4FFRA

Semet-labeled pylc (remote)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
355
structure length
347
Chain Sequence
b'MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYDDKDEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PylC
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase
total genus 112
structure length 347
sequence length 355
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ffrA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ffrA01
4UUOA 2C2XA 4OM8A 4E5KA 3HZZA 1BVRA 3KZVA 4NHEA 4QO8A 4J2HA 3WSVA 1ZNQO 3ZWCA 1JKFA 1YKFA 1WR2A 3GOHA 4ZQHA 2SCUB 4FFOA 4Y6PA 4KP7A 2VCYA 2C20A 1ZK2A 1DSSG 1N9GA 1Y9EA 4UVEA 4IY1A 4HQ6A 4HNTA 4R5HA 2DKNA 1BVUA 3DWFA 2YJZA 1QV6A 3K9QO 4HKTA 4Q9NA 1HYHA 2AA3A 3IP3A 3KVOA 2ZKLA 2YQ5A 1HE2A 3OSUA 4AJLA 4EJ6A 1HE3A 1QYWA 1U1IA 3GFBA 3NKLA 1LDBA 2BRUA 4YAEA 4AG3A 3EHEA 3DBVO 5A03A 4ALMA 1UP6A 3C7AA 3F1LA 3DMTA 3HFGA 5EL0A 1JA9A 4C7KA 3WQSB 3AUAA 2VR1A 4O1MA 3UCEA 5ENDA 4JK3A 1NQ5A 2VHXA 4X54A 1B8UA 1MGOA 1MLDA 1P31A 4GMFA 4HADA 3ZGYA 1O8CA 1RM4A 4QO7A 1BG6A 2C2YA 3AM3A 4U6QA 3DTTA 5ITVA 1XU7A 2IE0A 3DOCA 3MOIA 4BVAA 3U09A 4XYEA 2R6JA 3K5PA 4O59O 4YXFA 3DZFA 1ADBA 5DCYA 3VTZA 1U3VA 2PY6A 3HN2A 4E12A 4YJHA 3ZV4A 3DZKA 2BKAA 2JAPA 3FBGA 4I1IA 1JAXA 3QY9A 1D3AA 3KBOA 2VOJA 1DIGA 4W4TA 5KVVA 1S7CA 1U2GA 3JD4A 3TOZA 4PLHA 2NVUA 4ZQGA 1NNUA 4ZQFA 4BGIA 4E21A 4ALNA 3HBLA 1N5DA 3WLEA 4E2XA 1DV1A 4AICA 5I9NA 5B4TA 4E5MA 4OO3A 1LSSA 4MV9A 5L53A 2ZCUA 1J5PA 5DBIA 1P0CA 3PHLA 3GLQA 4FW8A 4XX0B 3JQ8A 1LDYA 3I6IA 1ZK1A 4M49A 1ZCJA 4U0KA 1UUFA 4D0RA 3W6UA 1U4OA 1H6AA 1P44A 3RU7A 3T7CA 1E3WA 1AXGA 1N2SA 2Q1WA 2VWHA 3DONA 3N6RA 2J5KA 3MJTA 4ZA2A 4WLUA 3F9IA 1KUTA 1LC3A 2YZLA 3GY0A 3PQEA 3INTA 1V9LA 1HDCA 1BWSA 1U5AA 3V2UA 5MDHA 3DBHB 4RF2A 4OOEA 1B2LA 3W8DA 4A10A 5GZ6A 1EVIA 1G6KA 3PJGA 2OLSA 2BHLA 2GNAA 4IDAA 4NFYA 4XQGA 4TZKA 2YHIA 1D8AA 3L4SO 2XD4A 3DC2A 5B4UA 1PJTA 3BTUA 1O6ZA 3UF0A 3VOSA 3CMMA 4HP8A 3JD0A 3KAJA 2X0NA 1BGVA 1KC7A 2IYPA 4U5QA 1EMDA 3ZWWA 2O7QA 3NAQA 4RQUA 3TJRA 4J90A 1E6UA 3RC2A 4JP2A 3AI3A 5TQVA 2VWGA 1NASA 3RI3A 1XR3A 3R5XA 1A9YA 1JKIA 1GAEO 4WOJA 3GVIA 3EGOA 5BPFA 1ADCA 1UDCA 1CIVA 2PZLA 2V65A 5A9TA 4BO6A 4L0QA 3V1TC 2B69A 4CUZA 1DV2A 1B16A 1LQTA 2VQ3A 3VZRA 3T7EA 4IPTA 4DC1A 3H5RA 4AJPA 2OOSA 2B0JA 4UEKA 5C7IO 4CQLA 4XGNA 4I5EA 1KVSA 4PRKA 4UEJA 4CM6A 2C0CA 3PZBA 4Y8VB 4JJGA 4ITUA 5JY6A 4I08A 4YEDA 1JWBB 1B6RA 3NT4A 2EGHA 2EP7A 4A27A 4QXMA 5COAA 1FDVA 5CP8A 3IIEA 2DBVO 2X9NA 4WLFA 5C5IA 4BMNA 1CQIA 1ZSYA 4HNUA 3C1AA 5KIAA 2IZ1A 4MV3A 2NACA 5KOIA 3ASUA 3QHAA 4A0SA 4CV1A 3ORFA 2O3SA 3H4VA 4PCVA 4PG7A 4XIYA 3UN1A 5A04A 3DQPA 3QP9A 5J2UF 2H9IA 2GZ1A 4WK6A 4YT8A 1KJIA 5D8DA 4Q3AA 1Z75A 3GPDG 3OECA 4R5MA 1Y1PA 1PS8A 3JZFA 1QG6A 4XQEA 4I5DA 3AWDA 4YRAA 5CPBA 3DZGA 1NPDA 2AMFA 1B26A 3ANMA 4JN6B 4MVJA 2WJPA 1T1RA 4RPLA 4B79A 5LOVF 1HSOA 3I5MA 3QE3A 4MIYA 1HXHA 2WTBA 1Y81A 2DFDA 1TT5B 2Y0CA 4C5BA 3HDHA 4KZPA 3RU9A 4CLEA 3ZWOA 3H5AA 4W7HA 1XELA 3VDRA 3MWEA 2GQSA 3OETA 1H6BA 1BXKA 3DDNA 1KVUA 3D4PA 4CLRA 5ICSA 1A48A 4DBZA 3OA2A 1OOEA 2DUUA 4JBGA 4GX1A 3U49A 5L95A 2Q1UA 2R84A 4IDFA 2DBRA 3MWDB 4DPMA 3ZU5A 2Q4BA 4IDGA 4MP3A 5FNVF 3D3EA 5BSEA 2QG4A 1ONOA 1RM3A 3QJ5A 5T8KC 3UKOA 3AFMA 1F14A 4W6ZA 2Z5LA 4CJXA 3TZQA 3JV7A 3U9TA 3RC7A 4EDFA 4U6SA 4J0EA 4B4VA 2O23A 5THQA 5LDHA 1LTHR 1NM5A 2PKQP 8ADHA 3U4DA 1KERA 2FPIA 2YW2A 1NP3A 2W4QA 3PJFA 4CMCA 2CUKA 3A4VA 2JFHA 1XWFA 2VUSA 2R00C 3ICPA 4XRRA 3NDJA 2NSDA 4ONEA 4TROA 3QLJA 4UREA 4IUYA 5BNIA 5TT1A 1P0FA 1BXRA 4NZ9A 5H83A 4WKGA 2PGLA 4IS2A 3IP1A 3TW6A 1ISHA 5TGDA 4J1SA 4BV8A 3SE7A 4WCFB 3WS7A 5HWSA 4NQZA 1E6EA 4BNYA 3PXXA 1BXGA 1E7YA 5DOZA 1T2DA 1OAAA 1E1NA 4BO3A 1X7GA 4GVXA 1NTOA 1KEUA 4FE2A 1I2CA 3ROQA 4NU5A 1I10A 2EERA 4KQXA 4F46A 1IPEA 2DLNA 3FTPA 1C3OA 1PX0A 2HRZA 3K73O 5AXAA 1LQUA 2O3UA 3AOEA 4J1TA 2AXQA 4F6LA 1EUCB 3WXBA 4Y8VA 4O86A 1HLDA 1LEHA 1R0KA 1E1MA 3RUFA 2RHRA 5B37A 4A26A 2P4HX 2P9GA 2J9GA 1ORRA 1YL7A 3ZU4A 4QUKA 3AFNA 3ZWVA 2X7HA 4CQMA 3CH6A 4KUEA 4Q3BA 3MOGA 2VTDA 3L9WA 5L45A 4ZQIA 1GYPA 3JQEA 4CR6A 2NU6B 2J6IA 1SEVA 3UH1A 4QSHA 3D7LA 4D44A 1A9XA 3L4BC 3DBLB 3MTJA 2IZZA 3NRCA 3UXYA 4J4HA 4UEOA 2PD6A 2VRCA 4OOFA 3M1AA 4RQTA 2Y67A 3AY6A 3IOYA 4R1TA 4RVGA 4YT5A 1QKIA 3RASA 5JCJD 4E4YA 1UJMA 3BA1A 3ITKA 1TVEA 4D42A 4GSKA 1VI2A 4BO4A 5C3MA 3U9SA 1K6IA 4RF5A 2VHVA 3LF2A 3OEYA 4NK4A 1MFZA 2C7GA 2ZDQA 4O7NA 2HO5A 4FJ1A 3GHYA 4DMMA 2EHDA 3OHSX 3QQPA 3ZW9A 2P5UA 4O0LA 1PS9A 2FSSA 2WYWA 3SJ7A 2X1HA 5IFLA 3VAZA 4EITA 1YO6A 2Q99A 5F5NA 1XQ6A 4IZHA 1PGOA 4TUYF 4OL9A 4IQ8A 2HSDA 1DLJA 3GNSA 4BS9A 4ND3A 3WSWA 5G0VA 1IB6A 1V6AA 4DQUA 4FB5A 1P33A 1OZAA 5IYZF 3JQ9C 2D1YA 2BGMA 3VZPA 3H7AA 2I8CA 1PIWA 2G1UA 1VKZA 3AK4A 1SNYA 2GN9A 3MWDA 1NAIA 1DHRA 4D0SA 2I99A 3IS3A 2PD3A 3RUCA 3GVPA 1RYDA 3WGZA 4CLXA 3GH3A 4O2BF 4GSLA 2W2LA 4ZJUA 4RVHA 2PKQO 1EEHA 3WGOA 2B83A 5J23A 2AE1A 1AHHA 3VPGA 2AQIA 4JGBA 5TJ9A 2W90A 4OSOA 3RBXA 4Q3NA 3VH3A 4J4BA 3D1LA 3L9XA 1V3VA 3GT0A 1SOVA 1NX6A 4FPXA 1E7SA 3UGKA 5I7VA 4I5FA 4O63O 5GY7A 1H2HA 2QW8A 