1BC5A 5DCYA 3F78A 3LT0A 3DFMA 2BFCA 4JBHA 3OPNA 4FT4A 2BMJA 1K3UB 4G37A 3W6UA 3WB1A 2WICA 2FFHA 3G9XA 2FMIA 3M9WA 1OZHA 3H4TA 4HQ0A 1WTAA 2PZJA 1YU6A 4URVR 1ZA1A 4R0VA 5IWCA 1J1IA 2AOWA 4Z4FA 1KKUA 2QZZA 5FJIA 1WV1A 3U4CA 1AZTA 2VLBA 1NNLA 2EVWX 4YMLA 1P0MA 1ZUWA 2XMDA 4ENTA 4B82A 2LP4Y 1AIPA 4N12A 4WK6A 5HIMA 4CPDA 1F2DA 1CQZA 3UQYS 2DQ4A 2BLLA 3K2IA 3KKNA 1PI3A 3PQDA 3PWZA 3BFVA 4DLLA 3KCQA 2ZEJA 1LDEA 3HY4A 4JBIA 4YHBA 4YRPA 3VR4H 1JFSA 2PH5A 1S2LA 4Y2VA 3HVKA 4GPBA 3RYHA 4DV6B 4PFJA 2F3QA 4OA8A 1LPPA 3OCVA 4G0MA 4KDRA 4YMIA 5LQSA 4NE2A 1JBKA 1OHHD 1YRWA 3AY7A 4I7EA 4Q6BA 2GB4A 2CLHB 2UYQA 4KXQA 2XY4A 2OXIA 2HD4A 2CL6X 2R84A 4L8VA 2A1IA 4G6ZA 1T2NA 4MZDA 5DXAA 3ZUPA 5A4DA 2YXDA 4J6FA 3QVKA 2ZCUA 4F1WA 1BW9A 5C18A 3FPEA 3FAKA 5IPFA 2X2OA 3PGMA 2CNDA 2I4MA 4H7IA 4AQ7A 2JGMA 4M49A 3IVAA 4DG9A 3U55A 1J0EA 3CISA 2ZE5A 1WNFA 2ZYWX 3ML1A 3CRW1 1LVHA 3PITA 4QNNA 4LCEA 2FN4A 1L7EA 2CNBA 3AM3A 2ZT6A 3LGAA 5ALIA 5DIFA 3MIZA 1CUHA 1YUMA 3EYAA 3NHFA 3F5QA 4FS3A 3EDQA 4W5NA 3NBUA 5JDIC 1KP9A 2C7PA 3EZGA 2IUUA 5B7PA 4BHTA 3TG8A 1QHIA 2CV2A 2V6JA 5CB4F 1M2WA 2GSWA 2VFAA 3WGGA 3CXRA 2W6JD 1JVSA 4HNVA 4NCKA 1CQIA 4YDRA 2B69A 1UKZA 5AXCA 5B58T 2PXXA 2A5JA 2PJUA 1HLPA 1BXGA 3EVEA 3GGDA 1T5DX 5DWDA 1Y5MA 2PKYX 4WT7A 3IA2A 4GPIB 4L6AA 4ZT4A 3L46A 4LFBB 1CKEA 4JLAA 3KSRA 5HE9A 3WYCA 4WKBA 3E0QA 2AJCA 1ZL2A 1NSFA 1CQPA 1DCFA 1CXZA 3DUWA 4JA0A 2BKAA 4LI3X 4JASB 2QN9A 5I7HA 3OY7A 4FDUA 1U9ZA 4GZLA 3R40A 1RAIA 1U2RA 3DP9A 4MAAA 2QTVB 1T0UA 1W5EA 5G4KB 1VE3A 2I6SA 4OBXA 5EIXA 2Q1UA 3A9UA 1EFKA 4ES6A 4EWLA 3INNA 2C96A 4PZDA 3GQVA 4FR2A 4IW3B 