4FFRA

Semet-labeled pylc (remote)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
355
structure length
347
Chain Sequence
MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYDDKDEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase
molecule keywords PylC
total genus 112
structure length 347
sequence length 355
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ffrA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ffrA01
4O83A 2W8ZA 2ZDHA 3JQAB 3GK3A 3KLPX 5JSFA 1SC6A 1LBEA 2JKVA 2ZTMA 4RZIA 3ZV5A 1MX3A 2JD1A 3JD4A 4GL4A 3H2ZA 4M54A 5KOIA 3GVHA 1I33A 1UXKA 2B5WA 3D1LA 4Q3NA 4RGBA 1QSGA 4QO8A 3BTOA 4Z9XA 1TEHA 4JLWA 3WIEA 4EGFA 2Q1WA 2VOJA 4OYRA 2HMWA 3F5SA 4TKLA 3FSRA 5KJ6A 5KTKA 4WUVA 1ZK1A 4BKQA 3VTZA 3DMYA 3PYMA 3T7CA 3AOEC 4O2AF 1JKJA 4FGWA 1GYQA 3QWFA 2I6TA 4BO0A 3KZVA 2G17A 3MEQA 3IAHA 3WIDA 5HBRA 5KJEA 3U09A 3WG9A 4NBWA 5LC1A 1U7HA 1ISFA 3F5QA 1H2HA 2EJWA 4OKNA 4R1SA 3H7AA 4HY3A 3D3WA 2FR1A 3P2OA 4E2WA 4B79A 4IZIA 1F17A 3WFJA 3ZU5A 4W99A 3WR5A 3MJSA 2OO5A 3KM0A 1O94A 3L4SO 5LDHA 1F14A 1P3DA 1ZUD1 4IDGA 3JQ7A 3KETA 4Z0HO 2D59A 3ZV6A 2DTXA 3E8XA 4TSKA 1RM3A 3GAFA 1ENOA 3OUUA 4G81A 2X0SA 4YTEA 1E1NA 3HJAA 4DPKA 1YBVA 5L7WA 2EGGA 3EMKA 4IXWA 1ADFA 1O5IA 3DZGA 4TZTA 1R66A 3I5MA 1YL6A 3GN1A 4OM8A 1FDUA 2Z5LA 5FI5A 3T4EA 2EIHA 5JCJD 2JCVA 4IUYA 4LW8A 2ZCUA 3LT2A 3WS7A 5HA5A 4TRNA 4PZDA 5G4KB 3DOOA 3BMOB 2ZATA 5HM8A 1H9BA 4YJGB 3ETJA 1NHGA 4BGUA 1DRWA 1N9GA 4O5OA 4J0FA 5F1KA 2JL1A 3RD5A 3F1LA 1PIWA 1V3UA 4BNIA 1LJ8A 2G0TA 2O7QA 3HDYA 3JQ9A 4BQPA 3RUEA 4QSHA 1T36A 4BNYA 3ONFA 2O23A 3IOYA 1KEWA 2Y1GA 4BNZA 3JYPA 3JCZA 1ZMTA 3SJUA 4DGSA 1GGOA 1ULZA 2R86A 4L1KA 1SMKA 3WXBA 3AUSA 4JGBA 2JFHA 3WNQA 2HKIA 4AICA 1DRVA 5ICMA 2OP0A 1OZAA 4CM4B 1HDRA 3G0OA 2Q99A 4IDEA 4CMBA 5DBIA 1EE2A 2D5CA 1KJ8A 2Y67A 2G5CA 4R5HA 4E5PA 2XAAA 4ND4A 4CM4A 3KSZO 4BNWA 1NR1A 5IZ4A 3E9QA 3NDRA 3HDJA 3GN2A 4RPHA 1B16A 3DZIA 4CM3A 4CPDA 5B4UA 2GASA 3CTMA 2V7PA 4FU0A 3L77A 4IHJF 1NM5A 2JCYA 4WK6A 3WWYA 1ADGA 1Z74A 3ETGA 2AQ8A 3KEQA 3TNLA 1UXHA 2OZPA 1OC2A 1AUVA 1C30A 1GZ6A 3QP9A 3I9MA 3OETA 1MG0A 1ISIA 1W73A 4XWYA 1ZK4A 3WJAA 5EMHA 1TLTA 5IN5A 1T24A 1KETA 2DBQA 1BMDA 1J4AA 5G4KA 1TXGA 3AM4A 4ND1A 1DB3A 2NVUB 3IP1A 4YBZA 4BNTA 3VH1A 3FPLA 4DREA 4Q3BA 3H9EO 3FR7A 5C37A 2HU2A 2AA3A 5A03A 2I80A 2ZB8A 3GG9A 3QVTA 3GVCA 4GMGA 4JP2A 1WPQA 1T1RA 3ZCXA 1PSDA 4BNHA 4FCCA 3A28A 3E9MA 4CLRA 3PJFA 3MJTA 3DMTA 4GWGA 1Y5RA 2J3JA 1T2EA 2CNUA 1H0KA 4Z9YA 4U0KA 3EUWA 1NX6A 4J4HA 2CY0A 2C0CA 4XYLA 1QG6A 4RZHA 4BO1A 2OFPA 1P31A 3IC5A 4OXNA 1HWYA 1M76A 2XD4A 1KVTA 4HUJA 4MV8A 3RFVA 1WP4A 4GGPA 1EQ2A 2BH9A 5KJCA 1ENYA 5LXTF 1KC7A 3NDIA 4ILKA 3LT0A 5GMOA 5ADHA 2HQ1A 4DIOA 4DIFA 2VPQA 1GV0A 2CUKA 5C7OO 3VVBA 1LEHA 3JQ8B 1LDNA 1JKJB 4BO9A 2C7GA 4H15A 2NV6A 3OIDA 1R0SA 3VH4A 3C8MA 5HRUA 4MVJM 2Z04A 2EERA 3B1KA 4I4TF 4A10A 5LOVF 5G0TA 1K5HA 3WGIA 3TFQA 3IMFA 4D79A 5IXYA 4CR6A 3FBGA 3GVIA 1RYDA 2WYOA 1M6WA 4MP8A 2I9PA 1ISGA 1HLPA 2YYYA 3QWBA 1ULSA 4M87A 2BMAA 3VZPA 5IYZF 2W2LA 4Q3EA 2OL4A 4Y67A 3TFOA 4IINA 3R3JA 5AXCA 1BNCA 5I9MA 5FF9A 1I8TA 3WMWA 4XYLB 3JD1A 1GUZA 5C1PA 3S2EA 1CERA 1CYDA 1OAAA 1ZW1A 2VTEA 1EEHA 3OIFA 2Q50A 4EW6A 4PVDA 4GX1A 6ADHA 1X13A 4L76A 3AI3A 5TGDA 2PFGA 1PWZA 3HQ4O 2VYNA 4NK5A 4IDCA 3VDRA 1EYZA 3QW2A 2WE7A 4ZQHA 2EEZA 4MA0A 3PGJA 1TT7A 1WW8A 3K8ZA 4PLCA 4AJKA 1HSOA 1HL3A 2R84A 5U9CA 2PNFA 4YBZB 3L0DA 2ZIZA 5U1PA 1BXKA 4PLVA 2OGUA 1W4ZA 3OMLA 1B3BA 3OH8A 4PRKA 5A9RA 1V35A 3GOHA 3ONDA 2P5UA 3OJOA 1IOLA 2I76A 1FMCA 2X8LA 2Q1UA 2DU8A 4RQTA 2IRWA 3QVSA 1O95A 2Y68A 2HK8A 2B69A 4UAGA 4ALLA 4YCAA 4YR9A 2CVOA 4M8SA 1D7OA 1P77A 2W70A 3RWBA 2ZYAA 1OMOA 5L4LA 5IZCA 4I50F 5BNIA 4M9UA 4HFJA 4C5AA 1D3AA 5I8WA 1S6YA 1N1EA 4E12A 3FF4A 1VKZA 2DC1A 3I83A 4GVXA 5AQ1A 4MIEA 3ZHBA 5JY1A 3RKRA 2IEDA 5KVCA 2YWVA 4TKMA 4AJEA 1T4DA 1YONA 4N5MA 3RUPA 2UUOA 1B8PA 1FF9A 3GDGA 4XQGA 4ZRMA 1GZ3A 4WNCA 4DXHA 5CDGA 1ZXLA 1OBGA 5THQA 1M2WA 3JQFC 4E4TA 2HUNA 3K96A 3QWAA 1FDSA 1O89A 1QRRA 2HMSA 2X5JO 3B1FA 4XEHA 4QQRA 5B4VA 1ONNA 5CP8A 5DMXA 4R1NA 1ZSVA 1Y7TA 2VHZA 2EGHA 3ZWPA 4DYDA 3B20A 3LWBA 4QUKA 3W6UA 1SEVA 4DIBA 4NIMA 4GWKA 4GPD1 1BXGB 2B36A 3A4VA 5CEJA 2JCXA 5KWEA 4XGKA 1EK5A 4CLDA 4FJ1A 2E4AA 2FB9A 1BWSA 5KCZA 3KBOA 2FSVA 1NFRA 1FXSA 1Y81A 1Z7BA 