3D0OA 4WLNA 5JNLA 3TQTA 3PFFA 3W1VA 1E3EA 3I23A 3R23A 4O7LA 3WLFA 1F8GA 2Q2WA 2JFFA 3DAGA 2DT5A 2X58A 3KSUA 2O4UX 4LVCA 2FHSA 1ID1A 2D3TA 3G8CA 4G2NA 4N5LA 1A7KA 3RQSA 1U5CA 1SAYA 3GG2A 3KSDO 4YJ2F 2RIRA 2EKPA 4FGRA 1CQJA 3EYWA 4W9NC 4N5MA 3HJAA 5G0WA 4O81A 3FTNA 3IUSA 1J4AA 3KV3O 3RV4A 4RZIA 1Z2PX 1QSGA 4Q3DA 5K6AC 1OFGA 5BSFA 5EJ2A 4D7AA 2PV7A 3LT2A 1HLPA 2FWMX 1GTMA 1YE3A 1I33A 1JTVA 1T24A 4CM4B 1XGKA 4MKXA 3WYCA 1KS9A 2PZKA 4GI2A 1EUCA 1BDMA 2I9PA 4XJSA 4YDRA 1VKOA 2NWQA 4JX8A 1HE4A 3R5HA 4XR4A 2Y99A 2RBEA 3GUYA 4L74A 2OUIA 4KWHA 2VHYA 1ZH8A 3OJEA 4LISA 1M0WA 4NJOA 3P2YA 5F1OA 5JH7F 2Y1DA 3OM9A 2C00A 3Q3CA 4IJVA 1I8TA 3AOGA 3DBLA 4PLPA 4GH5A 3O8QB 1I7NA 2V58A 1K0UA 1PJ3A 2C5EA 3KLMX 5TJHA 1LU9A 4II3A 2OXIA 4GX0A 3L77A 4QX6A 1XA0A 1UZMA 2GRAA 5JW6A 1NR1A 1PS0A 1U9JA 3D64A 3VPCA 1YBVA 1DDOA 2OZPA 1H94A 1WZIA 2GZ3A 3GC6A 2FOIA 3LC1O 2I67A 5L40A 4DBVO 3EVNA 1SB9A 1LBEA 4NJMB 3GZNB 1I2ZA 2P2SA 1FK8A 1FDUA 5JDIC 1ADGA 2OL4A 5ILGA 2AG5A 3BMOB 2DM6A 3ZV6A 1Y5RA 4D45A 5EQFA 4I8XA 4F6CA 5KCZA 1U3TA 4BO1A 1BTOA 3LT1A 3G3EA 4PG6A 3D4OA 4BNJA 4IMPA 1T2EA 2DUWA 2PK3A 1ADFA 3OIDA 4AVYA 4HNVA 1YB5A 1DIRA 4LCJA 2F00A 2J3JA 3RVDA 2GF2A 4O4JF 3BTOA 5FI5A 3T4XA 5BSHA 1H5QA 4RPKA 3RKUA 2FP4A 4GWGA 3HQ4O 4B7XA 1FXSA 1R37A 3Q0EA 4WCDA 5JXWA 1EHIA 4NIMA 1GSOA 5ICMA 3HFSA 2HU2A 2G82A 1QR6A 3FR8A 2CZGA 3NEPX 4M1QA 4WUVA 3RIHA 4CV2A 3OJLA 5AXBA 4B7UA 3UW3A 1YXMA 3TZHA 1EFLA 2YV2A 1H6DA 1W6UA 2OFPA 4Z9XA 5CEJA 5KTKA 3TRIA 3FCOA 3ETHA 4ND2A 3F3SA 1U4SA 1WW8A 4NFHA 1P45A 2RCYA 4R3NA 4NPCA 3TF5A 1A27A 2B4TO 3RJ9A 3WG9A 4JP3A 4TRMA 1SOWA 3PIIA 4JQCA 4BKRA 1YJ8A 1LDEA 3M6IA 2HMSA 5AQ1A 3OJOA 4XDZA 1HWYA 2EXXA 4MJLA 4E32A 1PJQA 3I12A 3CUKA 4KDFA 4L76A 2V6MA 3RROA 1IOVA 4YA6A 3LK7A 1P1RA 2HMTA 1CJCA 5JY1A 1BHSA 1I30A 1JQBA 3CZRA 2D5AA 4S1VA 3TNLA 1MC5A 1NQTA 2IXBA 1K6JA 3C85A 1I01A 1VKNA 5C1PA 3HNPA 1WAMA 4II2A 3ITDA 4BKQA 1PEDA 1IOLA 4BB6A 4IIUA 2I76A 5KJEA 3JYQA 1C1DB 1PL7A 3TOXA 2Q2QA 3VPFA 4DIFA 4CM4A 4G65A 4EUFA 4C4OA 1KVQA 2HDHA 3JYPA 3QA9A 4RGBA 2CNUA 2ZB3A 2DPGA 1GD1O 2R2GA 2GLXA 4XRGA 5DP2A 3MJVA 4XEHA 3CMCO 1E1LA 1EDOA 4Z6KA 1ZVMA 1KY5A 1PJLA 2I66A 3KHUA 3HN7A 2NU7B 4Y98A 1ISIA 2HAEA 3S1LA 4MV6A 3AU9A 3H9EO 3WGGA 4BKOA 4EEZA 4HWKA 1AGNA 2AQHA 1F17A 1VPDA 2VRBA 1SMKA 2DFVA 3BIOA 5DULA 2P68A 1KBLA 3GVCA 2EV9A 1PL8A 4O83A 2J3HA 4R16A 4ALLA 4B3JA 3I3OA 5CDUA 1ZSNA 4L73A 2WE7A 3M2TA 2D4AA 3EVTA 2GPSA 1Q0HA 1VJ0A 3U9LA 2VPQA 2CNBA 2NADA 1XDWA 2V59A 3SJUA 4B4OA 3OP4A 2E49A 4R1UA 2P9EA 4INAA 1Z2NX 1E77A 3ETEA 3OFSA 4EJ0A 4BO2A 5A4DA 4F3YA 5IDYA 4BO0A 2O3QA 5KVQA 4H15A 4CM8B 3PZRA 3GHHA 4EUHA 3ASVA 4E33A 4MVJD 3RC1A 5A1TA 1T26A 3EK2A 2XPCA 4RORA 5TRTA 4TZTA 2W71A 2VNSA 5JQGF 4CMIB 3TIGA 1BNCA 4Z3KA 4YT4A 5HS4A 1W8DA 4MV8A 5FYDA 2DAPA 2P9CA 3C8MA 3V1YA 2Z04A 4MVJI 2OMEA 5EESA 4BO7A 1PWXA 3PYMA 2B5VA 1XLTA 1XQ1A 3SLKA 4D3SA 1PSDA 1ZJZA 3I4CA 3ZZNA 1ZBQA 3AM5A 5DZSA 3C1OA 3E5RA 2GN8A 1QYCA 3L6EA 1EK5A 5JMPA 4ZI7F 5KKCA 3DMTC 4BO5A 3GG9A 1MG5A 1RWBA 3INGA 5IDWA 1VJ1A 4ZQEA 2ILTA 2ZB7A 3DFUA 2AQKA 2UDPA 3DMYA 4D3FA 1LRLA 2WD8A 1R16A 2NU8B 1RKXA 1NFQA 2FPPA 4WECA 5H81A 2EJWA 2IXAA 5T57A 4DTIA 4KUHA 2Q2VA 5CA1F 3GF4A 1S6YA 1UAGA 3IJRA 3LT0A 4AJHA 4E13A 1EDZA 3LU1A 4NNJA 4C7JA 1PQWA 2H6EA 2H63A 4CLDA 1VSUA 5JQWA 1FF9A 5IZ4A 5EPOA 3RFVA 1JLLB 5L51A 1OMOA 5AXDA 5ILOA 2CF6A 3QWIA 4W7IA 5DNAA 5ADHA 2ZCVA 3BYZA 4UVHA 2G0TA 4PN3A 3R1IA 4XGKA 2NU9B 1BW9B 2VT3A 1C1XB 2P91A 2GSDA 3BHIA 4CV3A 3MTGA 2V6FA 1KC3A 4NBWA 3R3JA 4OKIA 1K3TA 4MVJM 3GN2A 2EWMA 1E0DA 4E4TA 3JQCA 1P1IA 4LGVA 4RZQA 2YYAA 4IIJF 4UVGA 2HMVA 3NYWA 4ROSA 3Q2OA 4CMEA 1HYGA 3F46A 5DBFA 3HWRA 4IXTA 4OKNA 2E82A 1UH5A 2YDXA 3O26A 4DMLA 5K0ZA 2Z1MA 1TI7A 3PK0A 1C1DA 1XHLA 1NVMB 4XZ3B 1G0OA 3WGQA 2VTEA 4Q3CA 2DQ4A 2W98A 3C7CB 3DAFA 5G4LA 1LC0A 1ZK4A 2GDZA 1EQ2A 2O3JA 3AW9A 1WMAA 1Q7CA 4FJ2A 4YAKB 2CVOA 1I3NA 4IIVA 4N18A 1D7OA 2ZTMA 2NU7A 5IXYA 1D4FA 1H9BA 1KC1A 2DBQA 1CEQA 4CPDA 4S3MA 4E31A 1C0IA 2VWQA 2HKIA 3QWHA 2YDYA 2VOEA 3H9QA 4E30A 4OSPA 1GUZA 5CG1A 3AUSA 4WPGA 4IHJF 2R7LA 3SVTA 3ZHZA 1C30A 1GSHA 4J0FA 3T4EA 1AN9A 3CTMA 3W4IA 5KJFA 4CQMD 1WLYA 2RHCA 3UFXA 4IDDA 3GNQA 5TT0A 3JQDA 1EFKA 3E1KA 3ADOA 2GASA 1W0CA 4JCOA 4ZRNA 1PGNA 1HF3A 1OC2A 2VRCD 1F0YA 1NAHA 3GIDA 1OI7A 1MV8A 3H2ZA 1KEPA 1YH3A 5B4VA 3PIDA 3WDSA 2W70A 1NVGA 1DRWA 3DZBA 3FHLA 2JD0A 2DTEA 5GONF 5DF1A 2YUTA 3ICCA 1EK6A 5GZ3A 3VC7A 4XIJA 4Y6SA 4YB8B 5LA6F 3PJDA 4BNVA 1PGPA 3IKTA 4BNKA 4FJ0A 4QECA 4E6PA 1DJNA 3PTZA 1PJBA 1U2DA 3KXDA 5KJ6A 4WOKA 5BMVF 2GCGA 3DO5A 3TINA 3ZDFA 3H2SA 4BKUA 4CMIA 5THKA 5LDGA 2SCUA 1EE2A 2ZB4A 4CM1A 4P22A 3R5FA 2WDZA 3RBZA 3ZNQA 3GA0A 3L6OO 1YDWA 3H9JA 4Z0HO 4GGOA 3UHAA 4A5OA 2O2YA 3WGHA 4GQAA 2CD9A 3EZYA 3EW7A 3GGGA 3QV1A 4P4GA 3RUEA 2ZYGA 1KBZA 3FD8A 3ROKA 2FR0A 4DLKA 1OBDA 3K92A 1NBOA 2W2LD 3FWZA 3LC7O 4XYGA 4C5AA 2Y1EA 3DZIA 5BQFA 3K2EA 4CUJA 4UUNA 1HSZA 1Z6ZA 3ROMA 5IZCA 3ZV5A 5A3JA 1I3KA 1X7HA 1B3BA 4A2CA 1P9LA 2YZGA 2VQDA 2NVWA 1NWCA 1YQGA 2NU9A 5IG2A 3IC5A 1WDMA 4HFMA 3D5QA 1YB1A 2IEBA 1GL3A 1WMBA 1CRWG 