5E38A 5JY6A 3OWOA 2W37A 1E2GA 5AK5A 1KJJA 5K0ZA 5KHOC 3DF7A 1FTYA 1NI5A 3BGWA 2IS6A 2PGLA 3ABIA 1R8YA 3AP1A 3P2MA 4HDRA 4X0EA 4YBRA 1QCCA 1E3SA 4Q9NA 1YCHA 1T1EA 1YRYE 4RJKA 4BKUA 1NXWA 1SGWA 1R8XA 2PA0A 3MG9A 1MNAA 4R69A 4ZJPA 4ZYZA 2VTBA 3FYUB 4R41A 1B8VA 5GJWC 4HB2A 4IIHA 2X8WA 4JWKA 4HGQA 3CUWA 3KQWA 2JLQA 4N6NA 4RHYA 2JLZA 3U5TA 2O8CA 2AC7A 3O2NA 1WSWA 3N8KA 3P9KA 1BKYA 5HP4A 3U7JA 2AXEA 4KLAA 1PJRA 1ND6A 3H2ZA 2ZB7A 3IO5A 3ZZTA 4DUZB 1TUBA 1IULA 3N53A 4G1EB 4DLTA 5EJEA 2BKLA 1ACLA 2Q3DA 1WM1A 5J5VA 5K3FB 1IN1A 5CFZA 3RIMA 1RI3A 1W19A 3IKTA 3AEKB 1TYCA 1Z2EA 1D03A 3NXKA 2HSJA 1LW7A 2DWOA 1OD6A 1ACJA 3FJOA 3NHKA 4O5OA 4GSYA 4XIFA 4EB6B 4KFSA 3B7GA 3D2AA 2GRAA 5LOVA 4RA6B 4QE3A 2CK3A 1G41A 2FMHA 4IMIB 1B8NA 5D00A 5AVJA 1OJ7A 5A7HA 4IHJF 2WNHA 3QE4A 4DL9A 1IZ9A 5K0TA 5C1DA 5A0TA 1XALA 1ODTC 1OU0A 2VDUE 1ZBQA 2Y4OA 3PGVA 3Q0TA 4BTEA 2IP1A 2ZIVB 5IKXA 3OQJA 2DPGA 3BWXA 2PSHA 3KXIA 2X6RA 1DOZA 3SMQA 1A50B 1U2DC 3RRZA 3PEUA 4L57A 2YQZA 1H1LB 3A1FA 3C4QA 4G81A 2C00A 2XE4A 5FWNA 5ERXA 3NDPA 3U4AA 1L5FA 3H5TA 3MRTA 1QVWA 1KDPA 3HMKA 4K03A 2WVGA 2XTNA 5JZMA 5CCDA 2WD9A 2WU0A 3M3DA 3BGVA 3URKA 2BCJQ 1W59A 3OPMA 2AMJA 4QPNA 3TCKA 1ZGGA 3SQDA 3K8QA 2G4CA 2E7ZA 2GPJA 2GS9A 3DR5A 1UMCB 4MV5A 2VYFA 2Y6VA 4PVDA 3SN6A 1HEYA 5KU7A 3VDMA 1XA3A 2JBHA 2VJLA 4G0OA 3D3WA 5FTWA 2JHGA 4Y6SA 3L05A 3LWDA 3TCXB 4BNVA 2CB0A 5IAEA 1Z36A 1W46A 3OPXA 1HPLA 5I5TA 2BELA 3CRRA 4FD2A 1RWBA 1NVTA 2FSVA 2FPUA 2D1QA 3IUJA 1YJQA 1F0PA 3O2SB 4L7QA 3OQNA 4EP1A 1GZHB 2P3LA 4I2NA 2H16A 4EJSA 3HM9A 2FWNA 3LO5A 1E61A 2EJCA 1FTGA 2RB4A 3CW8X 1QFZA 3VUFA 5IT0A 