3D64A 1C0LA 2OOSA 4K1LA 3GGOA 2Q2WA 4Q39A 4YJGA 1E7RA 1F06A 3LZ6A 1YO6A 4UREA 4BGVA 3VPXA 1QMGA 4KZPA 1V9LA 2WYUA 1EUCA 2P9EA 4K26A 4XJTA 4BNXA 3GPIA 4FS3A 5TSDA 4CQLA 5TT1A 3C24A 1NAIA 2ZCVA 2NTNA 4NZ9A 5JMWA 3COSA 4O7WA 3ROMA 4AVYA 3GMSA 3TL2A 4LVUA 4R4JA 3GUCA 3QVOA 1UH5A 2YV2A 1WWKA 1PTJA 2J8ZA 3PJEA 2BGKA 2D5AA 3JD0A 4PCVA 4WLUA 4B4UA 2X9VA 1XGKA 1P1IA 3ZWAA 2CZCA 3TPCA 1EUCB 4B4OA 1K6XA 4O59O 3AM3A 3LT4A 1KJ9A 3D3EA 3N6RA 1PJTA 5BNFA 2PVPA 2AE2A 3D3WB 1LSOA 3KREA 3EDMA 5JO9A 4NG5A 1QYXA 4II3A 4BNLA 1JTVA 5HBRB 4HADA 1YJ8A 3S2IA 1GCUA 1BXGA 3PQEA 1UXJA 1PQWA 3DQPA 2PLAA 3PZBA 4AJJA 1UDBA 3N74A 1KBZA 3JYLA 3P5SA 1EVIA 1V0JA 4RCVA 2CMDA 2C00A 4R5MA 3ORQA 5A4DA 1NPTO 4EJ6A 4PLPA 3VZRA 2CDBA 3ASUA 3GEGA 3ONEA 1OFGA 3QWHA 3H9GA 4ND5A 4Y8VA 4CMHA 5IF3A 4NHEA 5KIAA 1NVMB 2EKPA 2NTVA 2ZKLA 1T1SA 3QY9A 5A06A 3I4CA 4FFPA 4FIZA 3TZHA 5L45A 1UJMA 1XELA 4OO3A 3V5NA 4HXYA 3RIHA 4RPGA 1Z75A 3PJDA 1GFSA 2YS6A 4G2NA 3JQAA 2Y0DA 3LYLA 4IS2A 1IE3A 4XB2A 4YAJA 3EHEA 3F4BA 2VZ9A 2X9GA 1EHIA 1XR3A 4E30A 1UP4A 3SEFA 2PGLA 5IDWA 4DBZA 3NJ8A 3WO1A 7MDHA 2DUUA 1XHLA 2GZ2A 3I12A 4MP3A 2UUPA 4BV9A 1T2DA 1VKOA 4FGRA 1HDYA 3H8VA 2FPGA 2YDXA 2FP4B 5IN4A 1Z2PX 4AJ2A 1BRMA 3LC2O 4YJDA 4ALJA 4AJ1A 2J9GA 2CDAA 2TMDA 4LISA 4YAIA 4I55F 5T67A 4YRDA 4YVFA 1Q0QA 2C07A 5L3ZA 1HZJA 1B0AA 3PRJA 1IYZA 3PIDA 2UV8A 3D7LA 1PEDA 3ZI0A 1G1AA 1NYTA 5B4TA 1JDBB 1VE9A 4ZVVA 2PBZA 2I87A 2P4HX 4JROA 4O7VA 2FSSA 3C1TA 5JY6A 4MV3A 5A9TA 2C2YA 4XGNA 1NP3A 2O4UX 4BS9A 5A9SB 3R5XA 2CZGA 1LTHR 2X5OA 1EFLA 3HZZA 3QFFA 3CPSA 2FZWA 1KOLA 4N7RA 1PJCA 3JQGB 3QV1A 3RUDA 4L0QA 2AHRA 5K9ZA 1DJNA 4EUEA 2IYPA 1Z7EA 1Q1NA 3ORFA 4YAKB 3GPDG 3KO8A 1O9BA 2HLPA 4FFNA 4E21A 3STHA 4XD2A 3AFMA 1ZSYA 4R1TA 2R7NA 1ZNQO 1LXCA 4U0JA 3N58A 4IGEA 2UAGA 3ROPA 3G1TA 4GBJA 4CM5A 3WNVA 2VT2A 1SNYA 3HB5X 5F5LA 3HDQA 1YB1A 3WGQA 3PZRA 5J2UF 3JQ6A 3EVTA 1TB4A 2C5AA 2GN4A 2I3AA 2R00C 3OM9A 4TRRA 2O2YA 2Q46A 4KWHA 4J9UE 2YV1A 3JQAD 4CLXA 1OBDA 4LMPA 3KOUA 2ZB3A 5G0WA 3ETDA 1I0ZA 3DF7A 4EEZA 1DO8A 3ASVA 1PS8A 3ADOA 3EVNA 4FDAA 2X23A 1XU7A 5JFOA 3ON5A 5EL0A 3JYQA 1ML3A 4TVOA 4BV8A 3SX2A 2B5VA 1ADCA 1E77A 4IJUA 3U54A 4EEXA 1LX6A 3AK4A 4XB1A 1LC0A 2BI8A 3HE3A 1PL7A 3UCXA 5L7TA 1BW9A 1SAYA 4WPGA 1IUKA 1MB4A 4CLOA 1EMDA 1U3VA 3D0OA 4JNKA 3ZWBA 1WAMA 4PLGA 2B4QA 3S1LA 5BSGA 4GSLA 1SOVA 2JD2A 3KXDA 1ZMOA 1X14A 2VHVA 3DL2A 4QO7A 1NAHA 4MV7A 4FE2A 5JC8A 5I7SA 3DOJA 4CLRB 2POQX 4WLFA 5G2OA 1I10A 4O7LA 3GLKA 1T25A 4M55A 1E3WA 3ORRA 5JMPA 2P2SA 3BHMA 3FTPA 3JQ9C 1J6UA 4NBTA 2UDPA 1SBYA 5ENVA 1NVGA 1VJ1A 1HF3A 1O0SA 3ZHZA 5JAMA 2QHXA 4DMLA 1XQ6A 1PJQA 4PVCA 3TQHA 3DBRA 2CF6A 3LLVA 2SCUA 2OXIA 2Z1MA 1YBAA 5JBIA 1DC5A 1AHIA 5I9NA 5L4NA 1S7CA 5C7LO 4S3MA 5L40A 1Z6ZA 4XDYA 1Q7BA 3UICA 4GX2A 1I3NA 2RCYA 4CMIB 4DUPA 2RHCA 5KVQA 4F6CA 5CDUA 4ZRNA 4KMSA 2WSBA 1E4EB 1VRWA 2ZJ1A 2IXAA 2B37A 2OP1A 3PDUA 1XWFA 5F1OA 1GUYA 4L4SA 1YOVB 4E31A 2O3RA 3JD3A 1ZK2A 5BNTA 5EJ2A 3HWRA 4MVJG 3FWNA 3T4XA 3E6AA 1GZ4A 3PGXA 3V2GA 1C1DA 3GLQA 1GUFA 5G0VA 1KY5A 4R9SA 4CQMA 3KALA 1EVYA 4CUZA 2BLLA 1R12A 4YB8A 3GHYA 1QP8A 3S8MA 1EUDB 4WJZA 5IJZA 1A5ZA 1PZEA 2OHXA 1T2FA 4IXTA 4ZGWA 3GVPA 2PD3A 1MGOA 4GH5A 2X86A 2VNSA 4RLHA 1GQYA 4JJIA 3U5TA 1E1MA 1M0TA 4LCEA 4XYBA 1P1KA 3K6JA 5COQA 3X2FA 4EDFA 2PH5A 4FJ0A 4MIYA 3D4PA 4Y6SA 4EJMA 1JKFA 5LYJF 4WECA 4XIJA 1MXHA 4BKRA 2NU8B 1BTOA 4GGOA 2FN7A 3U3XA 1Z82A 3U4DA 3G79A 3BHIA 1ZBQA 4CQMD 1DC6A 1E7QA 2VHWA 3DWFA 4O7RA 5IZCC 4CL3A 3RFCA 2VHXA 1EDZA 1BXZA 1KVUA 1VC2A 1WDLA 2WTBA 4EUFA 3AU8A 2ZB4A 3Q11A 3FWZA 3W4KA 3GEMA 1YS4A 3BMOA 1DOHA 2AQHA 1DEHA 1X1EA 1CDOA 4YAGA 3LQFA 5CB4F 1R0KA 1GV1A 4BNMA 3CE6A 2Z1NA 5BSHA 3G8CA 2YYAA 3PEFA 4FGSA 1Z2OX 3MTGA 5AXAA 4DMMA 3O26A 2GCGA 4RVUA 5EPOA 4O4HF 2B35A 2FRDA 4R41A 4RQUA 3GDOA 2VHYA 7ADHA 5JYDA 5FWNA 1LC3A 1QYVA 1T2AA 2DBVO 2DUWA 1NQ5A 1ZZEA 4JCOA 5FFFA 2NM0A 5C3MA 2EJVA 1KEPA 1GTMA 2PZLA 3RUAA 1LQTA 4ME6A 3AU9A 1GY8A 1TA4A 4JK3A 1DFIA 2NU6A 2C54A 4O4JF 1BXRA 3INGA 3VDQA 2ZK7A 4UEKA 1C0PA 3TJRA 3C7CB 1C1XA 2H6EA 2VUTA 1B6SA 5L7YA 4YJHA 1WLYA 2OUIA 4IZHA 4E33A 5ILOA 1F0YA 3VH3A 1M0WA 2UVDA 3ROKA 2Q4EA 4HV4A 1R15A 1GSAA 1LLQA 4Q3CA 2EW8A 3DTYA 3I3OA 4BB5A 2FPPA 3E5MA 3EGOA 4BO6A 3AUAA 1BHSA 1UZNA 2ZTLA 3ADPA 4EUHA 3I1JA 2I8CA 1E7WA 1ZFNA 3PHHA 5A04A 3VVCA 