5CDTA 1M6HA 1BMDA 5JO0A 1FMCA 3WNQA 1ENYA 3DZJA 1V8BA 5JPIA 3A9WA 4EUEA 2QYTA 3P19A 4M89A 3KLPX 4NU6A 4A73A 2DIKA 2FR8A 4ALIA 3IJPA 1SEPA 3WNZA 3BXXA 3JTMA 2E4AA 2QRLA 2R7NA 5J2TF 5KKNB 4DREA 2GGSA 4DLBA 5IDXA 4O7SA 4R1NA 5L7YA 4O4IF 3JQBA 3LF1A 1LXCA 4PLTA 2RAFA 4DRYA 4ZU3A 1C0KA 3WNVA 5DCWA 3JZIA 1EBUA 2I3GA 2WM3A 4K9DA 4XZ3A 2H5LA 4LMRA 4XX0A 4D79A 3W6ZA 2R7KA 5A06A 1EYZA 1ZKMA 4MP6A 2B35A 2X86A 3VH4A 4XQCA 3NT5A 2CVQA 1BXZA 2NV6A 5EMHA 1LLUA 4XA8A 4YAKA 3TDKA 1IPFA 3G1UA 1LRJA 3FNGA 1I7LA 1ZMTA 1UXHA 1VSVA 3O38A 1P77A 4ZGWA 5TNXA 1XU9A 2BELA 1DC5A 3R0IA 2FZWA 2NTVA 4FSHA 4EGFA 3DBHA 3OJFA 1GYQA 3RUHA 2QRJA 4YRDA 3GGOA 4YJGB 2Y66A 2PFGA 3I9KA 3K31A 3SC4A 4E5PA 1GZ4A 5I8ZA 1VL6A 4RPHA 3VH1A 1JU9A 1E4EB 3AUUA 1WWKA 2YZNA 4GBJA 5AXCA 1YBAA 4RVUA 5ER6A 5EZYF 4PZEA 3C24A 2Z02A 1SB8A 5TLSA 3NGXA 5L9AA 2G76A 4OJNA 2HJWA 5I9LA 3OQ6A 4DPLA 4OAQA 1Y7TA 4KQWA 4DL9A 3WYEA 3EC7A 4IM7A 1JKJB 3A1NA 1LLDA 1L7EA 2BGLA 2GN6A 5JBIA 4RJTA 1T2AA 2A4KA 5HA5A 3JQFA 1WNTA 4JIGA 2PGDA 3NX4A 2BF7A 4ZVVA 3NT2A 1H0KA 4PG8A 3AOEC 1GQ2A 3HO8A 1IULA 2F1KA 3V2HA 1Y9AA 4FIZA 3WFJA 2IRWA 1I0ZA 2UUPA 3MJEA 3WJ7A 2QQ5A 2JHGA 1DRUA 3JQAB 1PGJA 3I9MA 1Z73A 2YS7A 1PU2A 2P0AA 1QXSA 3RWBA 3BHJA 5FFFA 3GLKA 4HFNA 3I9LA 4PIVA 5KVSA 4OXNA 5COQA 1X1EA 3VVBA 3F4LA 3LC2O 2JJYA 4WE3A 2XXBA 3ZNPA 3K5HA 1KETA 4YJFB 4TV8F 2XF8A 1F8FA 1J6UA 2VYNA 2ZDGA 1Q1NA 4I9UA 1LJ8A 4QSMA 3HHPA 3ZWBA 4R41A 4FS3A 3TWOA 2OORA 1HRDA 4IJWA 3RUAA 1ISJA 4M9UA 3IDSA 3KB6A 3PDUA 1UXKA 1HZJA 1UDAA 2BI8A 2IDZA 1N92A 4XYLB 3Q2KA 3F6YA 4GAEA 4OGWA 1SCUB 3PQDA 3HE3A 5JE8A 1MP0A 3KSZO 2Z95A 2WYVA 3RSHA 1YQDA 3OIFA 5DP1A 3ZI0A 4MKZA 3CSDA 4XR9A 2A9FA 3KAKA 2WMDA 3RCBA 3JCZA 1E92A 3GEGA 3B1JA 4UUPA 3BTSA 4ZQBA 4K28A 4NK5A 1A71A 4J49A 4HR7A 1ISGA 4B8WA 4BV9A 1TT5A 1AUVA 4QFCA 1Q2XA 4J1QA 3RUDA 3VZSA 3ZU3A 1B14A 1YJQA 1I36A 3P7MA 4BOYA 4CL8A 3H6KA 5FWNA 1DC6A 3UCXA 4J43A 5I9MA 1W73A 4UAGA 2TMGA 2PZJA 4NH4A 3WBFA 5JO9A 1K5HA 3AW8A 3FSRA 1ZK0A 4HUJA 4DPKA 1O94A 3VDQA 4MA0A 3WTBA 4O4LF 1KJQA 1YS4A 1JDJA 2Y0EA 1EVZA 5CFZA 3G79A 3PDJA 4W99A 3ENKA 5T6BA 1U8XX 4PRLA 5DBGA 5A5EA 4Z9FA 2O2SA 3GDGA 2NTNA 3ZNOA 1KVTA 2JCYA 3H65A 4AJ4A 2FR1A 1PZGA 2C54A 4MVJF 2X9VA 2VUUA 3S2IA 3BAZA 2D5CA 5C8YF 3ZCXA 1B3RA 4OXYA 1ULUA 1E4EA 2CDBA 4NR0A 3NGLA 5HM8A 4B4UA 4OMUA 3TSCA 1UXIA 1EUZA 1UZNA 2CY0A 1R4NB 2IODA 2HGSA 5H80A 4WLOA 4GKBA 4Y6RA 5K9ZA 4FR5A 1NQAO 3IL2A 2X23A 2TMDA 4O7TA 4R69A 2ZATA 2FY8A 2WYOA 1A9ZA 4UVDA 5BSGA 1WVGA 4DQVA 4IGFA 1MB4A 1Y8RB 3ETJA 3K3PA 3FNEA 2GERA 5L3ZA 2CFCA 4HFJA 4FFLA 4DVJA 1JKJA 3AI1A 3NJ8A 4EYEA 4WCFA 1XIVA 2ZJ0A 4AJIA 3GPIA 2HRBA 5FF9A 4NI5A 3E5NA 1GV1A 1RPNA 1X0VA 1HEUA 2NQ8A 4PGFA 4XYBA 3S55A 4YAGA 3FR7A 1NR7A 1HDXA 1YGYA 2YFHA 3BMQB 4J4TA 1WP4A 1Y8QB 2ET6A 4TQGA 1Q0LA 1N1GA 3UVEA 2W6ZA 2C59A 1QORA 2P5YA 5BNFA 3JQAA 4AJ2A 1IL0A 1AHIA 1M6WA 1Z74A 3PGXA 2YV1A 1GY8A 1MUUA 3X2FA 5LP6F 2CDCA 1MX3A 4TRNA 4YAIA 1SZJG 3Q11A 3N8DA 4UULA 4DLLA 4IQGA 4RVFA 5CA0F 5A9SB 5DMXA 3R9RA 1M6VA 4IDEA 4IJKA 2GPWA 4J9UE 1E7WA 3U4CA 4R68A 5HBRB 4HNHA 3O4RA 2FB9A 3BMCB 4K1LA 1DLIA 3QWAA 4EW6A 1H93A 3D3WB 3JQGB 2NU6A 4XB2A 4AJ1A 3JQ7B 1LX6A 1N1EA 1LI4A 2PTGA 3WWYA 2Y1OA 4BL5A 1E7QA 2J5RA 4DQXA 2PR2A 5DN9A 4I5GA 1R4MB 4E2YA 2BI7A 5JC8A 1T4BA 2DBZA 2FMUA 4BNNA 5DOVA 1DFIA 4O4HF 2DVMA 4R51A 5A5FA 1BSVA 5JDCA 1HDYA 4BNGA 1GV0A 1Z2OX 3RFXA 4CMGA 2P4QA 4K26A 5AOVA 2GQRA 3LWBA 3Q1KA 1ENOA 2RH4A 5IN5A 4HV4A 2O50A 1ISFA 1P1KA 4FFMA 1GFSA 3C7DB 4XQ9A 3ZW8A 2PVPA 3W4KA 1AE1A 4R3WA 1R0LA 2O7SA 2PA3A 1ZK3A 3G8DA 3KO8A 1QLHA 4E5YA 4MVJG 2HMUA 1DOHA 2QZZA 3VKUA 4ZD6A 3IUPA 1QRRA 3B20A 4ESOA 4CR7A 4FDAA 2DWCA 4F45A 2X22A 3QVOA 4ALJA 3JQ6A 4OHUA 5IJZA 4TV9F 1XG5A 4WEQA 2W6PA 4XCVA 1P1FA 1ARZA 1V3UA 1WXDA 5ES3A 4YWJA 5C37A 1EZ4A 4PLFA 4L4RA 4NBUA 5CPFA 4B3IA 2YFQA 5ER9A 5JC1A 3W8FA 2PN1A 3PHHA 4YR9A 5A02A 3D4NA 1P1JA 1WDLA 3RV3A 2R85A 1FDSA 4MKRA 1M75A 2GYYA 2ZTVA 4GL4A 3O9ZA 4CM9A 4DWVA 5BT9A 2OHXA 1NFFA 3KEOA 1OC4A 4ND4A 3FN4A 1BDBA 3FNHA 2YHUA 1A4UA 4YACA 2J3IA 5A3VA 1N9GB 2GPTA 4YTEA 4BNXA 1KVRA 2UYYA 3KUXA 4J16A 4EEXA 3H3FA 1PK8A 3I52A 3S2EA 4OXKA 5C1OA 1D1TA 4BNFA 5T5QA 1T2CA 1EUDB 4PG4A 1DAOA 1B6SA 2B37A 1GZ3A 5KX5F 3CEAA 2QHXA 2AHRA 1KIFA 3E5MA 4FQ8A 3ZNNA 3AM4A 2HQ1A 1JWAB 1RJWA 2Q45A 3GR6A 3KTDA 2D59A 4PLWA 1YQXA 4XWYA 4ALKA 1L7DA 4JJIA 5KWEA 1HE5A 2BD0A 3UCFA 4BQPA 3DHNA 1QP8A 4KMSA 2I6TA 1YB4A 4L8VA 3WMXA 4IZIA 3BMQA 2YWVA 2D2IA 1Y8QA 3N74A 4YQZA 5JAMA 1ZXLA 4DA9A 1I2BA 2O4CA 4O7WA 1JVSA 2FRDA 3PLNA 1L1FA 4WLVA 3E9MA 4BMVA 4YJHB 5TF4A 5TS3A 2A92A 5IF3A 1DO8A 2R87A 2DTXA 3DOOA 4P8RA 3TPCA 2I3AA 3AU8A 1H6CA 3JYOA 2GR9A 3VZQA 3VPSA 2NVUB 3B1KA 4TVBA 1PZFA 2X0JA 5KJ1A 2X8LA 4R54A 2JAHA 2DLDA 2EKLA 5TSDA 3INRA 1C0PA 3GK3A 4O5OA 2Y93A 4DGSA 1DIHA 1TB4A 1T1SA 1NHGA 5T67A 3R6DA 4PFJA 3ZV3A 3PYLA 3KALA 4ZICA 3JQ7A 3ZWXA 3NJ4A 4BO9A 4M55A 3NUAA 2UAGA 3O8QA 5TX7A 1WZEA 1FDWA 4WBNF 1E3WB 4EGJA 2EIHA 3EUWA 5F1PA 4E3ZA 3U62A 4B4WA 5F3RA 2B5WA 5JSFA 2D0IA 3E9QA 2IEDA 2HK9A 1U3UA 5BPHA 4NBRA 1E7MA 5I7SA 4LRSB 3SLGA 3F47A 1JDEA 3VTFA 