1N5DA 1RHMA 3K0KA 2XB9A 4QPDA 4BBJA 4DC9A 1U98A 2IELA 3WLAA 4PX2A 3ZE0B 3MWFA 4AURA 1VTKA 4YAGA 2W90A 5DVZA 3DC2A 4E1VA 4RCNA 4AIIA 5AVQA 3AWIA 1FDUA 1IB6A 2FU5C 3TVYA 1XA4A 2WJZB 4D7AA 1NUAA 4JOSA 1XJCA 4QPJC 2WAAA 1H4QA 1T9BA 4V0OA 4IDBA 3RO7A 2VPQA 5LQAA 4ND8A 2ZBFA 5TARA 4ENRA 4K81B 5KPJA 2XZLA 2BW0A 4LYJA 9LDBA 4RX1A 3PEVA 1HZJA 1PJ8A 3GLKA 1XP5A 1OKKD 2WHEA 5EHNA 4CHIA 5C4GB 2ALJA 3JQQA 3LPAA 1RFGE 1R0ZA 1EFPB 5K03A 2ZUEA 1L1RA 1SUWA 3JQ8A 2JIZA 4IILA 3RS9A 3TSWA 1E3IA 1XZAA 2RAUA 2RHCA 3HYLA 3C74A 4AS1A 4HGYA 1UBHS 4P98A 2BTOA 3VA7A 1C3OB 3CN9A 3QIAA 3BIJA 3GLIB 3SJUA 1QORA 3HCEA 1IEXA 3WGMA 4BRWA 3BGSA 2G0AA 4GSLA 4ARUA 2W2XA 2PPLA 1G3IA 1DQZA 4HYTA 3CZCA 4DA0A 3GLFB 1IG3A 3NTQA 3H3XA 3RPEA 3NJ8A 5FKJA 4ESEA 1QC5A 1ZI6A 2HXSA 5G0SA 4MZXA 3OU6A 1KE2A 3GR6A 1UM8A 1B6TA 2X7HA 1LBIA 1R9GA 2OYRA 2IDZA 3AWDA 3T7TA 3ULKA 3W9BA 4RTSA 1G38A 3D8UA 3DXYA 4B5LA 1S1MA 2NZVG 2ODWA 1DAIA 1OC4A 4Y9SA 4MGZR 4ZZ0A 2VRBA 3QXJA 1PEKE 3VOAA 2W6ZA 5KWSA 3GA0A 3JVVA 3CCCA 2HSWA 5K5EA 1GTSA 4RH1A 4BNMA 1PWHA 3KSBC 1BJKA 2Q9AA 3H5LA 4M1KA 5IC6A 4ZEWA 1ST2A 3ADCA 5K4AA 3ZZMA 1RWNA 4L51A 1H6BA 3U4GA 3TI7A 3PJRA 1RRGA 3V9PA 5KQGA 4AJIA 1TFUA 2NV6A 5K8VA 2VRWA 4TLLB 4BKOA 3G0BA 4MHOA 4MQ4A 1TZBA 1RAAA 3JRXA 1AGPA 4MUXA 3W5VA 4AKTA 3OTIA 4PLVA 3GLIE 5FV4A 2AC4A 1FQKA 1PSZA 2Z4SA 3IR6A 2BN4A 3DONA 4QTUB 5CNKA 4BNUA 5FWXB 3OA2A 4UU7A 1ISFA 5KS8A 1J5PA 3TUJC 5FBVB 5LD2B 2QL6A 4KZPA 1JT2A 3GLFE 3WRYC 4EA7A 1WQ1R 2QJWA 3CEJA 4IO1A 1Y5LA 4RLSA 4UUQA 4D4HA 5M2QA 3USES 1HMYA 5IJ0B 2G67A 1UT5A 5HRAA 3NORA 3BF8A 4W5JA 5CK4A 3SFTA 4LBWA 4LBVA 4LOIA 