3TF5A 5JLAA 2CF5A 5CA1F 4URFA 4MVJE 2DLNA 3AUTA 2C5EA 3H6KA 4J1SA 4R69A 4CLEA 3OP4A 4BO3A 1I3MA 3PLRA 1HTBA 3RUFA 2CD9A 3KVOA 2BELA 4KDFA 4U8GA 1U8XX 4DWVA 4D3SA 1QYDA 9LDBA 1FK8A 2VRBA 4ZICA 3G17A 1B14A 2B0JA 2XCLA 4R1UA 4HNUA 3ZH2A 4O63O 3UCFA 3WLEA 2ET6A 1LDMA 3VKUA 5J23A 2J3HA 3H3FA 1DBVO 5GONF 1I2BA 3ZDFA 1BVUA 3QE3A 4N18A 1RPNA 2Y1OA 3ABIA 3QWIA 1DHRA 3OICA 3JV7A 3DFUA 2ILTA 1L1FA 3VPHA 2VNAA 3I9JA 3SE7A 1YKFA 4ZQFA 1PK8A 1ONOA 4O0LA 1VSVA 4BIIA 4IGFA 5TIIA 3IUPA 3X2EA 2HGSA 3MJFA 2R2GA 2WD8A 4XRGA 5DF1A 5GZ3A 4U5QA 1ISHA 4BGIA 4P4NA 4JBGA 1ONPA 2BGMA 4OQZA 1TI7A 1ZJYA 4Y98A 2G76A 3D5QA 2DPGA 3K5PA 1J5PA 1CQIA 1G0OA 1JWAB 4YWJA 2VYND 2YHIB 3DOCA 2HJSA 4CMCA 4EZBA 1KEVA 4MDHA 4E2XA 1M66A 2YV3A 3AUUA 1PX0A 2CVQA 2HRZA 3T7EA 4GI2A 4P8RA 1HDCA 4CV0A 2Q1TA 3ICPA 4XGIA 4QFCA 4LSWA 3ULKA 1A48A 2IZZA 4RO0A 1EQUA 3O4RA 1GAEO 5J2TF 3CINA 3ZWXA 4CV1A 1YDWA 2R7MA 3K2BA 1N92A 2YFHA 3K5IA 1BGVA 2Y93A 2LDXA 2RAFA 4D44A 3R6DA 3PI7A 3ZU3A 1C3OA 4B3JA 1P1RA 1PZHA 1H6BA 4G5HA 1MP0A 3TWOA 3OJ0A 4Q9NA 4WEOA 1RKXA 1L7EA 2C20A 3A9WA 4XX0B 2DQ4A 1HETA 3R0IA 1UAYA 4IJVA 4YEDA 4H7PA 5BR7A 3ZWYA 1E5QA 4IIVA 4RVDA 1MA0A 4BMSA 2PKQO 4E2YA 5KJ1A 2C29D 4O1MA 3FPCA 2NU9B 4MV4A 4F45A 4H3VA 4OL9A 4W9NA 5ER6A 3BG5A 4DYVA 2YS7A 2HSDA 1YQGA 4XZ3B 3WYBA 1V8BA 5BQFA 3GGPA 4MPDA 3CIFA 4J91A 2Y0EA 4J2OA 3WB9A 3QA9A 1RM5A 2EV9A 4J1NA 1Y1PA 3DBHA 1TT5B 4TWRA 2QZ9A 1CQJB 1R37A 4YRBA 4UUPA 1EDOA 2EF1A 1ZJZA 2D0IA 2VZ0A 2R7LA 2CSUA 3DAGA 4FC6A 4FR5A 3S2GA 3D4OA 4BO2A 4IS3A 4OXYA 4EI2A 3INTA 1OC4A 3NJ4A 1PS0A 5DP1A 1N2SA 3OQBA 1CJCA 4I5FA 5F3RA 1P74A 2V6FA 3NGXA 1WDKA 2FPIA 4QSMA 4KUHA 4E32A 1G0NA 4AJ4A 1Z2NX 1UXIA 4TQGA 4L9RA 5DCUA 4ZQGA 3D5TA 3ETEA 3CKYA 1M75A 1RWBA 3KSDO 3PQDA 3PYXA 3WYEA 1MC5A 1WVGA 2TMGA 5IDQA 2RH8A 2OBNA 4NJOA 2PTGA 5I8ZA 4ZOLF 3BZUA 4DLLA 2QK4A 1NWCA 3GRPA 1PJ4A 4ONEA 4EGJA 5U4QA 3NTQA 4FB5A 4JQCA 3UFXB 2HMTA 1DLIA 5T6BA 2V59A 4CM9D 3MWDA 4I5GA 1J0XO 1VL0A 5AYVA 1HYEA 3IIEA 1ADBA 1YJQA 2X5KO 1PU2A 3PP8A 4J49A 1ENZA 3RKUA 2VWPA 4JJFA 1ZK3A 3ETHA 2PD6A 3GVXA 3QVWA 1MFZA 2O3UA 4RDIA 4DQVA 2NU7A 1DV2A 4ZD6A 3W8FA 4P38A 2ZTVA 3AW9A 1NQOA 1IL0A 1GL3A 3UUWA 4ZQEA 4PG6A 4I1IA 4WCFB 2PA3A 2D4AA 2YRWA 1DIGA 1FDTA 4HNHA 4IDAA 1B7GO 4O6VA 2DIKA 4TV9F 3RI3A 3DHNA 1P0FA 3L6DA 4UUNA 2ZB7A 4KTVE 1E7MA 4QECA 4FFMA 1EUZA 1UZMA 4PLFA 5JDIA 1FDVA 5I9LA 1HDOA 3I9KA 3C1OA 3RU7A 3Q2IA 2C59A 3GMDA 3F46A 3M2TA 3TW6A 4MVJP 3OEYA 4CM9A 2IP4A 4JJGA 3TL3A 4BGEA 1GYPA 1PR9A 1PZFA 1O8CA 2E82A 3TSCA 1V3TA 2DFDA 2EKLA 1LDEA 2WE8A 4UUMA 1UXGA 4EG0A 1I30A 4OSOA 4O7ZA 4E4YA 1X15A 5JQGF 4GQAA 4L74A 2UYYA 1Y8RA 3GGGA 1XEAA 4K6CA 2X22A 5TJHA 1ZXBA 1VL8A 3R23A 4HX5A 5I7FA 2RBEA 2O50A 4G65A 1CS0A 3BMQB 4B3HA 2WD7B 1C14A 3BA1A 3AOGA 4OOEA 5EERA 3TOXA 1XDWA 1EZ4A 2ZYGA 3CMCO 4PLYA 5T57A 2YQ4A 3VZSA 2EHDA 5G4LA 4ID9A 4BNGA 2QYTA 2DAPA 3K31A 2BD0A 1AN9A 1NASA 3MWEA 3EY4A 1Q2XA 1ZEJA 3BMNA 4CV3A 3BTUA 5LA6F 4UVGA 1DAPA 4DLBA 1YQXA 3HUDA 4O86A 3PVZA 3QRWA 3W1VA 1UP6A 3ENNA 2GPSA 4YRAA 1MUUA 4MVJA 4TUYF 4PGFA 4LRTB 4PN3A 2W6PA 1BSVA 5C5IA 3VPCA 1K2WA 3WBBA 1U3WA 2Z02A 1ISMA 1GDHA 4NJMA 4CL8A 4KP7A 4QXMA 4CV2A 4OSPA 2IEBA 2AQIA 2GZ1A 4OH1A 4HNGA 2PGDA 4YXFA 3WNZA 4OGWA 5CDSA 4CMJA 3I6IA 3V1YA 1WZEA 1YL5A 1NVTA 4RF2A 2VTDA 3G8DA 1VBHA 4J4TA 3BMCB 1BDBA 3DZFA 1CEQA 4JP3A 5ITWA 4DIMA 2I65A 3ANMA 3KLMX 3GIDA 3RJ5A 5KKCA 2Y1EA 3AX6A 1ZKMA 4I9HA 4CR7A 4WCFA 2CDCA 2GR9A 5KKNB 1A71A 5AXBA 5TC4A 4DC0A 1PQPA 4RF4A 4WGGA 4E5YA 4WCFC 5CAEA 2NU7B 4YPOA 4ALIA 3EYWA 1T4BA 2XOXA 4IQ8A 1LQUA 1KVRA 2EW2A 2QF7A 3HO8A 5JCXA 1VM6A 1ZIDA 4II2A 3GNQA 2BF7A 1D4FA 2IZ1A 4L4XA 4MVJD 4E6PA 3QLJA 4LK3A 2LDBA 1NQTA 2P9CA 2I66A 3JZIA 3GZNA 4CM8B 4PLZA 1K0UA 3BXXA 3RAJA 2JAHA 4RV9A 4B4VA 5A1TA 4W4TA 4XYGA 4GLLA 4XYMA 1OBFO 5ITVA 4TRJA 1LSSA 4YAJB 1U3TA 3I9OA 4IDBA 4LSMA 2DPHA 4MKZA 4BNUA 1VBGA 3F47A 3KYDB 3P2YA 3B1JA 2C2XA 3MTJA 2GO1A 4TVBA 3IS3A 4MA5A 4YT5A 3JSAA 3KYCB 3OQ1A 4NYEA 3F9IA 2NVBA 3WGGA 1GSOA 1U1IA 2DBRA 1PGOA 4MOWA 3WFIA 3ZHXA 5JAQA 2H63A 1QKIA 1K3TA 5ILGA 1LA2A 5L4SA 1D1SA 4PG7A 2DBZA 3LF1A 1W93A 3RC9A 2Q3EA 5DOVA 5TS3A 3WYCA 5A02A 4TMFA 2OORA 2AG8A 1PL6A 1U4SA 3DONA 1CQJA 2FWMX 3V2UA 2H5LA 3K2EA 2PGJA 3PDJA 3UAGA 3BYZA 3AI2A 3PWZA 4OIMA 4WKGA 4IQ0A 1ISJA 5AVOA 1Y8QA 1SCUB 2HDHA 