3IMFA 1LA2A 1T25A 3LQFA 2CZCA 2LDXA 3PGJA 1IHXA 4NJMA 3GZNA 5H82A 3WOHA 4GPD1 5LC1A 4CM5A 1Q0QA 3B1FA 4NYEA 2YHIB 4K6FA 4OQZA 1UZLA 1X14A 1W96A 4A7PA 3BMOA 1PQPA 3PLRA 3ORQA 1GADO 2YYYA 2EG9A 1VM6A 4E2ZA 1Z7EA 5FI3A 3LSYA 2VZ0A 3QVWA 2PNFA 9LDTA 5ITWA 4CMKA 5FEUA 2Q50A 2YZMA 4M8SA 4MV7A 2Q49A 4BGVA 4GLOA 4N5NA 4PZDA 2W6MA 4B8ZA 3M2PA 5AYVA 4FC7A 4R1SA 4PVDA 5CAEB 3H3JA 3G49A 4GX5A 5G0UA 4BNWA 2CMDA 4Z0TA 3ON5A 3QVTA 4OYRA 1EQUA 1IY8A 1K2WA 1NYTA 3E18A 1H2BA 3UAGA 4KTVE 4XD2A 2YRXA 3JD2A 4WGGA 2HK8A 2QZ9A 4Z9YA 2HK7A 2XOXA 3WTCA 2AEMA 4CQLB 5JAIA 3RAJA 2B4QA 1O89A 1X15A 1MA0A 1I3MA 2AEFA 4FFPA 3PQFA 3V8BA 3H5NA 5BR7A 3GMDA 5JMWA 5JVDF 3A14A 1ZEMA 3ZWMA 1LDGA 4LW8A 1KOLA 1EUDA 1ZO8A 4LCEA 3VMMA 2X4GA 2PLAA 4J91A 3MJCA 3WQQA 4RO0A 2FZEA 1ZXBA 3ZWYA 1CQIB 1YDEA 4CMEC 3C1TA 5LXTF 3PYXA 1EVJA 3VVCA 4B7CA 1UXJA 3EDMA 1YONA 3LVFO 4ID9A 5DT9A 1EZ1A 2X6TA 1ONNA 4N7RA 4BNIA 4BKPA 5ENVA 5HRUA 2BFPA 3TZCA 1E5LA 4O6VA 1CYDA 3VPXA 1GZ6A 1TEHA 2JHFA 4YJDA 1UXGA 4BNHA 1ONPA 1KJJA 4JBHA 3NTRA 4RLHA 3U55A 1N7GA 1KJ9A 1R12A 2CVZA 5G4KB 6LDHA 5IXSA 3FNFA 4CL3A 1HDOA 1M2WA 3WYBA 4BO8A 3K30A 4AL4A 3MJ4A 4R9SA 2J5QA 4IBOA 4DYVA 1C0LA 5C7OO 1DAPA 4MO2A 1EE9A 2I80A 3WGTA 3LP8A 3WIDA 5IDQA 1Z82A 2HLPA 2IZ0A 2W2KB 4M87A 4CLOB 1VL0A 2BFAA 2JFGA 3F4BA 3MWEB 3ABIA 5U4QA 2V5AA 2FPGB 1YL6A 2QIOA 4KOAA 5HS6A 4H16A 4CLRB 3OQBA 1DIBA 4FOOA 1FDTA 3RC9A 2VYND 5COBA 1P1HA 1RM0A 4NDNE 2NNLD 4FFRA 3GQVA 5U9CA 1QYXA 5C7LO 4MIEA 1TXGA 1A5ZA 2ZYAA 4FC6A 3KREA 4TVOA 1AUXA 1GU7A 4PLGA 3JYNA 4RVDA 3K5IA 1GSAA 4J2OA 4CMJA 3NV9A 2RH8A 3I9JA 1X0XA 3V4ZA 2ZTLA 3NUGA 3U54A 1UP4A 4HX5A 4J6FA 3MZ0A 1GR0A 4BHTA 3WGIA 1IE3A 1PTJA 4LRTB 1T2FA 3QSGA 1QMGA 5LYJF 1KEWA 3ZU2A 1GLVA 4BNUA 5BNTA 1HETA 2FPIB 1NPTO 1LDNA 1KY4A 2EW8A 3ZHBA 5JCXA 1VE9A 4CM8A 3OIGA 3HUDA 3WR5A 2XCLA 1NFRA 1QLJA 4QTZA 5CDGA 3UOGA 4H3VA 1AXEA 1H9AA 4NFSA 3N58A 3A06A 4KUGA 3F1KA 1PJCA 2I5PO 3KYBA 3VPBA 1SPXA 2E48A 4CM7A 5KVCA 3AY7A 2DU8A 3SC6A 2PD4A 2YY7A 2I87A 3LYLA 5U1PA 3WGYA 4MOWA 1YVEI 3QIVA 3BHMA 3NTOA 4C5CA 5CAEA 2AG8A 1BXGB 7ADHA 4R01A 1F12A 2JL1A 3PHGA 4WLEA 3V4SA 3DZHA 2IP4A 1P74A 1IZ9A 4BGUA 2CNQA 1IYZA 5L4NA 3TN7A 3BMNB 4YQYA 3OICA 2CNVA 2V6GA 5A9RA 4ZN6A 1R6DA 2NU8A 5IZCC 2C29D 3ETDA 3G1TA 4RDHA 1HL3A 3COSA 3MJFA 4RDIA 1JAYA 3JSAA 2JD1A 1N7HA 1C14A 1V0JA 1JLLA 3OA0A 4GMGA 4ZOLF 3RUIA 2WEKA 4RPGA 4DC0A 1BW9A 1GDHA 3AX6A 1C1XA 3Q1LA 3ONDA 1E1KA 3H9UA 4FCCA 3WX0A 4CQMB 4ME6A 1KJ8A 3CE6A 2NVBA 4J3FA 5GMOA 4IINA 2QRKA 4YRBA 1LLCA 3I6QA 3JQBC 1GQQA 3PWKA 4A03A 3OEWA 2Y1GA 4P4LA 1LSJA 1TA4A 1XSEA 1HTBA 3PRJA 2UVDA 4ZHSA 1I5RA 2HMWA 4LVUA 4HBGA 2VYVA 3JRXA 3U4HA 2IYOA 3ULKA 2NQTA 2WWRA 2QX7A 1DIAA 4QQRA 4WASA 1JVBA 2I65A 3F5QA 4QT0A 3KYCB 3GZ4A 4CMBA 3WQRA 4BMSA 1O5IA 5G4KA 4D41A 2NTJA 1P3DA 1HKUA 4PLZA 4QEDA 2DZDA 4PZCA 2Y1CA 1PX2A 2JCXA 5CDYA 1LLQA 3JQAD 3KM0A 3VA7A 4D43A 4O84A 2ZQYA 4XDYA 4BIIA 1LDMA 4HNGA 4AJKA 1Y6JA 2W2KA 4XKJA 2YV3A 4AFNA 3LDHA 4CLOA 4FOSA 5L7TA 4DUPA 2FPGA 2Y68A 3ANNA 4BNZA 1ZZEA 1Z45A 2AQ8A 4DLAA 2ZQZA 3PVZA 4FU0A 1M0TA 4RVSA 4EI2A 3OBBA 1NXQA 2O3TA 5CHEA 1CS0A 3WO1A 3EY4A 3I83A 4LMPA 4CV0A 4MIOA 2ZK7A 3GVXA 4ILKA 4JLWA 3GEMA 1G1AA 1YOVB 2GZ2A 3E9NA 3L07A 3FRJA 3ONFA 4TRJA 3WICA 2QK4A 2BFOA 3S2GA 3TZ6A 1MG0A 4RPJA 3W4JA 5L4LA 1PR3A 1DIKA 4DIMA 2ZDHA 1LSOA 2PWZA 4TKLA 3JQFC 1GEEA 1W93A 2X0RA 4LK3A 1GUYA 1O9BA 4YAJB 3GAZA 2E37A 4FN4A 2AE2A 4FGWA 5T8KA 1VL8A 5CB4F 4L4SA 3SXPA 3HSKA 2LDBA 3PPIA 5TIIA 1DFGA 3RKRA 3CPSA 5L7WA 2OBNA 3HB4X 4EZBA 4FGSA 4YB8A 1CWUA 4P4NA 3DBRB 3QW2A 3GAFA 3RJ5A 1RM5A 2W6NA 3RBVA 1GEGA 1NPYA 1DC3A 3GDOA 2VZ8A 4J7XA 1HYEA 4OIMA 1U28A 2J3KA 3U5TA 3IAHA 2BGKA 3KRTA 1CE8A 2R00A 3P5SA 4IS3A 1CQJB 3I9NA 4CUKA 1PGQA 4RL6A 3UICA 1YWGO 3ZWNA 1GUFA 1PQUA 2PGJA 5HV6A 4YPOA 3ZWAA 1EBFA 2FSVA 1NHWA 1ULSA 3DB2A 3WIEA 3ETGA 4RF3A 4B3HA 4GKVA 3QVSA 3EAGA 5GZ1A 1E3LA 4KDEA 1LNQA 1ZFNA 3GEDA 3BMNA 3DAPA 5F1KA 2VUTA 1WDKA 1OBGA 3NDRA 4U7WA 5IAAA 3P2OA 1NQOA 1LRKA 3ZWPA 2VNAA 4XGIA 1MXFA 4ZHQF 2G17A 1GQYA 4EG0A 3KOUA 4J1NA 3K6JA 4RCVA 1E6WA 1I24A 1XYGA 2NLOA 4JROA 2EF1A 1TLTA 5G0TA 5I8WA 5KNLA 3AJRA 4JBIA 3CINA 3PHIA 3S8MA 2O3RA 2OP1A 2Q3EA 3RFCA 3X2EA 4CM3A 4EBFA 4Q3EA 3R3SA 3I1JA 1V35A 4CM9D 4QFDA 1QYDA 4WNCA 1A72A 4CMAA 1MFPA 3OUZA 3CIFA 5EN4A 2ZYDA 4J7CA 4Y9DA 4E2WA 1X7DA 3RUPA 3E8XA 2B36A 4YYZA 3GFGA 2DC1A 2E6UX 3K8ZA 5I7EA 2W6OA 2NUAB 3DXFA 4AJEA 1X1TA 3E03A 3N7UA 2CDAA 5CEEA 3K2BA 5F5LA 5KKAA 4YBZB 1CDOA 2H1SA 4CODB 1VLLA 3DL2A 1Q7BA 2V7PA 3PWZA 4NBVA 3E6AA 3V2GA 2DPHA 5B1YA 1TT7A 4GWKA 2GN4A 4FFNA 1NVTA 2OBYA 4TKMA 3L4BA 4XB1A 1SC6A 4MP8A 3KYCA 3HB5X 4GX2A 1GCOA 4JJFA 1JN0A 4IQ0A 3TL2A 4E5NA 1ZEJA 3OF2A 4NG5A 4BNLA 5IN4A 2HJRA 2YZ7A 4IGEA 1IHYA 3EZLA 4I9NA 5G0SA 4IDBA 2EKQA 1DB3A 7MDHA 3H9GA 4ND1A 3SEFA 1ZSVA 2BH9A 3FBTA 3L6DA 2HJSA 3BG5A 4YJ3F 4D46A 2YS6A 3HDJA 4YJGA 4ZRMA 3PJEA 4JNKA 3STHA 4GGPA 1HDZA 3ANLA 4MAMA 1GYRA 4M54A 1OBFO 3GMSA 3QWFA 2BFMA 2FP4B 4TMFA 1DHTA 3LT4A 1YOVA 2O48X 2D8AA 3JQ9A 4WCFC 1PWZA 4JXKA 1DBVO 3DHEA 4R4JA 2C82A 3GVHA 3A28A 3BTVA 1IOWA 