5FBHA 3RC9A 2ACKA 1GUBA 4RFVA 4F4JA 4Z1MD 2VP2A 1TT5A 4UNSA 2EF1A 2JASA 4RDCA 3VPSA 5ALVA 2VDKB 1PDOA 2GEBA 2VZ8A 2JKZA 1ZR4A 3SS7X 1NATA 4OK5A 2VDRB 1OA1A 5ENZA 1E9FA 3GEMA 5A1JA 1E3TA 3AEQB 1S7CA 1LF5A 3L77A 4NYMR 3ZOKA 3Q4GA 3JWJA 1H9CA 2ZU0C 3RWOA 4FEYA 3PK0A 1C7ZA 2GBCA 2JFQA 1HYBA 1KRXA 3BPSA 3PNBA 1J2JA 1ZM7A 1W25A 4DPMA 3FKQA 4M9UA 1G20B 1C0LA 3O4VA 3QUCA 1PJCA 3F98A 3K8YA 3MCUA 2O2HA 1H69A 1P9NA 2J67A 4JXJA 3L06A 4K6NA 3MLBA 1PO7A 1ZCFA 3DZIA 5B7GA 3H1AA 1A0IA 1C9MA 1GADO 2ZJ3A 4P3OA 4UQLA 5CD1A 4LAFA 2P9ZA 4HH1A 2JGLA 2YC4C 2GEUA 3E23A 3S2FA 4HQOA 3WVNA 3RIHA 3TJZA 5FOQA 3RBZA 2AG6A 4E11A 3ADDA 1OVMA 4TRRA 3W7VA 5AKHA 1PR0A 3VHQA 4FFRA 4EA9A 3ORHA 5IUKC 5JE8A 5AVRA 1J22A 3THXA 4FB4A 4U3JB 1V11B 1WR8A 1F20A 2QW0X 1U5BA 1KZ7B 4Z2AA 5IANA 2ANBA 3GCZA 1OTXA 3VMMA 3NDIA 3O4FA 4KHZA 4XD7A 5C8YA 3ZUGA 4LDQA 1U02A 1X1CA 1IZZA 1ZXLA 2HDWA 2P79A 3KZVA 4G0NA 4M98A 3FUCA 3U0BA 4PLGA 2Q3JA 4O0MA 4BO5A 4MXDA 4F9EA 3WLNA 4BP3A 3KVVA 2X22A 1QFXA 2JJYA 4CFSA 5JNSA 4DR6B 2YIMA 4ER7A 2TRSB 4LZLA 4R6XA 2FPIA 3JQ6A 3ZG6A 4H3VA 5L9AA 4BFYA 1I2KA 1OLUB 3E2MA 3KPWA 5IVDA 3GNTA 3WL4A 1OBCA 3K5HA 3JWHA 4QICA 4CI9A 1GU7A 1QRUA 2FEWB 2JBAA 4ESOA 1E64A 3B13B 4P4UA 3U9TA 1VLLA 2UYCA 2BFDA 4EQ6A 4E08A 4IEEA 4F5WA 5JTUA 2ZVJA 3O4RA 3R6WA 1GPAA 3FNEA 1A8HA 3N0WA 2H7YA 3N2YA 1DAFA 3MWYW 4MW7A 5J2TA 2IYYA 1LLFA 2WB2A 3OLZA 1LQTA 4UHEA 4ZRMA 4WLUA 3HH8A 3PRKE 3EGWA 4EM6A 3I6YA 3H0KA 1FMCA 3FF4A 5AIAA 3T7CA 2V7UA 5EIHA 2J85A 2ZUCA 2EXXA 2QLJA 4QVIA 3OF2A 5I3ZA 1X7XA 2J08A 3EIFA 4O59O 3VZQA 4FE4A 2HJ9A 2ZB4A 1AKQA 2NYRA 3ANTA 3DGFC 1I0ZA 3FF1A 