5EINA 3ZW9A 3ITKA 3MJVA 1P44A 4DQUA 5LP6F 3K92A 5IFLA 2P0AA 2CFCA 3VHRA 2W98A 4A26A 4BNKA 1YDEA 1JAYA 4FQ8A 1UAGA 3QHAA 5ES3A 2NSDA 4BKUA 1R4MB 4M89A 5JW6A 2W2KA 1LRKA 3ST7A 3G1UA 5K6AA 5LDGA 5JAIA 1XU9A 2W6ZA 1EZ1A 3E5NA 1DIHA 1UDAA 1W0CA 2V65A 2P68A 3NTRA 1NPDA 4XX0A 4RF3A 3ZWVA 3TN7A 1GR0A 1K6IA 3DBLA 4ND2A 5T8KA 1YE3A 1U9JA 3NYWA 2ZQZA 3DEYX 2W2KB 5JYEA 4WOKA 3VTFA 4HBGA 4YJFB 1NFQA 3ZWWA 1H6CA 4K28A 4O7TA 1SB9A 3GR6A 3PWKA 2BFAA 1KERA 4AL4A 3ENKA 3L6OO 1I3LA 4R3WA 1QR6A 2PZKA 4ZQBA 5JVLA 3ANLA 4Y9DA 3WO0A 3PJGA 1SCUA 2V58A 1AUXA 1Y8QB 1QV6A 2H1SA 4FOSA 5A3JA 2VT3A 3GNSA 4N5NA 4IJWA 4D43A 3JQBA 2O3QA 4PZCA 1KBLA 2YW9A 4BO5A 3I9NA 1R4NA 4B7CA 1A7KA 4KWIA 1DHTA 4KUEA 3V4ZA 1EVJA 2B4RO 4ROSA 1PX2A 3RU9A 5D8DA 1BDMA 2VWHA 4CM7A 4U6QA 4NPCA 2QRJA 4LCJA 1X7GA 4I08A 4P22A 3LVFO 3K5HA 4BQRA 4LRSB 1F12A 1V3VA 3FI9A 3OFSA 3U4HA 2CNBA 3KYDA 3CH6A 1KVSA 3GEDA 5AOVA 1DV1A 4DQXA 4D3DA 4O81A 5JQWA 4J43A 1QXSA 3VH2A 3SLKA 4FFOA 1H6AA 3VKVA 4RF5A 1JLLA 4KOAA 5L51A 4RVSA 1K6JA 1LRJA 2NUAA 4CM8A 1MC4A 1R16A 3R3SA 4GKBA 3UCEA 1RM0A 1DC4A 3IKVA 2F00A 3UOGA 3Q6IA 4DPLA 4TV8F 2QIOA 4E2ZA 1HKUA 5THKA 3Q2KA 1HDGO 1A9YA 3CMMA 1DPGA 3O03A 3EW7A 3JYOA 2NVWA 1OI7A 3WDSA 4EJ0A 8LDHA 4KQXA 3RC1A 5HTOA 2RH4A 4NFHA 5BMVF 2DTDA 5T8KC 3ZNNA 4TZKA 4QFDA 4ALMA 4IQGA 3ANNA 5CAEB 3K9QO 3LC1O 3DMTC 4MO2A 4WLVA 4XQCA 2XXBA 3GA0A 3QSGA 2W6OA 4Z3DA 3R5HA 3VPSA 1E6UA 1PJSA 1YB4A 2V6MA 1NHWA 1PJLA 2ZDQA 1JQBA 1DC3A 1A9ZA 3AJRA 2VOEA 2EKQA 2GYYA 2NWQA 3E5RA 4D42A 1DLJA 4TRMA 3LDHA 4HQ6A 1PGQA 1WXDA 3PK0A 2GZ3A 2NADA 3IJRA 4RPLA 1G6KA 2Q49A 2EG9A 3H65A 4PRLA 4XKJA 5ICSA 2GD1O 5B12A 4YA6A 2PK3A 1T26A 1GD1O 3O8QA 1DFHA 3E1KA 3GRKA 3HN7A 4YJHB 1DIAA 1HYGA 2JFGA 1C1XB 4IDDA 2X9NA 4WNIA 3TZ6A 2X1HA 4O4LF 3ZHYA 3WGZA 4BNVA 4D46A 4D41A 2NU6B 4IJKA 5T5QA 3W6ZA 2HO5A 2NUAB 2PH3A 4B8WA 1JA9A 2IDZA 3EAGA 1HEUA 1PZGA 4D3FA 2ZDGA 5EZYF 5DULA 3PHIA 3JZFA 1TVEA 1U4OA 5B37A 3WTBA 3N7UA 2D8AA 2A92A 3WQQA 1EK6A 3NKLA 4XR9A 1QLHA 5I7VA 4FC7A 4UVHA 1E5LA 3RJ9A 3DHYA 3RFTA 3OQ6A 3CZMA 3ICCA 1DFGA 2YZNA 4FFLA 2R82A 4K6FA 3L9WA 4FW8A 1QLJA 5JAZA 5H83A 3JRXA 1VJ0A 2P9GA 3FNEA 3P7MA 3C7DB 5A3VA 4ESOA 4NBVA 4AJLA 1R4NB 1XCBA 3GHHA 3UW3A 2PV7A 1PJ3A 3L07A 1A4UA 3CSDA 1PS9A 4L4RA 4U7WA 3Q3CA 3BIOA 3W4JA 4ZA2A 3GAZA 4Z3KA 4MJLA 3AY6A 3INRA 5DN9A 1X1TA 2V6BA 4IZOA 2GRAA 4CODB 4B7UA 2DKNA 2NU8A 4LVCA 3H9UA 1DXYA 1FJHA 1SZJG 1QORA 4OHUA 3NUGA 3I4FA 4PLHA 3NT5A 2X0RA 5CG1A 1LI4A 4IIUA 4YJFA 1KJQA 3QQPA 4D0RA 3ZWMA 3WOHA 1B26A 2P4QA 1ZSNA 3VMMA 5A5EA 4HNTA 3ZN2A 4BOYA 3DBLB 3TZCA 1A4IA 1AGNA 4GSKA 1CE8A 2AE1A 3VC7A 4XDZA 5CPBA 1X7HA 3TINA 4MVJI 3S55A 4KQWA 3S2FA 1I32A 1HSZA 1R4MA 4FPXA 4O4IF 5JDIC 2OMEA 5TT0A 4W7IA 1C1DB 2WMDA 2E48A 3KUXA 3I6QA 4A73A 4AG3A 1E92A 3ZZNA 3OSUA 5C8YF 1JN0A 3OECA 4MV1A 5HWSA 4O2BF 2GPTA 2W6NA 4YT8A 2FR8A 1U2GA 1N8KA 1B15A 3OHSX 1LRLA 5TNXA 5FEUA 2FMUA 3R1IA 4XR4A 1E3IA 3SC4A 1V6AA 4J16A 4O7YA 4A7PA 4JBIA 4CMIA 3Q2OA 4U6SA 4HFRA 3JQFA 5COBA 1LDYA 4IMRA 4DRYA 4EGQA 5KVSA 4YJ3F 3M1AA 4WLOA 4GLOA 3DBRB 3E82A 3E18A 4BNJA 4HFNA 2IXBA 1CIVA 5FYDA 3UXYA 3RV3A 4A5OA 2XPCA 3WLFA 3PFWO 3K3PA 1P33A 1NBOA 3V1UA 2EP5A 1KJJA 3BAZA 3HNPA 3RC7A 1MFPA 2HMVA 2Y1FA 1ZCJA 4W7HA 1B8UA 3W8DA 1N5DA 1K89A 3W8EA 1Q7CA 1WMBA 1JDEA 3DFZA 4PZEA 1C0KA 3ZU2A 4P4GA 4YACA 3ZV3A 2WDZA 5IDXA 1B3RA 3U4IA 3TOZA 3WGOA 3ZWNA 2AQKA 4O7SA 3TIGA 2ZQYA 1O6ZA 3E9NA 2EXXA 5FI3A 3RSHA 3TZKA 2FR0A 2Q4BA 3LF2A 4C5CA 1X7DA 5DCYA 2ZYDA 3IL2A 3GZNB 5TLSA 3F4LA 2P91A 2YFQA 3PTZA 3C7AA 5IG2A 1N7HA 3FHLA 1GADO 3U9LA 3GH3A 4FD3A 2OLSA 4CLOB 4M1QA 5CEFA 3L6EA 2XF8A 1BW9B 1NQAO 2Y66A 3QVXA 2YUTA 4YQYA 4DVJA 1TT5A 5I7EA 2A4KA 1UR5A 3EK2A 2PZJA 3NV9A 5CG2A 1OOEA 3MJ4A 5JO0A 5G0UA 2R6JA 4FOOA 1JW9B 3FBTA 4DLAA 2A9FA 3ITDA 2F1KA 3OBBA 3V2HA 3JRWA 2I99A 1WMAA 4NFSA 3WSWA 4DTIA 3GQVA 5F21A 3WJ7A 5BPHA 4J1TA 4RPJA 1YRLA 5CPFA 1HYHA 2X0JA 4DA9A 1P45A 3OA0A 1E3EA 3OF2A 4C7JA 4CMEC 2OBYA 5A05A 1HLDA 1EE9A 3F3SA 4O7NA 3F1KA 3MZ0A 1VLLA 4UVIA 2G82A 3DBVO 2VCYA 4TROA 4L75A 2YJZA 2X4GA 3WSVA 1VL6A 3H9QA 4I9NA 4RPKA 3DAPA 5F1PA 3SLGA 3C1AA 1QV7A 4R54A 1MV8A 2BFMA 1D1TA 1CETA 1PWXA 3NTOA 2QYSA 3ZU4A 4MV9A 5G0SA 3I23A 2V6GA 4BUCA 4NDNE 4FBGA 2GN8A 4UUOA 3CXRA 4HWKA 4J7XA 3RBZA 5CEEA 3JQGA 4HNVA 1C3VA 2YZMA 2FY8A 3BTSA 