3ST7A 1V3TA 3V5NA 2C07A 2JKVA 3G0OA 2R86A 3B70A 3QRWA 4YAJA 2JCVA 1E5QA 3KYDB 1VBGA 1GCUA 2X5JO 2YW9A 1MXHA 1D1SA 5KJCA 4UUMA 3ORRA 3PEFA 3DBRA 4MVJH 1KEEA 1ZW1A 3PFWO 3NTQA 5TC4A 3WWZA 1VBHA 3WMWA 3M1LA 2EGGA 3Q9NA 3H8VA 4WEOA 1E3SA 3JYLA 3TZKA 4EGQA 3F5SA 3VOTA 2ZJ1A 3ZHXA 4RF4A 3HADA 1A4IA 1YRLA 4L75A 4Z0PA 3VHRA 4CR8A 1DXYA 5DDIP 3Q6IA 1HDGO 1ZJYA 3V1UA 3DHYA 3EMKA 4YJFA 2Y0DA 1ENZA 4HY3A 3FI9A 2EW2A 1JDBB 3MEQA 5B12A 4L9RA 1VC2A 3B6ZA 4W9NA 1O0SA 2Y1FA 3JD1A 1R0SA 1MC4A 4I50F 4N54A 1W4ZA 3WB9A 3RFTA 1ULZA 3TIIA 1NWHA 2G5CA 1Y5MA 3LZ6A 2PZMA 1CF2O 1B15A 3O03A 5K6AA 5A05A 1QYVA 4O2AF 3RD5A 3E48A 4MINA 5JDCC 4MVJE 5T64A 2R82A 4FD3A 1I32A 4XYLA 4G81A 4BUCA 1SCUA 3DR3A 3MJSA 1JW9B 4P38A 4XYMB 3ONEA 3GRKA 2HUNA 3DF7A 1XEAA 3WO0A 4I4TF 3FF4A 3U3XA 1U3WA 4I9HA 2POQX 2C5AA 3KETA 4MV4A 2NUAA 2OGUA 3PP8A 4GLLA 4R9RA 4BGEA 2CF5A 2W8ZA 3D5TA 1M76A 2W6QA 1IUKA 4XJTA 4YBZA 2VWPA 4BNTA 1HZZA 3ROPA 1SBYA 2AW5A 3AI2A 4FBGA 4M86A 1XCBA 2X0IA 1B8PA 1G0NA 2XAAA 2B4RO 4YT2A 1HDRA 1GPJA 4AJOA 1VRWA 4CLHA 4PLCA 1GGOA 8LDHA 4G5HA 3ADPA 2YL2A 3ENNA 2Q46A 3OH8A 2Z1NA 3MCVA 3NDIA 2JD2A 1N8KA 1VJTA 5HTOA 4J7UA 4LSMA 2PH5A 1O95A 1PJ2A 2DTDA 2HCTA 2YRWA 1PJSA 2Y05A 2R7MA 2ZIZA 2WD7B 4PLYA 4W82A 4KTTE 2QYSA 1A7AA 3CZMA 3GRPA 1WPQA 3GNTA 1T4DA 5CDSA 1T36A 2PKRA 2UV8A 4J9VA 4IZOA 4L1KA 2BLLA 5G2OA 4YCAA 3DOJA 3WFIA 4EJMA 1HT0A 2EEZA 1YL5A 3QFFA 5JDIA 2BMAA 1J49A 4DIOA 2EP5A 5JYEA 1Q7GA 3GN1A 4URFA 4BQRA 2X0SA 1DJQA 4TSKA 5EQDA 4TWRA 1E3IA 2GLTA 4O82A 1KEVA 2UUOA 3CXRA 1E7RA 3GDFA 4AJJA 1YBMA 4WJZA 4E0BA 1R4NA 4IMRA 3GUCA 4Q39A 5F21A 3ZH2A 3TL3A 2Q1SA 1ZUD1 3C3XA 2Q4EA 6ADHA 1GPDG 9LDBA 1BRMA 5AVOA 4PLVA 2X5KO 2Q1TA 1Y8RA 3W8EA 2WSBA 3HG7A 2FPPB 3QVXA 3LLVA 3OUUA 3KYDA 2A94A 5JCJA 3U4IA 4MPDA 4MDHA 1ZIDA 4RLSA 3QWBA 3LLSA 5EIOA 5LCXA 3FWNA 3VH2A 3GGPA 3AY3A 4HFRA 4U0JA 1PZEA 3HDQA 2ZTUA 3K96A 4IDCA 1AUPA 1SO8A 3PWSA 3UUWA 3G17A 3FPCA 4LN1A 3L0DA 1C3VA 2VZ9A 2VHZA 4D3DA 1U7HA 3PI7A 3PHJA 4NBTA 2YQ4A 5CEFA 2PBZA 3DTYA 4GVLA 4CMHA 1X13A 4O7RA 5JS6A 2WYUA 2NM0A 3TQHA 5JAZA 1CETA 4RV9A 1UAYA 2FN7A 3AUTA 3FPLA 5JAQA 1XKQA 3ZN2A 3JD3A 4L4XA 5JLAA 2QF7A 4BB5A 5JVLA 4ND5A 1B0AA 3E82A 4WNIA 3SBOA 5A9SA 1FJHA 1B7GO 3I9OA 3ZHYA 1B8VA 1ENPA 5JYDA 5HBRA 4H7PA 4AJNA 2X5OA 2A35A 1K6XA 4OQYA 3BMCA 4RZHA 1ISMA 1DC4A 1DPGA 4Z3DA 2CSUA 1R66A 3D3WA 3TFOA 3JQGA 4DYDA 2V6BA 3TFQA 5L4SA 3JQ8B 5EERA 1IZ0A 1M66A 4PG5A 1PL6A 3IKVA 3HB9A 2VHWA 4Y67A 4O7VA 1PJ4A 1ZMOA 3VPHA 5CG2A 1UDBA 2OP0A 3IQDB 3OQ1A 1EVYA 4O7ZA 4TRRA 4IJUA 1ML3A 1R4MA 3OMLA 4OH1A 1KYQA 1M67A 4BNMA 4XYMA 5EINA 5I7FA 3JRWA 4DIBA 2EJVA 3BZUA 3I4FA 4U8GA 5DCUA 5JFOA 3VKVA 2VT2A 2AEJA 2WE8A 4PVCA 2VN8A 1LSUA 3U0BA 4YVFA 2X9GA 1DRVA 2ZB8A 4LSWA 3Q9UA 3SX2A 4MA5A 4DXHA 4K6CA 2GUGA 1RYEA 3UFXB 3KEQA 4MV1A 3WJAA 3S2FA 2C7VA 1J0XO 4UVIA 3DFZA 1Z7BA 1DEHA 1E3JA 1DFHA 3WBBA 1PZHA 4IXWA 2GD1O 1QV7A 4MVJP 2VYVD 1U7TA 4I55F 1U8FO 1K89A 2GO1A 3CKYA 3HDYA 2XXJA 1R15A 1UR5A 2PH3A 2J8ZA 4KWIA 1F06A 1LUAA 1UP7A 3Q2IA 4NMHA 3OJ0A 2WD7A 3DEYX 2OO5A 1I3LA 5MGBA 4O7YA 1PR9A 1CERA 4HXYA
chains in the Genus database with same CATH superfamily
4UUOA 1LJLA 3ZGLA 4OM8A 5LQRA 2GYVA 2ZIXA 3BWDD 1BVRA 4NHEA 5AM2A 4DV6B 1JKFA 1YKFA 3LSTA 3KWLA 3ABOB 3QUBA 2BFFA 2J9YB 3DF9A 4P80A 4KP7A 5FBWB 4D8UA 3I9V6 3NFRA 1DSSG 1Y9EA 3AR2A 2RHBA 3DKIA 1BH2A 4IY1A 4R5HA 5DM70 2AZMA 3DWFA 3PPXA 4RABA 1QV6A 3K9QO 3V1NA 4YMVA 2G80A 2OHVA 2VXYA 5BWOA 3KVOA 4MW7A 2YQ5A 3MLAA 4D9CA 3BXPA 4EJ6A 1HE3A 4CCSA 3B78A 1PUIA 3HCBA 3GFBA 4DNOA 4YFVA 2OK7A 3T35A 1KXJA 4WIAA 4AG3A 3EHEA 3QUSA 1EVKA 1CHDA 3EIWA 3OCVA 2XWJI 1LK7A 4Q34A 1KZ9A 4QUAA 4ALMA 4EY7A 1NNI1 1SHUX 1OD6A 3EYAA 3DMTA 1WTCA 3JZAA 2OOKA 3CH5A 4K9LA 3TX2A 1LNSA 3UV6A 4C7KA 2VR1A 2BN4A 3BA6A 1L5KA 3UCEA 3HKBB 5ENDA 1TECE 2ORED 3TDMA 1B8UA 2WKSA 3GGJA 4LA4A 3QQMA 3FUTA 4GMFA 1BYUA 4DR5B 2Z30A 2Q8QA 2C2YA 4POAA 3GJ3A 1Z06A 3DTTA 4XARA 5ESDA 5ITVA 2DPLA 4RZSA 5DX0A 4KACA 4XYEA 5FLYA 3DDSA 1F3OA 4YCMA 1SZPA 4YXFA 1ADBA 4ENVA 3VTZA 5DLQC 1P91A 2BY4A 1VXOA 3HN2A 3R6GA 4CC6A 4U9UA 4B6PA 4CEIA 1Z6AA 4E12A 4YJHA 1NDQA 1CXZA 2KS6A 1I1QB 3FSGD 4WTOA 2BKAA 3FBGA 5I7AA 4V1CB 1XZ8A 2JVIA 4Q02A 1W29A 3KBOA 4CL0A 3JD4A 1IONA 5KQMA 2JK0A 4ZQFA 3TZBA 1D9XA 1L2TA 1QIEA 2A59A 4ACBA 3QW4B 3AEXA 1DJPA 1EA7A 3WLEA 3EXFB 4CNBA 6REQA 1M2OA 1DTWB 2B2CA 2ZXEA 1NT4A 1XMJA 2I2AA 2YHAA 4U2DA 4YLGA 4FYWA 5B4TA 4UQLA 5ARCA 4MWTA 4G26A 3SQXA 2EF0A 3HBNA 2VQ6A 4UPVA 5AUNB 2HNAA 3V00A 3D3JA 3PHLA 3L6CA 2QJRA 4KFUA 1N0WA 1XV5A 1ZK1A 2I54A 3MMSA 4M49A 1W36D 3EOBI 1QVAA 2AN3A 3CGGA 3KVNA 4QYMA 3SKYA 3ZXUB 2WJAA 2P9FA 4D0RA 3V8NA 1Z62A 1P44A 5DV9A 5EY5B 1GKUB 4ZYYA 3T7CA 1AXGA 2Q1WA 4F4FA 2GK3A 4KQGA 3DONA 2B2NA 3KT0A 4M0PA 1QF9A 1X8KA 1B04A 3QXHA 5AMXA 3RKSA 4Q4AA 1PFGA 1KUTA 2VF7A 3GPBA 2J33A 4D4MA 4Z7OB 3PQEA 3WNDA 3GLIE 3PE3A 1YFJA 1V9LA 2WFZA 1BWSA 3UGTA 4C0WA 4I4NA 2P9BA 4NCJA 4W5JA 3EWNA 5ALZA 1GU0A 1PT5A 1R8XA 4NS1A 4RF2A 4OOEA 1B2LA 1GA1A 1T8PA 1WVIA 2GPYA 3UJ6A 1KK0A 3L84A 5T41A 4NFYA 1T9CA 1F7VA 1M2VA 3L4SO 2XD4A 2FUNB 3DC2A 5E6SB 