2DQZA 3G9TA 5AH0A 1FYFA 4I14A 4US1R 4A82A 1A4XA 2I7TA 3HKDB 4EARA 1LDBA 3AVTA 1V9PA 1B8UA 4IWXA 4R83A 3PE3A 4LVOA 4RHUA 3EIUA 4HPXB 2LW7A 2XEDA 4XIGS 1E2NA 1NM5A 3OZCA 5TDHA 1L5YA 1JB9A 2R8YA 1ZD2P 1KXZA 4TXHA 5G53C 3R7NA 2O2GA 1VKRA 3F0TA 3E3OA 4PZ0A 3WXBA 3PXDA 3E22A 1HXHA 1JSCA 2CJFA 5BNWA 1M2OB 1KO5A 2L82A 2KBFA 3C3KA 3KXKA 4JC0A 1HYEA 1TEZA 1OBGA 3CM0A 1Q44A 3GVCA 2X4IA 4EGFA 5EJ5A 1FF9A 1MG0A 3NWOA 3W6ZA 1SKMA 4QOIA 2B83A 3B8HA 1E9CA 2Q3EA 4OREX 2P67A 4KXMA 2C54A 5I60A 3D5QA 5HXAA 3KQUA 3ND6A 5MHTA 2CLEB 3FCAA 3QW2A 2PT7A 4RL6A 3W6NA 5LWHA 3ZNQA 1FNMA 4YWJA 1XTZA 4NE9A 5JNTA 5DTEA 4X6XA 5E7JA 1DAGA 3DVSX 1PV2A 1Z5WA 3LMKA 4KFRA 5F9FA 1PTJA 1SKBA 2EYQA 4AY3A 2ZQ5A 5PNTA 2J48A 1F6WA 4BNJA 1FYVA 3OSUA 2H59A 5IJAA 4W5QA 1O0BA 1KL7A 3E9NA 4UBNA 3RTEA 3O91A 1FY2A 3HU2A 4XWKA 1RJWA 4KOAA 1D4OA 4FMBB 3A70A 1DKQA 2QZ9A 1N1EA 2O3UA 2QNRA 2G1KA 3BX1A 1VFNA 2NV2B 2RGXA 1E2LA 3GBSA 4CE5A 3AI1A 1CR0A 4TKUA 4HAZA 4JIGA 5D2CA 4OBBA 4AX8A 2OHHA 4AX4A 4C29A 3TMAA 3H5VA 3EH2A 1N2XA 2CCKA 4S1TA 2I8AA 3FWPA 3WP1B 5CH8A 1NW7A 1EVJA 1X1SA 4GL2A 1KQOA 2BWJA 4E0BA 2QROA 3FZQA 4DTIA 1Q0PA 1H65A 3ABSB 1I0LA 3U62A 2PRIA 1E9BA 3DBOB 1G8MA 3LI2A 2IV7A 3CNOA 3E58A 5FFFA 4B44A 1GHTA 4W5TA 5BVHB 1QX4A 2FJUA 4PW0A 1ZJ4A 2JGKA 3CH4B 1KYYA 3MM4A 3HY3A 3QPWA 4GFDA 4MUKA 1BX3A 2C4TA 4GGPA 4JCCA 1XWWA 3K35A 4MVWA 3V1KA 3UK0A 5B3LA 1G7CA 3R20A 4GWGA 4O2BB 3VX4A 3RUFA 5BR7A 3WLOA 1YS1X 4C1NA 3F1LA 3FLAA 4KJZA 4QUIA 3UJ9A 1O9GA 3GDGA 1CY7A 1FVFA 4JYPA 4MPDA 3RSSA 4WXPA 4ZDIA 1I7SB 1BE1A 3IP8A 4LE2A 5EE1A 3L0SA 2GAIA 4P4NA 5CDTA 1FS5A 4D9GA 4YRZA 5BQ5A 