4KTTE 5F5NA 3GT0A 5IDYA 5JC1A 1B8VA 5L9AA 3DC2A 4FSHA 3RVDA 3UH1A 3MWEB 5CDYA 3NT2A 1HE2A 3ZNQA 2AW5A 2HMUA 4ZI7F 1AE1A 1JWBB 3HG7A 1YGYA 1CQIB 1RJWA 1KEEA 3IP3A 3B6ZA 1M6HA 3PXXA 2GPWA 1P9LA 4UVDA 4GX5A 4CJXA 1E0DA 2DZDA 2Q2VA 4NU6A 4W6ZA 5BPFA 2Q1SA 2J5RA 1Y6JA 1YL7A 2PWZA 4I5DA 2QW8A 4XQ9A 3L9XA 2YZ7A 3BMQA 1LLCA 2QZZA 4BMNA 5C1OA 4IM7A 3HFGA 4XA8A 4BO7A 3ZV4A 4HFMA 3Q9UA 5HV6A 1MG5A 3B70A 1H5QA 3LLSA 5TJ9A 2FPGB 2V5AA 4BKPA 3BHJA 3FNHA 8ADHA 4X54A 1XQ1A 1I2ZA 3G49A 4M49A 4WLNA 2DVMA 3LSYA 4XIYA 3TZQA 5MGBA 1KJIA 1C0IA 3Q0EA 1YWGO 4BKOA 3JQCA 4O82A 5CA0F 1MLDA 1PL8A 4FJ2A 1DRUA 1P1JA 3A06A 3H5AA 4XYEA 4UEOA 2GUGA 1KEUA 1NPYA 5EIOA 4N54A 4J0EA 1AUPA 1HRDA 3GF4A 5JNLA 3O8QB 4Q3AA 3GY0A 2P5YA 4RVGA 5DOZA 3RROA 5COAA 2D3TA 2NNLD 2O48X 3HSKA 5ENDA 2CNVA 2W90A 3HDHA 4J90A 4DC1A 3M2PA 1IZ0A 5DBGA 4J7CA 4J6FA 2GDZA 4Y8VB 3FN4A 5EQDA 4OXKA 3H5RA 1I5RA 5EQFA 5JDCC 1Y9AA 3HFSA 1YH3A 1YXMA 1IB6A 3LP8A 5H80A 4OAQA 5BSEA 3OA2A 3DZBA 4MVJF 1Y5MA 4AFNA 1R0LA 2BGLA 2W4QA 2R87A 2Y1CA 3PQFA 2FPPB 2HAEA 2YZLA 1JKIA 1Q0HA 5HS6A 1LDGA 4UULA 4BL5A 2Y1DA 1VKNA 4BO8A 3AW8A 3DXFA 2AEFA 4L8VA 3MCVA 3MWDB 5DCWA 3U9SA 3UFXA 3F6YA 1A9XA 3PHLA 4NFYA 4J4BA 1I01A 1JLLB 2VYVA 3W4IA 1YBMA 3LT1A 1NR7A 1XYGA 3VPFA 1L7DA 2I5PO 4R9RA 4I8XA 1ID1A 1E3LA 3PPIA 3H9JA 9LDTA 1W6UA 3NX4A 1XKQA 3ZWCA 3NAQA 3SXPA 4K9DA 1KS9A 2CVZA 2VQDA 1NTOA 5FNVF 3VOTA 3U62A 1DDOA 2QG4A 3VPGA 4YT2A 1BG6A 5LCXA 1E7YA 1LLDA 4IBOA 3AWDA 1XIVA 4JXKA 1X0XA 5K0ZA 1SPXA 2C82A 1H9AA 1WZIA 4JBHA 2NACA 3LC7O 2YQ5A 5DDIP 1XLTA 2YW2A 4ALNA 5JCJA 4E3ZA 3C85A 4WEQA 3PHGA 4CMEA 3KAKA 1NXQA 3DBHB 3VZQA 2DT5A 3TIIA 3MOIA 1CF2O 3IQDB 3U55A 3KHUA 1E1KA 2FOIA 3CEAA 2QRKA 3UGKA 1NFFA 2IE0A 1E6WA 2VZ8A 1M67A 4B8ZA 1Y9EA 2PD4A 3DDNA 4CLHA 5K6AC 4I9UA 2BHLA 3HB4X 3O38A 1ORRA 3WGTA 5DZSA 1DJQA 5GY7A 4QTZA 2NU9A 4I5EA 4Z6KA 1KUTA 1GPJA 3G3EA 4GAEA 4LMRA 3RBVA 1ZEMA 2RHRA 1IULA 2QRLA 4NU5A 2YRXA 3WGHA 3GZ4A 2HCTA 3UN1A 2Y05A 3HADA 4XQEA 1PGPA 4CM1A 2WYVA 1W8DA 4YB8B 2E6UX 4N5LA 1X0VA 4CQMB 5JS6A 3AY7A 4JIGA 4IMPA 5CHEA 1UZLA 1U5AA 2X58A 2DWCA 1KC1A 2O2SA 4EYEA 1YOVA 4LN1A 5CDTA 5DNAA 1W96A 5L53A 3IDSA 4PG8A 2H9IA 1KY4A 3A1NA 4XJSA 3EC7A 4E13A 4IPTA 4YQZA 1WNTA 2O4CA 4CMAA 3O9ZA 4E5KA 4MKRA 4OOFA 5A5FA 2E37A 2J6IA 4CMKA 1B6RA 2R7KA 4Y6PA 1JVBA 5KJFA 2YHIA 4QX6A 1R6DA 3JD2A 3ZWOA 1VJTA 1IY8A 4S1VA 5TX7A 3RBXA 1KYQA 4Q3DA 2DFVA 2WJPA 4AJOA 2C7VA 4DL9A 4DPMA 2X0NA 3R9RA 2GSDA 3SVTA 2R00A 2O3SA 4OQYA 4B3IA 3KSUA 3KEOA 4NBRA 3V1TC 2J5QA 2JHFA 3FD8A 3C3XA 2Q2QA 1ENPA 3KYCA 3MJEA 3OEWA 1E3WB 3UVEA 1IZ9A 5L95A 4RVHA 2B83A 4FFRA 2FZEA 4WCDA 3RUIA 3UF0A 4BMVA 1GPDG 4YAEA 4WBNF 3NUAA 1LNQA 4RZQA 4A2CA 2DLDA 4LGVA 2X7HA 5EESA 1E3JA 2NQTA 4XYMB 4ZQIA 1DIBA 4B7XA 1H2BA 1GEGA 4WE3A 5H81A 2A35A 1SB8A 1YVEI 5TQVA 4RLSA 1F8FA 1VI2A 3DO5A 1RYEA 1YQDA 4QEDA 4OKIA 3VOSA 1JU9A 3IJPA 2W6MA 3ROQA 1WR2A 4AJHA 2VR1A 3Q1KA 2BKAA 3CUKA 5BSFA 5CFZA 3QJ5A 4J2HA 3DAFA 4ZN6A 2R85A 4J7UA 1LSJA 3HB9A 1D8AA 1F8GA 2B4TO 2W2LD 1HXHA 3UKOA 3SC6A 3UHAA 4NH4A 1Q0LA 1XSEA 3MJCA 3I9LA 3RUHA 4D45A 1SEPA 1VPDA 1WDMA 4A0SA 5IXSA 4INAA 3WBFA 3L4BC 1EBFA 2O3JA 3JQ8A 4NR0A 1U8FO 3TRIA 3JQBC 3H5NA 5TF4A 3Q9NA 3RUCA 4HR7A 2ZJ0A 3SJ7A 4Z0TA 4C5BA 3FNGA 3BMCA 1FDWA 4Z0PA 3TDKA 4ZHSA 2WWRA 2XXJA 5T64A 3R5FA 4BVAA 4MKXA 3ZNOA 4E5MA 4XRRA 4EITA 2GQRA 4PLTA 2I3GA 4R51A 4F6LA 2W6QA 1H93A 2IODA 2ZTUA 3KTDA 1HZZA 1AXGA 4NJMB 3DTTA 3RC2A 3WGYA 2AEMA 2GERA 4O84A 2BFPA 2PZMA 4UVEA 4DLKA 4J3FA 1IHYA 3K73O 5DP2A 1AXEA 2VUSA 5DBFA 2JD0A 1J49A 1E7SA 3D4NA 5A9SA 3A14A 4RDHA 1LLUA 4OMUA 3VA7A 3BMNB 1PQUA 3H4VA 1KIFA 1I3KA 3DZKA 4NQZA 3HHPA 1I7LA 1ARZA 3WQRA 1EBUA 2D1YA 2NVUA 3GG2A 4DBVO 3WICA 5ER9A 3IUSA 1HE5A 3NEPX 4Z9FA 3RCBA 4MV6A 5GZ1A 2I67A 1MXFA 1PGJA 1HDZA 2WD7A 4H16A 4M86A 4QT0A 3U0BA 3DZJA 2GLTA 1SO8A 4J9VA 1DSSG 1GLVA 2VQ3A 4HKTA 2JJYA 5HS4A 3DHEA 4R68A 2DTEA 2FP4A 1Y8RB 3E03A 3HN2A 1U28A 3FCOA 1NNUA 4OJNA 2QX7A 3KB6A 4GMFA 4E5NA 2GNAA 5KKAA 1KVQA 2D2IA 4ZU3A 2VWQA 4NNJA 3U4CA 2IYOA 4JN6B 1A7AA 2WM3A 4KUGA 2CNQA 1RM4A 1UUFA 1BVRA 1LUAA 4NBUA 1GSHA 2AG5A 3N8DA 1E6EA 3GDFA 4ND3A 4WLEA 1PGNA 3M1LA 4MP6A 3FR8A 2J3KA 1EUDA 3WWZA 1Z45A 4D7AA 3OJFA 4MIOA 2WYWA 2HK7A 1GEEA 3WQSB 1VSUA 5KNLA 2AXQA 1T2CA 5JH7F 2RIRA 3AFNA 1I7NA 3OJEA 2PKRA 4EBFA 1IPFA 