5B4UA 1PJTA 3IMKA 3VOSA 1U7ZA 3IIKA 1C8BA 2ZJ3A 1E2FA 4RTOA 1EE1A 2P6UA 2NVOA 5B3JC 1YVRA 2PJRA 1CJUC 3KPVA 2CXQA 2X0NA 5EMMA 3VFDA 5CFQA 1AKWA 4DR3B 2IYPA 2ZQ5A 2BOVA 2HMAA 3PRKE 1PLKA 1X87A 3NAQA 4LV6A 1D04A 3DMRA 3OTQA 3HKDA 2YHBA 4MEAA 4NPHA 1XUOA 3ADDA 5FR9A 1V8OA 2GM5A 4R2XA 4XWGA 2XRFA 2EQAA 2BLNA 4NAHA 4ZANA 1QE3A 3R9XA 1XR3A 1E3DA 1A9YA 1SQFA 2C83A 1GAEO 4QJ5A 5KHOC 5BPFA 3BK2A 4UKDA 3E2PA 5FUQA 4F8JA 3HXKA 5EUBA 1SCQA 3QHQA 1UPUA 3IELA 3BF7A 4A8HA 3QXGA 1DV2A 4ZCPA 1B16A 2VQ3A 5EJ8A 3S0JA 1PG2A 3KXPA 5CRIA 4TWIA 3Q0TA 2EKDA 3H5RA 1MR3F 4L8WB 5I48A 3G89A 1E1CA 3D7KA 3T7DA 4EJSC 2CDRA 5C7IO 1Z6TA 4XGNA 1PQYA 1T6NA 3I30X 4I5EA 4CM6A 2PPLA 4CU2A 1EGVB 1QO0A 3ELDA 4UOEA 3HB0A 5ALUA 3CVYA 1TM1E 3AL2A 2JHAA 1M8KA 4LOHA 4OQPA 5FYQA 4OP1A 1OVGA 2C95A 4ITUA 5HR5A 4B8YA 4I08A 1B6RA 1U2PA 3EARA 1QIFA 3PUXA 1V26A 2FYTA 1UM9B 4QFBA 2OILA 5GJCA 3GB8B 5HKKD 4Q9KA 1S96A 3CT6A 4BMNA 2BMFA 2XB6A 2XDQB 3IB6A 4F3TA 5KSOA 4HNUA 2I2XB 5HILA 5C1DA 4CQJA 3ZHSA 1RADA 4QDUA 5JASA 3L0ZA 1KOFA 2J4CA 3OD1A 3Q8WA 4H0NA 2L82A 2YWJA 4URVR 2CBXA 2HCBA 1S2NA 5JAOA 4KNWA 5KUTA 1AQIA 3H4VA 4WADA 3UN1A 5HXAA 2A86A 13PKA 3BBLA 3SYLA 5J2UF 2GZ1A 4G07A 1KJIA 4TTJA 2IV3A 1Z75A 3GPDG 3PNKA 4LVOA 4R5MA 5AO9A 4MAFA 1PS8A 3F7MA 3JZFA 4PZUA 1ZJ4A 3AWDA 1LLFA 1RQNA 2X9QA 1OGYA 1REQB 3A1SA 1GUBA 4ACAA 3LUDA 4JS0A 4TKUA 4EG5A 4QGBA 5FI1B 4MVJA 3SXUA 1T1RA 3Q7PA 3SGLA 4F96A 1HSOA 2JIMA 4S2EA 3VOAA 4MIYA 1ST2A 1E18A 4JJ4A 1AU9A 1ZWLA 4XX1A 5AICA 1EIWA 1DQPA 1QHNA 1TT5B 4RK5A 1V5IA 2BAGA 5DBOA 1XYVA 2FPMA 2H1LA 2ODAA 3ZWOA 1G59A 3A1DA 3H5AA 1XELA 3MWEA 1DP4A 1YDMA 1GQSA 3LUPA 1YULA 1E9BA 2IEYA 2GCEA 4PBTA 4ARUA 4DBZA 1MU0A 5E4JA 4FYVA 1OOEA 2DUUA 2GPJA 4L3WA 3ZPXA 4DDWA 3KDPA 4TSFA 5KX5B 1FZTA 1ABFA 3CONA 2R84A 1G20B 4IDFA 1M34B 2DBRA 4CEJA 1EKVA 3P9NA 4AUNA 2CB9A 3OFKA 1ZHFA 1HOXA 4MP3A 1T9AA 4P7GA 3P4XA 1UC9A 5B1SA 3I37X 4C78A 5FNVF 4YJ2A 2I1VB 2IYEA 1A7UA 3D3EA 1RM3A 3H3XA 4UBNA 4LJ4A 1E61A 1LW6E 2F1IA 4ZO4A 3ZCSA 2IKQA 1Z0SA 2NT3A 3FGPA 4QOFA 5H1YA 2QAGC 1RKQA 3TZQA 4ZCMA 2NYRA 3PN1A 2AFIB 4GQIA 2WU1A 4HK4A 4MKIA 3RC7A 5BV8A 4DR4B 2XMGA 4LE0A 2O23A 2JGMA 3G6KA 2QTHA 4M8NE 2MSNA 2W2MA 3GEBA 3LBAA 3SIXA 3TAXA 4YRZA 4X1YB 1Z63A 1KERA 5K3FB 3EFEA 1XF1A 4JDPA 3WIBA 2YW2A 1BE0A 1XALA 3RIYA 3VR4H 5JS2A 1W25A 2CUKA 3K1AB 3USCS 1XXLA 1CDZA 2PLNA 3A6DA 1QANA 2VUSA 5E7JA 4RD0A 5CK4A 4AQDA 5JS7A 2W6JD 5L6LB 4C0KA 1HQKA 3QLJA 5BNIA 1QDEA 5GJVC 3BD7A 3W1WA 4HAYA 5ESRA 3RVMA 3I45A 3P4YA 1YJBA 1U7UA 2O1SA 2E3JA 3DVAA 4RKWA 4UEWA 4GZ6A 5G1OA 3TW6A 1ISHA 3HP4A 3MFQA 4X1KB 1CUHA 4EI7A 1CYEA 4U00A 5KAPA 3PXXA 3ZBTA 1E7YA 4PFKA 1OAAA 3B3FA 1X7GA 4GVXA 2Q6IA 2Z3VA 3UZUA 5TQ0A 2QUAA 4PC2A 1UOPA 1NTOA 1QVVA 1KEUA 1OHHA 3PC7A 4HGPA 1KDTA 4AG5A 4DLYA 3CN9A 1E9FA 2YXLA 4MQEB 4MGIR 3ROQA 5BYKA 3C5VA 3UAVA 1G8JA 4KQXA 4F46A 2P4EA 2RI0A 2G04A 4P53A 5CX1A 4YMSA 1C3OA 1PX0A 1EEXB 1QHFA 1ZNZA 3B8HA 4F6RA 4DHEA 2HRZA 2XVMA 2R47A 1O0BA 4MQ6A 4RAOA 3DCYA 4JOBA 1X8LA 4INOA 1EUCB 1P5ZB 2H2AA 4WZBB 4ZAVA 2MINB 1HLDA 2XOEA 1E1MA 2YV5A 1YQUA 3RUFA 2JDID 3AP2A 3CBQA 3T7AA 4CC5A 1R74A 3G6WA 3KYIB 4M1YA 2P9GA 2J9GA 2CMHA 5EWMB 2QBYB 2XMBA 4ZT2A 5AW4A 3IMGA 3MOGA 4EA6A 1U3FA 1CY2A 1W49A 1QQAA 4KYIB 4XJVA 4PYLA 5H9VA 4OAPA 4QSHA 3CNLA 4LHEA 4F8EA 4RPCA 5DNUA 2ZJ6A 2HV9A 3NRCA 1F6BA 3KT6A 1FBTA 4J4HA 4JA2A 2P0EA 3DD1A 1RWVA 3BZBA 1OPXA 1YS6A 4RQTA 3AY6A 3IOYA 1G21A 1SQ0A 2XKKA 1PFKA 3RASA 1VIYA 2DQZA 3OLZA 3GUVA 3OOJA 3ITKA 1R64A 3FKSD 3G5MA 1TVEA 4Q37A 1Y3CE 1D2EA 2JIDA 3HLKA 5CXXA 3RODA 4TVSA 3L2OB 4YRJA 4BO4A 3ANTA 2MYUA 1UFVA 3U9SA 1K6IA 1ULBA 4W7SA 4IIHA 1Q3KA 5EIFA 3LF2A 1MFZA 2ZDQA 4O7NA 1COWD 1KP3A 3GHYA 4DMMA 4E07A 2EHDA 2PNJA 3OHSX 3QQPA 2ZM6B 4PSKA 5JYCA 5IFLA 3VC3A 4EITA 2WJJA 3E9ZA 2Q99A 3L4KA 4RV4A 4IZHA 4TUYF 3C16C 1L7MA 1X19A 2B2XA 4URWR 2RHLA 1W59A 1PR6A 1DLJA 3OIYA 3OOEA 2C2BA 1AKVA 1GRQA 2GD2A 1THMA 2ORYA 3DV0B 3FE2A 3P4UA 2FFAA 3P9YA 4UHEA 2Y1LA 1RXCA 4X93A 2K4MA 4ZALA 5G0VA 4EG6A 2YOGA 4UCWA 4DQUA 1P33A 3MTDA 4QOIA 5KSWB 3NEYA 5CVVA 2BGMA 2XHZA 3H7AA 3L49A 3T38A 2G1UA 1LI5A 1VKZA 3AK4A 2ZE6A 5B64A 4ARIA 1KE1A 5LXTB 1EFRD 3KX2A 4MCJA 3SOPA 1Z4PX 1DOZA 1ISRA 2UXDB 4C3ZA 2IU0A 3TPFA 1RYDA 1OBOA 1Y1SA 2VDOB 3LZDA 1QE5A 2EKZA 3P9SA 1KGDA 2X5XA 1EFPA 3EWAA 1VE3A 1TW3A 2W2LA 1RCUA 2GZAA 2I8LA 3K20A 4RVHA 3WGOA 2P1ZA 1G6Q1 3MRSA 1AHHA 2FX2A 2AQIA 2O0HA 4UAUA 4ZCTA 1DCMA 4BMCA 2DYKA 1C9DB 3JATA 3UJ9A 2PQMA 2H16A 4J4BA 3D1LA 3L7KA 3S28A 5J43A 1V3VA 2J3EA 1OWMA 3GT0A 3PFIA 2OXTA 4BFCA 4BMXA 5M2QA 4ZEWA 1Y1LA 3KCNA 4ZEVA 4F71A 1NUPA 2WZCA 4RK4A 3QG1A 2J09A 3UGKA 3D59A 3ZD9A 4CYMA 3T3OA 3QPUA 3RRBA 4BX8A 1NC1A 3GT7A 4C06A 3HFJA 3MILA 2CHVA 2OVFA 1I7PA 5AVJA 2CXOA 4YUZA 4KR9A 2GX6A 3LD9A 1YRWA 1FY2A 2Z9BA 2FI1A 2VP3A 5F3DA 2EJBA 3K9FC 3QBTA 2OHOA 3JASB 3G9XA 3KJEA 3O4FA 3W2EA 2D3TA 3RQSA 4NJEA 4LECA 2AW3A 2VSNA 2WV7A 4LOAA 1L5YA 3PD7A 3EYWA 2B6HA 1CQJA 3ZDYB 1XTKA 3HJAA 3ZHUA 4QNMA 4FNAA 5G0WA 2HYDA 4H1HA 3DYVA 4K46A 3ZDZB 3G23A 2XB2A 1JMKC 3O74A 5JSYA 1OFGA 2NN3C 4KXYA 2XUIA 3LT2A 4KYUA 5SICE 1A9RA 