4EW1A 4KMOA 1W0CA 3ZU6A 1ULAA 3INRA 1Q20A 3PQ8A 1DC4A 1PJAA 1Z6PA 3CU5A 4JXKA 3GJ6A 3MIIA 3A32A 1L7AA 1U2EA 2CN1A 1KOLA 4D0SA 1P6XA 4RO0A 5CA0F 5CW1A 5DM4A 5F3DA 4PYQA 2EZUA 2ORYA 4ZPJA 2CXQA 4B3CA 1Z2DA 3LRXA 1WB4A 5ALDA 3FGOA 4QPCA 2F1KA 1YQDA 3TQIA 1DC6A 4LHSA 2V97A 4W1RA 4Q3BA 3VZBA 5FQNA 1U0SY 4WFKA 4EKIA 4KJXA 3IELA 2I5PO 1R4NA 3DBRB 5KHLB 3NIWA 1GGFA 2IKSA 5KYXA 2GJ8A 3C3MA 4HGRA 2CL5A 2Q2NA 1QGOA 2PMCA 5LQCA 4JYAB 3IOBA 3LOQA 4IV0A 4YV0A 2JCGA 3L5OA 4CR8A 2B4TO 2A8YA 4Q00A 1Y48E 2BYTA 1J2EA 2OEPA 3IQHX 2IHTA 2FH5B 3REOA 3ZLVA 5LYJA 3F67A 1FVIA 3K4PA 1HTWA 1NY6A 5HIJA 4DCVA 4POOA 4MB0A 1ND5A 4QBTA 3AHDA 3OUUA 3RS2A 3OT5A 4YAJB 4DABA 2WF7A 3NBFA 1B43A 1RPJA 4YRMA 1D3AA 1UDCA 3VDRA 3OE1A 1MW8X 3U80A 1MTZA 3TM5A 1VKNA 1Z0KA 3Q5EA 2PKQO 1HORA 3ZQKA 1D6NA 1EBBA 4A03A 3FTFA 1PLKA 4PE5B 3CJQA 5H83A 4I55F 1GDDA 4G8DA 4RHXA 5D1HA 3SYKA 3BF7A 4YBZB 1O94D 2OKCA 3QKSB 4JL5A 4YJ3A 5COBA 3TEJA 1HDOA 1BE8A 2SKEA 1RRVA 1UBMS 3BWYA 3T0GA 1K88A 4HNTA 4FX2A 2R6R1 4DRXB 4X7BA 2QT1A 1WBDA 3E1SA 1P5HA 3EUAA 9LDTA 1MKYA 3C3JA 1V8PA 3W2FA 5CX1A 1KPIA 1PN3A 2CUKA 1UQUA 2WZBA 1I9GA 3HDQA 1FUYB 3K94A 2YJTD 1N7GA 1MVNA 3CVUA 1HSZA 2A0FA 5DI9A 4ZCQA 3BZUA 3OC6A 1GRRA 2ZK7A 2QIPA 1JG4A 1CZHA 1KHTA 4WLOA 2RONA 5M29A 1K5GA 4CEJB 4HQKA 4L8LA 3GMSA 1I4TD 3PVSA 3O1HB 2ZAYA 5B3JA 4FDAA 1CX9B 5AVTA 4X1OA 2FRDA 3HWSA 1J0DA 3EPRA 4QXQA 3AXTA 1QCDA 2O7RA 2O5CA 5DWQA 1ZRMA 1L5KA 2QSZA 3VTAA 3TZHA 3H2BA 4M22A 4LFCB 3V2HA 4ALNA 3JQFA 3M4ZA 1Q6ZA 4CQMD 1MN6A 4B83A 2HSDA 5KVSA 4WY5A 1O97D 3A36A 4C4SA 1K5HA 4AVYA 1C1HA 4Y2JA 4CLEA 1DFGA 1OYYA 1YZ3A 1TI7A 