1PJBA 2GN6A 3WMXA 5JXWA 3OUZA 1Z73A 4WOJA 1IOVA 3WTCA 4F46A 1IOWA 1GU7A 2AMFA 3NDJA 1XG5A 4UEJA 5KVVA 4CUJA 1E4EA 4W9NC 1EFKA 4FN4A 1P0CA 4L73A 2VRCA 2GQSA 2W71A 2J5KA 5C7IO 1N9GB 3V8BA 1I36A 4BHTA 4R16A 3AY3A 3DR3A 5EN4A 4A03A 1B2LA 2Y0CA 1ZVMA 2EWMA 2BRUA 2AEJA 3V4SA 2SCUB 4YYZA 4PFJA 1HE4A 4YJ2F 2VRCD 4RJTA 1GQQA 2IZ0A 5IAAA 4PG4A 2A94A 2VYVD 1HT0A 1LDBA 5DT9A 3AOEA 6LDHA 3RV4A 1GQ2A 2JAPA 1U7TA 3PLNA 1HDXA 3E48A 2HK9A 1IHXA 2O7SA 2WEKA 4PG5A 4RVFA 4MINA 2YHUA 2YDYA 4BNNA 2PN1A 3SBOA 5JDCA 3MOGA 2J3IA 3WX0A 2Z95A 3FNFA 4D0SA 4NMHA 3JQ7B 1YB5A 2FPIB 3QIVA 1P1FA 4W82A 4CQLB 1JAXA 1U2DA 1N1GA 4ALKA 5B1YA 4F3YA 2GN9A 5GZ6A 1GYRA 1HE3A 3AM5A 2JHGA 3Q1LA 1EVZA 1CRWG 1XA0A 1UP7A 3K30A 1ULUA 3JQDA 3RFXA 1CWUA 2VN8A 4GKVA 1ZK0A 3LK7A 3RASA 4NK4A 2Q45A 3NT4A 2G1UA 4NI5A 2O3TA 3NGLA 4PLWA 3GFGA 2YZGA 4XZ3A 4RORA 2NQ8A 5JPIA 5KX5F 3JQEA 4JX8A 3ZNPA 1AHHA 4J1QA 4CMGA 2EP7A 1Q7GA 4A27A 1ZO8A 5JE8A 3GUYA 2GLXA 4AJNA 3ZW8A 3PWSA 3U49A 3M6IA 1PR3A 5BT9A 3FTNA 3GC6A 1UDCA 4KDEA 1I2CA 4GVLA 4RL6A 4B4WA 4C7KA 1QYWA 3H2SA 2DM6A 2E49A 5H82A 2X0IA 4AJIA 3AI1A 2NTJA 4ZJUA 3JTMA 4YAKA 1U3UA 3BTVA 2BFOA 4Y6RA 4XCVA 2GGSA 1JVSA 3DZHA 3L4BA 1H94A 2FHSA 4AJPA 3TQTA 4BNFA 3PFFA 1QYCA 4R3NA 3PYLA 4IY1A 5TRTA 2PY6A 1DIKA 3PIIA 2HRBA 3GFBA 4IDFA 3H3JA 2YL2A 1LU9A 4CM6A 4CUKA 2X6TA 4IIJF 3IKTA 1E3SA 4ZHQF 1DAOA 3FRJA 2HJWA 3JYNA 3KRTA 4P4LA 1KC3A 3PHJA 1IPEA 1NWHA 1E1LA 3DB2A 4C4OA 4MVJH 4CR8A 4HP8A 3OIGA 3CZRA 1LSUA 3NRCA 1P1HA 1A27A 4E0BA 1I24A 3OJLA 4BO4A 4YDRA 3EZLA 3KV3O 4GX0A 3ZGYA 3HBLA 3P19A 2QQ5A 3KAJA 3VPBA 2YY7A 2HJRA 1GCOA 3I52A 3KYBA 5JVDF 1M6VA 1H6DA 2BI7A 5AXDA 4WASA 4PIVA 1PJ2A 1A72A 2GF2A 3EZYA 2NLOA 2VUUA 4R01A 1JDJA 1U5CA 4YT4A 5MDHA 2JFFA 2PR2A 2VWGA 3LU1A 3U9TA 2PKQP 1N7GA 4ITUA 2Y99A 1ZH8A 4BB6A 3RQSA 1DIRA 3GNTA 1SOWA 3VAZA 4MAMA
chains in the Genus database with same CATH superfamily
4ZAFA 1VJGA 1JZQA 1JP7A 1W35A 2VK4A 3GK3A 1SC6A 3KLPX 3MNFA 1MIHA 4RK0A 1DEXA 1X86B 1C9JA 2D13A 3WK9A 3C43A 1LZKA 1R6AA 2JD1A 3JD4A 2P0YA 3BSWA 3H2ZA 1N2XA 1ZJ5A 4M54A 1F1BA 3TQOA 5EXXA 4RENA 2CV1A 4RGBA 4MS3A 2P35A 4QO8A 1GL7A 3BHNA 4IIFA 2W8BA 3OZTA 5AKKA 3BTOA 3STUA 1DMRA 2GNPA 4Z9XA 3UB4A 3O84A 1A2BA 3WIEA 3SQDA 4OYRA 2HMWA 4TKLA 3HDTA 3FFBA 2CLKB 4WUVA 4WCVA 1ZK1A 1J2UA 3CZAA 1QR2A 1ZH6A 3PHCA 3PYMA 3R5JA 2XWSA 3IVAA 1SUPA 3ESRA 3FPHA 3ZR4B 3QYAA 3KZVA 5CFNA 1BJTA 4QDZA 5I9IA 1K08A 1LFDB 2VJMB 3WG9A 4NBWA 1ZIYA 1U7HA 1YMUA 4YJ2B 1JV2B 3UTCA 5JSZA 1YJAA 4R71A 1DCMA 1TKRA 1HK7A 4BEVA 1EP1B 1V71A 2FSHA 4KXUA 2VO1A 4BMZA 3ZU5A 1R9NA 2Q27A 5KYKA 3G0BA 4HRVA 3EY9A 1OX5A 3KM0A 4KK3A 5DTIA 1O94A 1SUCA 1QVVA 4OBXA 1KMCA 1U2SA 2QX4A 4LDZA 1F14A 1P3DA 1U0SY 2JJ1A 2EZ8A 3KETA 1TA9A 2D59A 3EXG1 1I1KA 2I8AA 5HG0A 3ZV6A 1N57A 2G80A 2WJYA 5LP6C 2QVLA 2HGWA 1RM3A 3UFBA 5K09A 3OUUA 4G81A 1V5WA 3TLGA 4YTEA 2C3OA 2EKZA 3T54A 5IK2A 4O02B 3FA2A 1V96A 2AK3A 1I1OA 1QG2A 1Z16A 2CYBA 2EGGA 2MWMA 3FG9A 3M5DA 4QNMA 4TZTA 5DASA 4ASUD 3GN1A 4OM8A 1FDUA 3F78A 5IC4A 1T3TA 3HXKA 5E1OA 3T4EA 1OB2A 1HQKA 2PMKA 1CIPA 3KDSE 4O3MA 1MN6A 4LW8A 1BOFA 1T4MA 3IUQA 3WS7A 2H00A 1A0IA 3EF1A 3RTEA 2ZOSA 4LMBA 5FPHA 3FAKA 1AM4D 2QRMA 2ASVA 2WZDA 1WZUA 3DOOA 3QKRA 2R751 3QVKA 1FL9A 3SF8B 4X1IA 1H9BA 1XD8A 1S7GA 3A9UA 3ICEA 2FXIA 4MW9A 4PAGA 5JJLA 3UOAB 2OD2A 3T1VA 1KWGA 1YR3A 4EB6B 1Z8HA 2XBUA 1BQEA 3EF0A 2Q6TA 2R6HA 2J32A 3OHMA 4FDMA 2O7QA 4NPAA 4WY2A 4B17A 3FLAA 5BRAA 1KDRA 4BQEA 1T36A 1BD3A 3IILA 5EIBC 4EMUA 1KJZA 5KOHA 4QYSA 2E55A 4GZ6A 3IOYA 3TIFA 3JYPA 3OOEA 2PLFA 4MMYB 1RLOA 1YAJA 1ZMTA 4NCKA 1GGOA 4L1KA 2R86A 1A77A 1MRSA 1UEJA 2PCJA 3PXDA 4ZWNA 1SXGA 3WLSA 1VL1A 3WXBA 4ETWA 4WADA 1PG0A 4AICA 5AVKA 4JZKA 3VNUA 3M5PA 5B6PA 1LV7A 3JWEA 2OP0A 4P34A 1OZAA 4CM4B 1NMQA 1HDRA 2GPNA 2R8PA 4V24A 6NULA 3I5XA 2Q5FA 3AINA 2Q99A 4ENVA 2DPXA 2K4MA 1L7QA 3CURA 5H4HA 3N8NA 1YQ9A 3CKLA 3LL4A 1NMXA 2ZEJA 4G9EA 1PWYE 5HBGA 3W5JA 1KEKA 3PQ8A 3P9IA 5CITA 1GAWA 2Y67A 2ZRLA 4XUCA 3T5DA 1VIVA 2XNJA 3Q9LA 4MA4A 3BWVA 5BW5A 1XL0A 3WB2A 5LYJA 3E9QA 4C6RA 1CF9A 3RRFA 1NUPA 1EP9A 3CHYA 2IA5A 1QHIA 3AILA 2ON6A 4RPHA 4XD7D 1B16A 1J7JA 1WPGA 2ACVA 3DZIA 4BX2A 4DMGA 4RCNA 2XA1A 1R0XA 4K9QA 2P2NA 4CPDA 4F0JA 4N3BA 4W5RA 4IIBA 5KINB 5DHQA 5PGMA 3WKDA 3L77A 1MH1A 1XRSB 2JCYA 4IKOA 4WK6A 1ADGA 1Z74A 