1XCGB 1YE3A 2FWMX 2NUTB 3EHDA 3IVAA 5REQA 1FIUA 4WDRA 2CV2A 3WAKA 1JTEA 4WZ6A 4YY3B 3EJWA 5CX4A 4PQRA 2XQVA 3YASA 5LDDC 1SD2A 5HE8A 5IRCD 3CURA 3EDYA 1XNGA 4U2CA 3ND7A 3WYCA 3KT8A 3PQ2A 3W9UA 4QYXA 4GI2A 2AUNA 4ZIRB 5KYYA 2I9PA 1YS9A 1NRWA 3ZH9B 3R5HA 3W1GA 1L1RA 1XZBA 1LS6A 5LJLA 4BFUA 2RBEA 2XRYA 2BSXA 3DUFB 1SD1A 4ENSA 2ZULA 3GUYA 3OU2A 3OLCX 1Y6FA 2NO5A 3MT8A 1BFUA 2GRJA 4LISA 3IEUA 2CC2A 3UG6A 5JH7F 4CMDA 2ROQA 5MN4A 3AERA 3BPSA 1I8TA 1TC2A 2MDTA 2P7IA 1SKYE 2Q5OA 4JOCA 3S27A 3Q8LA 4HRVA 3O8QB 3I62A 1I7NA 2XE8A 4DEYA 4HSGA 2XE4A 5BRAA 3OQPA 4GX0A 3ZDAA 4QX6A 1NP7A 3VVCA 1RKUA 1L4YA 1T1JA 1UZMA 3NP7A 2GRAA 5JW6A 5KJ1A 1H4QA 3BABA 1H0RA 1JF8A 4FLFA 3VPCA 2PZBA 3EIFA 1YBVA 4W9RA 4ZI7A 2IS1A 1WZIA 2WUDA 3KE9A 3M1IA 3LQ2A 5JJCA 1U2TA 3GC6A 2FOIA 2J4FA 3G0IA 2NV0A 4TTRA 4UM7A 3PNOA 1NKSA 4ZU1X 1DJOA 2L17A 4DBVO 1HH4A 1XDGA 3GZNB 1A9OA 3EOZA 2YN2A 5JDIC 1OBCA 4OJYA 3DOUA 2OL4A 1C9JA 4CKCA 5ILGA 5DE3A 4NARA 1E9SA 5DRYA 4CTNA 3BACA 4PF1A 4FLMA 4LE1A 5AI9A 3KKQA 3HYCA 4CEHB 1A2BA 1N2CE 1U0GA 3EVAA 3ZV6A 3I09A 4D45A 2IYUA 4ETMA 4I8XA 5KCZA 1Z0UA 1KTIA 4ZGBA 2LUOA 1FDIA 4L2IB 1W0JA 1XA3A 1RYZA 3G3EA 3CVJA 2C9YA 3GFQA 4N82A 4TT3D 3USZA 1T2EA 5EJ9A 2DUWA 1HQDA 2PK3A 4O3FA 4YRFA 1LPSA 1YR7A 4OKSA 4S1TA 1DIRA 3RVDA 4AVYA 5CVUA 4BZZA 4EI9A 3GCGA 5TB5A 4O4JF 3R7LA 3TJZA 3PUIA 4RPKA 1IWOA 3HCFA 4WK0B 4QYSA 1FXSA 1R37A 3H8WA 4N0EA 2BHNA 3UMSA 4DSTA 5JATA 1EHIA 3VU0A 4LKRA 1KYYA 1U9YA 4GPTA 5LZ8A 4KHPB 2G82A 1TADA 2A0FA 1QR6A 3FR8A 3NEPX 4JLJA 2EFYA 3S2ZA 4DUYB 2VHCA 4FNMA 4HQ0A 3TZHA 3IPAA 1CRPA 4UCSA 3WL6A 4Z9XA 4RHTA 3UMBA 4JLNA 1H3EA 3LY9A 4HWGA 3TRHA 1IVNA 1RWKA 4OJMX 4QHTA 3ZV7A 2XMSA 3R44A 3C8HA 1TQ4A 1AKUA 1NYLA 4R0VA 2ZE7A 1EWRA 4PPYA 1NUUA 3FWKA 4JP3A 1U7XA 1BKDR 3FYUA 3E84A 4JQCA 4DNQA 4BN5A 1R6XA 5K6TA 4G8BA 2HMSA 4KO1S 3C3BA 3OJOA 2A6PA 1KP9A 1X92A 5F2KA 4JQOA 1JECA 2EXXA 2HMYB 1DBPA 2IZ6A 4MJLA 3ER6A 2ZRIA 3CUKA 1XZJA 4B47A 5C81A 2Z5GA 4M38A 5D85A 2WTUA 3SZMA 4GR5A 5EKSA 1RRFA 2VFAA 1T0IA 2YZ2A 2BM8A 4CG2A 4JCCA 2QW0X 1CJCA 1XVTA 5JY1A 5K8LA 4Z4QA 1JQBA 1SC9A 4MWDA 3TNLA 1Z39A 1NQTA 1TMKA 2QLLA 1U0NA 1Z7WA 1K6JA 3C85A 3EMBA 2A3NA 1I2LA 1R8QA 3O3NB 4RE5A 1U6IA 2BUAA 5FUYA 1JTFA 1QRSA 5A4FS 1QS0B 1UWVA 1VKNA 1E1RA 2ISSD 5C1PA 3GRVA 5BVGA 3UT5A 1NVDA 1SA0A 2ZE8A 3ITDA 5FFNA 4BKQA 1H0SA 3OZGA 1WF3A 4IIDA 4NDAA 2O5EA 4IIUA 2IPLA 2FQXA 3TOXA 3VPFA 2GK4A 2DQKA 1SRRA 4ITVA 4G65A 4WFKA 4CM4A 4C4OA 1EFUA 4RQAA 2HDHA 5FTLA 1L7XA 4RGBA 1EUYA 2ZB3A 4QU8A 2XRMA 1GD1O 1PNRA 3P2KA 3MJVA 4K6GA 3EF1A 3PGMA 4G9GA 4TOIA 3R9IA 3HVRA 1E1LA 1QH9A 1EDOA 4DUGD 4Z6KA 1JB9A 1DADA 4NU8X 1DTSA 4B9AA 1PJLA 1TEVA 3HN7A 1BCRB 2NU7B 3V33A 3A2LA 5CXQA 2IA5A 5KYVA 4Q1EA 3DLHA 1L5HA 4EEZA 4HWKA 2AQHA 2VUGA 5K2MA 1VPDA 1YI1A 2VRBA 1XF9A 3DT9A 3ESYA 1N57A 1XMOB 4CKZA 4ZV4A 4KMMA 3P32A 5DULA 3NBYB 2Z57A 5EIXA 1N0VC 2EV9A 4GI7A 4O83A 5K2OA 1GL9B 2JLBA 2ZWVA 3V48A 4OQNA 4QWMA 5TMBA 5C4IA 2CMGA 2UZAA 1Z9BA 2GPSA 1YMUA 2JAUA 2XUDA 5LZ5A 3ND8A 1G7RA 3DV9A 5HKAA 5KU1A 5I9TA 1Y9ZA 2CNBA 2HHLA 4MS1A 4BNDA 5I6DA 3EG9B 3EJ6A 3OP4A 1H69A 2O2IA 4JEMA 4Q1CA 5EWLB 4XTRA 2P9EA 3LHSA 1Z5ZA 1Z2NX 3ETEA 2GXUA 1A77A 5SY4A 4N47A 5AK3A 1YQQA 4LJSA 1FTSA 2IXFA 4PCAA 1H1LA 1AK9A 1H4VB 5FDFA 5IT9A 2O3QA 8MHTA 3PZRA 1WXIA 3GHHA 2VBFA 1W94A 5FPQA 5KHAA 2CVPA 1E6CA 1NI3A 2IEIA 3IAFA 3E9CA 3C3PA 1ZICA 2XPCA 4ZOLA 3BA8A 4AZ3A 2ZU6A 4TZTA 4FM9A 2VNSA 1NXWA 1OLOA 2AK3A 4ABYA 5I3CA 4TM5A 2PX5A 4L07A 4YT4A 4MV8A 2DAPA 3KS9A 2PZ8A 3D7RA 1RYMA 1YACA 3C6BA 5C8VA 3GLVA 3SLKA 4V1CI 2W2PA 1VE7A 3DFIA 3ZZNA 3UKJA 7MHTA 1ZBQA 5DZSA 2WILA 2JLZA 3DEZA 1YI8A 1Q1EA 5J3JA 1TEZA 2ZSIA 3IO5A 2PUBA 4J0JA 2RH5A 1EK5A 3D6TB 3E1SA 3L7LA 1PFUA 3LY8A 3L8DA 1GGEA 3ONVA 2WIGA 3PD0A 1AG9A 1RWBA 3PICA 4RY2A 1WOYA 5B1DA 4ZQEA 5IDWA 1J9EA 1NX9A 3FOFC 3FTEA 1GARA 2AQKA 3A2MA 2IP1A 1UXOA 2WD8A 1R16A 3GX1A 1G7SA 1NFQA 1RZUA 2EJWA 3B6KA 4DMFA 5T57A 5IJ9A 3GL9A 4TWZA 5DYGA 4US1R 1DOAA 3LT0A 3DE4X 1UOEA 2F90A 4UM5A 4AJHA 2ZANA 1EDZA 1U4NA 3LU1A 3QJGA 4PN7A 4NICA 1SBTA 4CLDA 1VSUA 2Q7OE 5L51A 4DANA 3RFVA 5K8VA 1OMOA 4EM6A 2CF6A 4QXQA 1GNVA 3A9VA 3UTDA 5ADHA 4CKEA 4CIXA 2XZLA 1O9GA 2J3LA 3HPRA 4XGKA 3OPQA 4E51A 2D6FA 3EQ7A 2ZIVB 4KW7A 1K9SA 1UBTS 3DXXA 4WT7A 1QO9A 3GFOA 1U6JA 2C9MA 3KC2A 4URYR 3T4PA 3VR3D 4YDQA 4MTCA 4NBWA 1IJEA 3E4DA 3D8SA 2HA4A 1VCOA 1WXHA 3KQOA 2DERA 1EZZA 3ER9A 1E0DA 4E4TA 2VSOA 3EGXB 4P7FA 4D0NA 2FWPA 1P1IA 3L1UA 3PB3A 4B32A 2OQIA 2FMXA 4MRAA 3NYWA 3GELA 2CNLA 1AA9A 1QK3A 2P5SA 5DBFA 4PS1A 1TK3A 2N3ZA 3V4RA 4OKNA 4LH6A 2DWOA 1UH5A 2ZWOA 1F0NA 2PU5A 3PGVA 1UQUA 2PUDA 3PF8A 4H9GA 5BUCA 1C1DA 3EISA 1B8OA 1LZKA 1NVMB 3THWA 4KXFB 2RI6A 1CY1A 4ZVKA 2FPXA 3ZGNA 1CUZA 4Q3CA 2EW1A 1Z0AA 4RGYA 3DAFA 3TI7A 1LC0A 1ZK4A 1FP7A 2I6GA 2O3JA 3FMFA 3JARB 4TTPA 1IXZA 4DZTA 2CVOA 3GBPA 4X60A 4ARCA 1K7FB 1J24A 1NOKA 2HR1A 1D7OA 1BWQA 1PW7A 1XJ5A 2DFTA 3Q3HA 4Q0MA 5M04A 1MPXA 3DCNA 4TGLA 1CEQA 2OYRA 4MQ5A 4R3UC 4CLEA 3VR1A 4XWOA 2E4VA 1DEOA 4E30A 2V5VA 2VSYA 3K9NA 5SYMA 2AI3A 4BX9A 3TLMA 2V1UA 9GPBA 3AUSA 4Q16A 4XFDA 4Z8YA 