1VCHA 2F3PA 2QAGC 1W5SA 3HA5A 3K1YA 1BWRA 1TA4A 3PZRA 4MMYB 3JATA 2QLBA 3G82C 2ZXEA 4RYLA 3SC3A 4B76A 3UAXA 1E66A 4EENA 1WLSA 3R9RA 2EDAA 2PVPA 4TV8F 1PE0A 2HLNA 1GQYA 1KK2A 2QRHA 3NC4A 3SGLA 2G1PA 2H2HA 2AG0A 3HB9A 3KEFA 3K7EA 4LHWA 1GY8A 2C5HA 4RMNA 4OLJA 4LTDA 1A95A 3CTMA 3UWKA 2EGGA 3C48A 4URWR 3WA6A 2DPLA 4G0XA 2JK1A 2IZ7A 1D07A 4QYIB 2HF7A 4YXWD 5BUZA 2ECQA 3TLAA 1BDHA 2PYDA 1IZ7A 4A0RA 2G9VA 3OUZA 4TZKA 5JI3E 2A0XA 2P0EA 5C7IO 2H7VA 3FGNA 3KSUA 1TYZA 5SYNA 1CERA 4G3XA 3IUSA 3CYFA 4KWIA 2PMKA 4B3TB 2ES4A 1SOMA 4X20A 3HJBA 2CD9A 4P0TA 4RIFA 5AUOB 1B4DA 2CSXA 2I29A 2Q3CA 1FFHA 1FFBA 3VTZA 2PLFA 1GN9A 2IL1A 1Z29A 3D6JA 1NMSA 2BJHA 3GP5A 1EGHA 1Q77A 3V4VB 4LC0A 2H0QA 2NU8B 1Q95A 3WS7A 4FHFA 1XMJA 2YJ4A 1B74A 2ZI3A 4D3XA 2PRSA 3GN1A 2COEA 4UJ3A 1KI1A 1M2VA 4H3SA 4BV2A 4IH4A 3A7EA 2FR0A 4IWYA 1F48A 1E63A 3SX0A 3W5BA 4UBOA 4XB1A 4D4LA 3GRCA 3DYBA 1ETHA 4R2XA 2H54A 4UMDA 2FW1A 4NDAA 1MB9A 3L7AA 1N57A 2B6HA 4TVKA 4IDOA 5DLEA 4ARAA 5K8CA 2ZI5A 4H6PA 1G16A 4C88A 4IQFA 3N05A 2C98A 4EX6A 3H9EO 1ZR2A 1M9NA 1XAGA 2QX9A 4F21A 1I2DA 1WMBA 1OZGA 4OPMA 4CTJA 5FNVB 3RRMA 10MHA 2BOVA 3D4PA 3I58A 4CG3A 4CM4B 2IU3A 1WOYA 4ER3A 1XNRB 4AWXA 2GZ1A 4KTVE 4MYTA 5TT1A 1W48A 5G02A 2PQ6A 3G5UA 1TKRA 4IDQA 4NOLA 5JDCC 4LK3A 5GTDA 1N92A 1HR0B 5I8PA 4LXGA 1PHRA 4X90A 3ET4A 1DBSA 1OPRA 3EZ2A 3GFGA 5B36A 5CDYA 4OI0A 4RTQA 1JQDA 2TMYA 4R98A 4WZBB 1GTZA 4ICIA 3EDYA 5ED4A 4ZZIA 1BHO1 4MUEA 5CDFA 3C45A 2PK3A 3CX8A 4ZI5A 3VBEA 3ZYCA 1XRJA 4OP2A 3L6OO 3N8HA 2IS1A 1K7FB 5K51A 1JQLB 1L5QA 1G2OA 3OQBA 5IM4F 4GYJA 3AVWA 2ACVA 2X4GA 4EHLA 1BG6A 1WIWA 1ZMRA