2H8KA 1CUSA 1T36B 2FUEA 2HL6A 4N6NA 5LNK6 5IJAA 2OZPA 4QTYA 1TVKB 3A8TA 3LWZA 3HPQA 1GZ6A 1JYEA 2FW1A 4MI9A 4EB6A 1SUAA 4DR3B 1QAOA 3WJAA 3FCUB 3AZPA 1V43A 4G5RA 3SQLA 4G97A 5KWSA 1KAEA 1L7RA 4N12A 1B73A 3B89A 3E4DA 4R9UC 1CEEA 5G4KA 3AM4A 4XI9A 1QIHA 4ND1A 4QLAA 2Q6IA 4WN9B 2IS2A 4MZXA 2NVUB 1CUVA 3UWKA 4D98A 1ZZGA 3OKFA 4DREA 1ZC3A 3MQFA 5IT5A 3NEYA 1M1YB 4EB3A 3W5BA 3LFHA 3UUEA 3CW9A 2HU2A 1G5HA 4PAMA 5LQDA 1SC1A 1Q1EA 4PYOA 4N03A 1D2CA 1HT1E 3JZDA 4LDQA 4DFDA 3D31A 4RZ3A 2WSIA 3DKIA 3GVCA 4IGAA 2C2KA 2XTJA 1TRKA 3KJNA 4BNHA 1U31A 3EWIA 4P7FA 1GGVA 4IV0A 3A28A 3E9MA 2HBYA 3PJFA 2WSMA 3F97A 1H1DA 3DAOA 3JVUA 1R27A 3LS2A 1FP7A 4GWGA 4LSGA 4RM3A 4TXMA 3H4IA 3TMKA 3GFSA 4CCYA 4CKZA 4Q4HA 2YINC 4XYLA 2COGA 3TR5A 1INLA 4Q4DA 1EUQA 1M76A 4HYYA 4AKSA 1TQDA 1UFVA 3CF6R 3EVDA 1KVTA 2VAVA 4MV8A 3Q40A 4MWBA 4RABA 4WOCA 4GGPA 3A3KA 4R2MA 3MAAC 4BVFA 1Y1KE 4ZT2A 2H2GA 2FMTA 4Q4LA 3LFUA 4TN1A 3AUFA 1KNQA 5LQJA 1AS3A 2JGKA 3BZWA 1RKUA 3NDIA 4PX5A 3TOCA 4A1FA 2XWPA 5GMOA 4FFSA 2WWWA 2PT7A 2BUCA 4DIOA 5ADHA 1KXJA 1M8KA 1PR0A 2L82A 3EIFA 3SJBA 5C7OO 4P4SB 2RMKA 1QWSA 3JQ8B 3B7WA 4BO9A 4H15A 5KQMA 3OIDA 2QS9A 4JP1A 4G23A 4M1MA 1O94C 2ONJA 4JOSA 3VH4A 3QZUA 1FFDA 4MVJM 4GLFA 3B1KA 4I4TF 1Y3FE 4N8SA 3ZCUA 2QJOA 4HTAA 5CB6A 4CBVA 3LHDA 3U7EB 4EJ2A 1QGAA 1VG1A 2PTHA 5HDQA 4BN5A 4ON9A 4C88A 2IHJA 2W8BB 2WF5A 3EDRA 2FKNA 2W4MA 3AB7A 5LR6A 2DABA 3D8UA 3JALA 1RYDA 2BN4A 1BS9A 4IXMA 1DBWA 1KSFX 1P5HA 1A5SB 4XSVA 4ZVQA 1HLPA 5HF6A 4M87A 1XV5A 4KGVA 3R5KA 3T3NA 5IYZF 1BU5A 1BHJA 3TFOA 1Z0AA 4M6WA 1KQFA 3S1AA 3BQNB 3G0CA 4KX5A 2A9VA 5DX8A 4UDXX 1I8TA 2SHKA 3WMWA 1QMPA 5BW4A 5KWVA 1UBJS 5C1PA 5AW8A 1CYDA 2AXPA 1IK4A 1G3IA 4IGKA 2QNIA 2H1OA 1OAAA 2VTEA 1EEHA 3ACDA 1ZN2A 5LOVB 4TM5A 2H7XA 2FMXA 1QANA 5A3QA 2IIQA 6ADHA 2PUAA 3AI3A 2JJ2D 3TRFA 4NK5A 2VYNA 4Q37A 4RPCA 4XDHA 1EYZA 2ZUCA 1WXEA 3IOMA 2XDYA 3IESA 2WE7A 3QW2A 4B73A 2R8XA 4MA0A 1TT7A 1WW8A 3HCPA 1C2TA 1O6FA 2JZCA 3K8ZA 3AIOA 1IZYA 4PLCA 4RGYA 1ISPA 1YAHA 7REQB 3BM5A 2BTOA 4UUQA 4X00A 2FPLA 4AS1A 2R84A 3E0XA 3REQB 4BUZA 5B57C 4YBZB 1P3Y1 3ILYA 4Z86A 3VR4D 4EGSA 1TQ6A 3L0DA 2HHCA 1NJSA 2ZIZA 1BXKA 1OZ0A 3H84A 1G2PA 4PLVA 1XAIA 4Z99A 3ZHOA 3CC8A 5CA0B 2ATIA 1IJKA 3S44A 5A9RA 5KUTA 1G8KA 3ONDA 5JJIA 4DDVA 3AESB 1K86A 2BHTA 3ZD8A 1P0PA 3A4YA 3SFZA 2C3MA 3RU2A 4Y1RA 3WB0A 3ZTYA 5MFZA 2IRWA 5ALNA 5ALZA 5ALIA 4U7HA 1C30B 3RRXA 2GTHA 4Q1VA 1MJGA 1WKBA 3F8TA 4FVTA 2Q41A 1FVHA 1VYTA 2B69A 4M53A 3T3GA 3DCYA 4NAVA 1C7IA 4MS4A 1RZRD 3WJ2A 3FOWA 1Z83A 4I50F 1PFUA 2GESA 4HFJA 2WU8A 3PNLA 5D85A 3EIXA 4JLUA 3PNKA 4OLAA 4GVXA 1ORWA 3V8EA 2KBEA 3DE3X 4NMLA 3GD7A 2DX7A 3DLPX 3AKYA 3RIMA 4UHFA 2YWVA 3O95A 5H3LA 4Z5XA 3GUUA 3SNOA 2FVYA 1ZJJA 2QTFA 1JJIA 2XBLA 1XAJA 4N5MA 3CPJB 3WV4A 3GWZA 4A1OA 3E1SA 4F4IA 4JB0A 4G4IA 3BIJA 4LWOA 1N5LA 1QPGA 2LVBA 2C1ZA 2V8BA 2ZUWA 2EFEB 3GDGA 4URYR 1G5RA 4ZRMA 4DXHA 5A7FA 1SZCA 3KOMA 2HDKA 4CN8A 1ZXLA 1OBGA 4HTFA 1M2WA 4YRBA 3QWAA 3C14C 1FDSA 1O89A 2VHTA 5B4VA 2O8EB 4IDPA 3JARB 4A0GA 4PTYA 1ICEA 3AFIA 4JJ8A 5H59A 2WB4A 1RJEA 4JLVA 3N05A 1BN6A 1IY9A 3BS4A 3AQIA 1T6NA 1X1DA 2R6GA 4OJYA 1DWUA 2P9QA 2HT6A 3SS7X 5BN4A 3U3KA 5JUWA 3ZVNA 3KB2A 4AURA 1WE2A 1J33A 1R4ZA 3B1WA 4LC0A 4CTJA 1XPJA 4HGQA 5AKEA 2B36A 5GVSA 1UAAA 2JCXA 4XGKA 4CLDA 3QLUC 1W34A 2FTKE 2FSVA 2X19A 4EY8A 2WU4A 1WDTA 1SA0B 1FXSA 1Z7BA 2JGRA 3GJTA 3KWMA 4OAPA 4PYIA 4YHBA 1SM4A 1VYVA 2R5WA 3L46A 1CB7A 2OCBA 1E7RA 4YJGA 3VR3A 4BGVA 2V9ZA 3VPXA 1QMGA 4KZPA 1V9LA 2WYUA 2ATVA 4K26A 3HUTA 4TL8A 1G41A 4BNXA 4YAUA 1XN4A 1NULA 1M74A 3LQ1A 5CHYA 2DFKB 2ID4A 4HAYA 3PFIA 4M1OA 1E79A 1V25A 4KV9A 3SOZA 2NTNA 4GRAA 2A59A 4NZ9A 3VR5H 5B1EA 5KREA 3NHBA 3CCCA 5JMWA 3COSA 3KB1A 3EBPA 3SR0A 2JF0A 2NGRA 4UD6A 3ER8A 1N3LA 2PYZA 4ENUA 2EZ9A 1ECGA 1X8LA 4R8KA 4WA7A 1R0ZA 2ZSBA 3A6ZA 2PGIA 1O95D 2GBLC 4B3FX 4P7BA 1U3FA 4E5VA 3GUCA 2MJLA 1M0SA 2WV7A 3QVOA 4MEJA 4BBPA 1PTJA 1T6ZA 2B25A 2BGKA 1Q0PA 4L0MA 4PCVA 5IBQA 2FPOA 4U00A 4B4UA 3R20A 2RI1A 3JASB 3MF4A 3P2EA 1P1IA 3AEXA 2CZCA 3MUEA 3ZTTA 5JAHA 4MQUA 1YIDA 4B4OA 3C6KA 4O59O 4QUDA 4S2UA 1YVPA 2ECKA 2DPMA 4A2PA 1PJTA 1PDOA 1WF3A 1Y82A 2AE2A 2BTQA 3P0HA 1G19A 5BNFA 2XDQB 5IVKA 4AZWA 4MYRA 5JO9A 4NG5A 1QYXA 1QCYA 4EENA 3ITNA 1CY2A 4LXTA 3AQ4A 5KS2A 1V11B 3I6MA 4CKBB 3P9ZA 4HS9A 