5EG5A 1G66A 1VMIA 3W4IA 5KJFA 4DCVA 4AY5A 1MEOA 1GPKA 3JQDA 4BAGA 3E1KA 1F8YA 5HX7A 2WYHA 3N2YA 2RGWA 3D6MA 4TV8A 3WKCA 5DXFA 5CA0B 2AZXA 4LC0A 1W0CA 4NCAA 1R7RA 2SECE 3RS3A 2EJUA 4ZRNA 1PGNA 1HF3A 4PGAA 1HR0B 1KY2A 3GIDA 4X8LA 1FFGA 4EPTA 4CN8A 1YH3A 3WDSA 2W70A 1FFBA 4JX9A 3DVSX 1XTVA 2R751 5GONF 1V9CA 1BWPA 4MMYB 5EJMA 5DF1A 4ZI3A 3MXTA 5DEIA 2C99A 2PKEA 1EWTA 1U90A 1M8GA 4XGRA 5FWYA 3A05A 1GLNA 3A2NA 1BGXT 3IKTA 1OBHA 4FJ0A 1CR2A 1OTYA 3AJAA 4P1ZA 1JSZA 3K94A 3I6MA 1LBIA 2DJIA 2Q0HA 1PJBA 2A57A 4QUJA 2JFNA 1WF6A 4XPZA 3U16A 3UUFA 4M1WA 2V0CA 1G17A 4W8GA 4BFTA 5THKA 5LDGA 4R2HA 4B73A 2QORA 2Q9BA 1M2FA 3AIOA 4EY6A 1GTJ1 1L7VC 1V16A 2RJNA 4P22A 1L7BA 3FCXA 4DCUA 3PPVA 1GNTA 2CLIB 5IABA 1H65A 2GN2A 5D3MB 1XA4A 3ZE0B 4DV7B 1AGYA 2H1FA 4Z0HO 1MTOA 4A5OA 4ZEXA 1JHAA 4BVJA 5IEBA 1XD8A 5ALNA 4P81A 2GVDC 3EZYA 3GGGA 4E7OA 3GJSA 4P4GA 2Y9PB 3RUEA 2ZYGA 5DNWA 5J5VA 3ROKA 3K9LA 2C1XA 3LA8A 4EMTA 4HYQA 1JEOA 5K4HA 1ZMXA 4G0UA 3EFOB 1JBEA 4HHEA 4YCLA 4ZDJA 1J0BA 1HA3A 4K9MA 2ZJAA 3DZIA 4GOKA 3R75A 3E7DA 3I05A 4KE6A 1YBFA 3LTEA 1HSZA 2O05A 4DCOA 1ZC4A 2NP6A 3DD5A 2VZLA 3PQ3A 2ZIAA 1H85A 4GUAA 3VYRB 3WWEA 2XUPA 3DT8A 4BVLA 8ABPA 1P9LA 2HB6A 2WJIA 2NVWA 4R9UC 2NU9A 2D7CA 1EDDA 2E21A 1WDMA 2W0SA 2EBUA 1YB1A 5CDTA 3R3VA 1WMBA 3IQWA 5LZ4A 1IBKB 3EVCA 2DECA 3PCXA 3ZHOA 3L8GA 2ABWA 4JVLA 3WNQA 2WD9A 3O31A 1ENYA 3DZJA 4HNAA 4IOLA 1CKOA 1Q95A 3QEKA 3KLPX 4NU6A 2I4NA 1W44A 4MGHA 2DIKA 5C53B 2QV7A 4ZK2A 2NO9A 1P3Y1 4ALIA 4KITB 3LUBA 2XA1A 3BXXA 3UHFA 4ZEMA 4NZMA 4RTNA 3BWYA 5EXDA 3GA7A 3L7NA 4LHSA 5BN3B 5BO5A 2ZYUX 4DLBA 4ES6A 1FBNA 3FJOA 4U2BA 4O4IF 3JQBA 1IYDA 2Q5IA 3LF1A 2OGSA 4WXRA 4JC8A 4DRXB 1Y98A 1I0LA 1YJ5A 2QNRA 1SU4A 1LW7A 1QOZA 1JPUA 3AVPA 1T2NA 4FGKA 4EB6A 1UDXA 2H7XA 5A4JA 4DXAA 3BWCA 2UZ0A 3WV5A 4EVRA 3BCHA 5DCWA 5F7XA 3JZIA 4K9DA 5K3DA 2JRCA 3IH5A 4LMRA 2P62A 4N03A 4XX0A 3QF4B 1TJNA 4K9SA 2WLTA 1FVOA 3SEZA 3N2LA 1MABB 4YHHB 4M7RA 3N1UA 2X86A 2GDJA 2EZ9A 3NT5A 1O96B 5BWTA 1Q1QA 1SOMA 2E1RA 4X97A 4H4DA 5EMHA 1EQAA 3W34A 3QE4A 1AQJA 4GI3A 4YAKA 1IPFA 1CNFA 3OQVA 1VBFA 3FNGA 1I7LA 1P2TA 1P77A 2GA8A 1G5RA 1XU9A 3ANSA 4MLDA 2BELA 1UM8A 4X00A 4CF6A 1OT3A 4Q03A 3BORA 4LZAA 2QRJA 3SK0A 2G7MC 3M9XA 4Q1FA 4D9GA 5FBLB 2PFGA 4X66B 5FOSA 1FU8A 2ZPUA 1SKBA 1VL6A 3BFXA 3ESZA 4M0UA 1HK7A 4PYQA 2F17A 5AI4A 5EIWA 1OFIA 3HN6A 5FUXA 4DV2B 4I2VA 4RVUA 1GTG1 4DAOA 3H75A 2GPAA 3COPA 1UQRA 2BEUB 2WZDA 5ER6A 1LTQA 5B2FA 5AW6A 2WUVA 3VNAA 4B7AA 5LVAA 3QZUA 5LP6A 3RIXA 4CCYA 3KTAA 4UHDA 1DAAA 4GKKB 1XZCA 4JQSA 4KWEA 1Z22A 4C3UA 3EXEB 4O5AA 1CFZA 1AQNA 2WMYA 1DWOA 1K5GA 4R2MA 4NC9A 3RYTC 3AHJA 5JXIA 4MVCA 5A6SB 3BD6A 1FXWA 3GCDA 4RA6A 5HA5A 3MXOA 3FCSB 4GS5A 4OHCA 1IXRC 1TO1E 2XGSA 2H29A 4JIGA 1TZ2A 1GGHA 1Z33A 2V7TA 4WXHA 1F3LA 3AOEC 5CYGA 1GQ2A 3JAWB 5JWOA 1KEEB 2F1KA 2HEGA 3KQTA 1Y9AA 4FIZA 3VISA 4BKUA 2IRWA 5KYGA 1XDZA 3OLXA 1G291 3M5WA 5FAKA 3I9MA 2C5FA 1Z73A 1QXSA 1T6ZA 2P0AA 2A5FA 1KI6B 2PPVA 2ZVJA 5FFFA 4O4HA 3U37A 3JAMA 1G9TA 1MIHA 4I4TA 5BORA 2W48A 3TLYA 2O19A 2G4LA 2JJYA 2JLAA 2VLBA 4IFIA 2XXBA 3AF6A 4IVRA 1RQ7A 2H00A 2XF8A 2YWRA 2HIMA 3GRYA 3PKZA 2ZDGA 4AT1A 4AC9A 3PXGA 1CUSA 4FKBA 4BMOB 2M6SA 1RKBA 1N33B 1IEVA 5KDDA 1G42A 2IS6A 4BLRA 4ZOQI 1B4DA 3DXZA 4YRPA 3KL2A 3LKVA 3TRFA 3ZVRA 2OORA 4W5OA 4IJWA 1Q0UA 1ZL2A 1PYOA 2IGTA 3ROXA 3TQOA 3IDSA 1LVGA 3OEED 4FILA 5BV7A 1A1SA 1UXKA 3RVKA 5K0FA 3CS3A 4I55B 1X1SA 3TYXA 2CBZA 1OB5A 2IDZA 3IAAA 1TKBA 2PHZA 4LX0A 4RGVA 1I4TD 1SCKA 5DNDA 2G0NA 3AKYA 1KKLA 4IO0A 5TVKA 3ODPA 2BKEA 2IKSA 3QX8A 3UJCA 2H0RA 1VIAA 5DP1A 1CUVA 1NVKA 4DMGA 1W4CA 1A3GA 1DX4A 2LV8A 2P90A 5J9FA 2P75A 1YFZA 1OWLA 5GV8A 2WOJA 4FFWA 1E92A 4U7GA 3JX9A 1U0EA 5EXXA 4ZQBA 1SCIA 2W4MA 4QREA 4U7DA 3ROFA 1ISGA 1X9IA 1OI2A 2AFHB 2FOXA 4LPSA 3W3AH 4BV9A 5K0CA 4J1QA 4BLVA 1B14A 4NEGA 3H2IA 4LX8A 4MEBA 4M0EA 4CL8A 4F06A 2POCA 2IEZA 2QN1A 3H6KA 3LC0A 1TAQA 1G5TA 3UKDA 1MX1A 3VR6H 3MOSA 4JKYA 5FR1A 2DHEA 2DPYA 2PA0A 2WJ6A 3N2ZB 5H68A 3WBFA 3BE8A 3Q3IA 1RI1A 4BU1A 1DMRA 2EAUA 3PT9A 3AW8A 2XVXA 3CF4A 1O94A 2GILA 2R1VA 1ATZA 4RFVA 4RMIA 1N2JA 2ZAIA 4O4LF 1V11B 1FLNA 1YS4A 3OJCA 3OZCA 4K03A 4EUKA 4YIHA 2YQZA 3REGA 4DQ0A 5CFZA 2PGOA 2GKGA 4OYHA 1Z4NA 4NMXB 1E98A 2DUMA 2O2SA 4FEYA 4X3PA 1DXOA 2NTNA 1OX6A 1H22A 2JCYA 3H65A 4QOGA 4B85A 3TD2A 1X8XA 1SXJA 2GESA 5CCEA 1VMDA 2HJ9A 2XTZA 1L4MA 4MR7A 4UFNA 3UWDA 1QHEA 3S5JA 3ZCXA 3IUMA 4ZVLA 2AK2A 3A6HA 3FCUB 4ZZ2A 4XIFA 3NGLA 5K0BA 3TSCA 4XCXA 1W1WA 1DEXA 1CJMA 1UZNA 2IODA 3C6ZA 3EOAI 4WLOA 2ZS9A 5HCUA 3TCNA 1TIKA 1N0HA 3AH8A 3EH1A 4QGFA 3IL2A 4JI4B 1EX1A 3PFHA 1ND5A 2ZATA 5H9WA 1UZAA 2NT4A 4ZJPA 3N75A 2WYOA 1OZFA 4Q82A 4UVDA 1WVGA 2KYRA 2NGRA 3OC6A 4R6WA 5B7NA 1MENA 5HPYB 3FNEA 1MQSA 3QUCA 2H07A 4MGYR 4PC7A 4EQ6B 2F6RA 1U63A 1GKKA 5WRFA 1IQ0A 2WFMA 4UBLA 4WCFA 3R9KA 3SHOA 4DF3A 4A5SA 5CH8A 4EARA 1ZRSA 3SQOA 621PA 1RYBA 3JSLA 2QSUA 4UUBA 4JI5B 1Q22A 2NQ8A 4FMDB 1HEUA 2CEKA 1F8UA 2BJVA 5AKJA 4YAGA 5LU8A 2M98A 5IWCA 5M5BA 4M3NA 1ZGGA 4Z86A 5KWJA 2H1OA 2RC5A 4ERNA 3PHCA 2VSXA 2ET6A 3X1ZA 4TQGA 2NSLA 3S1AB 1Q0LA 5EIBD