3QX7A 4AJJA 3AUJB 1M2OA 1UDBA 3N74A 2YQZA 3V8VA 3JYLA 3A70A 2RC5A 4I99A 1V0JA 1ORVA 1MV5A 2I4LA 2I9KA 2Q3MA 3DGEC 1RXWA 4R5MA 2VEDA 2FH5B 5GIPE 4EJ6A 1B8OA 3VZRA 5AM3A 5D1PA 3ONEA 1OFGA 1AK9A 2REQB 3H9GA 2ZU0C 1WUYA 3LIPA 4PQGA 4ETMA 5KMGB 2O8EA 1G2WA 4GOND 1T1IA 4LA4A 1QQTA 2WR8A 5EC8A 5FYQA 4MAFA 4Z8YA 3GJQA 5D1OA 5LBTA 2ODQA 1CY1A 1SKQA 2IPNA 3WGMA 1D2AA 4B3TB 1Z75A 1R88A 4LY9A 4TTQA 4X8OA 4CDGA 4CIWA 1FZTA 3GJ7A 4W1PA 2YS6A 5DSTA 4G2NA 3JQAA 2VUGA 3LYLA 5EXDA 1IE3A 1K8QA 3RANA 2YXLA 5KYWB 5LWHA 3F4BA 3KQVA 3IDZA 4ZV7A 2ZSFA 4M1EA 1E5TA 3RS2A 1EX1A 5IDWA 4E30A 1UP4A 5E9QA 4WY8A 1GG8A 3I0NA 2NO1A 2H1WA 1JAZA 3DDWA 1NXTA 1FYXA 2HDWA 4TS4A 1XHLA 3VJMA 5KDDA 4JXUA 4G84A 4L4YA 5M5BA 2O2EA 4FGRA 4IHQA 2D5IA 1XMSA 1Q1AA 2FPGA 3H8VA 4GP9A 1N75A 4EF6A 4A6XA 3L1JA 4C7OB 3QFCA 1ZD8A 2XCQA 1H65A 4P3PA 1Y7HA 4YJDA 1JHYA 3O73A 4HLUC 4AB1A 2CDAA 5TY0A 2WJIA 4DCNA 5EVCA 5IU6A 4OYHA 4RK7A 2J7PD 1B76A 4N01A 2HF9A 4ZZ3A 3PXUA 4GE3A 3OURA 3AV3A 1IAVA 4P33A 1YU6A 4RJLA 3TLMA 3V1MA 3WQHA 5EIFA 3ZKWB 4Q1BA 3FRHA 2B8EA 1UFOA 1KEEB 1SU4A 1DAIA 2Z98A 3AEZA 5FBZA 2I22A 5DISB 4BLTA 5KTYA 2XECA 4C3ZA 3LNTA 2PBZA 2I87A 4KMMA 2AV6A 1EB9A 2IPLA 2Z6UA 1CSEE 3VSDA 5A9TA 3TEFA 2O4UX 5A9SB 3TCXB 4HT3B 4QJIA 2Z9DA 2J33A 3E22B 3EIHA 3G9UA 1JEYB 4E6NA 1U0RA 2QEQA 5FNVA 4Y2TA 1KOLA 4N7RA 2OA0A 5KO2A 1OD6A 1WB4A 3FHJA 2A86A 2J0UB 1QNFA 2AHRA 3FDXA 5ALUA 1VBFA 4EUEA 1KIMA 2N47A 4BDTA 2PL3A 5BORA 4YAKB 3KO8A 2ZXFA 1F38A 4FFNA 4YUXA 4M98A 4OFXA 4NULA 2BMVA 3HBMA 5JMOA 4L3OA 4XD2A 3AFMA 1ZSYA 1Z2CA 2R7NA 5EAIA 3T9CA 4YMLA 1MCZA 1D03A 3QPUA 4ZV9A 4F5YA 2JLCA 3N58A 1UWVA 3ROPA 1XCMA 1WQ1R 1FUKA 1G16A 3U7FB 3JALB 2O8CB 3HB5X 1E8MA 1EX9A 4ZAYA 4DJDC 5I3ZA 3PZRA 5J2UF 1NN3A 1SURA 2APJA 2YWBA 3LHKA 2V1XA 2CLHB 1N3BA 2I3AA 3OM9A 4DXAA 5I4IA 2Q46A 2VF5X 4URXR 2DECA 3FRIA 3FI0A 2IGTA 2P3SA 1I0ZA 5HUJA 3I30X 3ASVA 3EVNA 3FKSD 3LXMA 3L79A 4WJLA 1D6NA 4OGKA 4FYXA 1XE3A 2GHRA 3CT6A 3TLBA 4TVOA 2E3JA 1CUDA 1CQPA 3OZDA 1A5TA 1E77A 2VZLA 4IJUA 1FW8A 2CXRA 4XB1A 3SNKA 3Q10A 5NULA 2VDRB 5JSHA 2QLJA 3PNSA 4WPGA 4AZ0A 4AYTA 1EMDA 1YSCA 1NBHA 1MJGM 1U3VA 2PZFA 5B1IA 1EM8B 4RPIA 1OQAA 1XQVA 1YIOA 1V41E 3K7EA 4WZBE 2LWIA 4GSLA 4EY4A 3KXDA 5C8YB 4PYLA 5IANA 3DL2A 4I50B 2EX1A 3QX3A 2O8VA 1X87A 4MV7A 4ZVTA 1KBQA 1V1MB 1S96A 4G25A 4IX1A 4MWDA 5JC8A 1JMYA 3EC2A 3IV9A 3OM1A 3QNWA 4F92B 3W5AA 4GW3A 1M7HA 1DJOA 5G2OA 4ZDWA 4HB0A 3RB8A 5AM1A 4YCMA 5DWVA 2EGUA 2YNMA 4QPDA 1O0BA 3ORRA 2WUDA 4LJ5A 3N76A 3ITEA 3TEJA 4C6TA 1KYVA 3W9BA 1K7XB 5BR1A 5ENVA 4TM7A 4HEHA 1TTTA 2QHXA 1SXIA 2V0NA 4PVCA 2OXIA 2CF6A 3HDVA 1TDJA 3LLVA 2F9LA 3BD7A 3F4KA 4GMXA 3MYRA 3NFRA 5I9NA 2IWHA 1AMOA 4OXXA 2QD3A 1RWPA 4FFVA 4ZALA 2ICAA 1L2TA 1OFHA 3W5IA 1CUWA 1Q7BA 3UICA 1RWWA 5A4FS 1PW5A 1RD4A 4F12A 3ZWQA 1X1RA 4EW2A 1VBNA 3P0EA 1UT5A 4BQOA 4LE1A 1E4EB 2EIYA 1TCCA 2RHJA 2VDPB 2ZJ1A 3MSCA 2OP1A 3TIXB 1V7QA 1NJ5A 5GTDA 4UE2A 1LVUA 1XWFA 5FL7D 1F7VA 4L4SA 2RK3A 1Q6ZA 3REOA 5BWCA 4DB2A 2I71A 1N6OA 3K9FC 3HWRA 1GZ7A 4PIMA 4AKHA 3T4XA 3PGXA 2VYQA 1C1DA 3G85A 5KQSA 1OXTA 4GC9A 3RSFA 4UHBA 3QLVA 4R9SA 4M22A 4CQMA 3KALA 4CUZA 4B9AA 4GOMD 2BLLA 3NM6B 1R12A 3T9FA 4YB8A 1QP8A 4H7DA 5IJZA 4WJZA 3AHGA 2DKFA 3TSWA 1L7OA 1T2FA 3UMCA 3EXG2 1Z5NA 4L07A 1R4AA 3KU1A 4R8MA 3O8DA 4DG9A 3EZNA 2XSZD 2JJMA 1W2HA 5E6SA 3RVRA 1GQYA 4INOA 3AHIA 4W1RA 1DX4A 1P4GA 3A6GA 4MB0A 4C2BA 3FETA 1WCYA 4XYBA 5COQA 1YQQA 1RRCA 4OQPA 1C3JA 4C30A 4MIYA 1XPRA 2RHOA 2BFDA 1YOBA 3RLIA 1W0JA 4WECA 3VU3A 1MXHA 2QRHA 4BKRA 1SVIA 3IDAA 1QM5A 4BUJA 1U2ZA 3OQHA 1ZBQA 2G07A 1DC6A 1E7QA 1ZPDA 1FS6A 4DC9A 4CL3A 4FNAA 4ZO4A 1HM5A 3DAHA 2I2DA 1EDZA 1UKBA 4AX4A 1JQAA 3O21A 4Q9KA 2Q07A 2BM1A 3Q11A 3FWZA 3UM9A 3R3ZA 3M6WA 4OBEA 4P0QB 1DOHA 2AQHA 2GBIA 3QKRB 3QE4A 4N39A 1PT9A 3ML1A 4WHMA 3OPQA 1E1CA 2BH2A 2LTAA 4BNMA 3RFFA 1LBIA 2Z1NA 3CE6A 3S8EA 1YC5A 1ZOOA 1Q15A 3G8CA 3IEIA 1EGQA 1V4BA 3C3DA 4QARA 4YRZA 2YYAA 4FGSA 2EWVA 1E1DA 2P78A 5AXAA 2WB2A 4P5PA 1NVFA 2XUPA 3L84A 1G59A 3QKSA 5BVGA 2WMYA 4R41A 5TEVA 3O8CA 1HRKA 1OV6A 1D6JA 1WUKS 1N6KA 2F9FA 2VHYA 3KKQA 1NI5A 3L1UA 3MTDA 4KXVA 5D3QA 4BFZA 5AVQA 3BT7A 4GC5A 4HWPA 4NZZA 4OVKA 4PNHA 2YJGA 1QAQA 1SPBS 2LXNA 4OHBA 4CF4A 4L08A 2GBFA 3LP6A 4TMZA 2NM0A 3RUAA 1GTMA 1UBHS 5ISMA 3ZQUA 1GY8A 1JHZA 5K4GA 2NTYC 4TYYA 1I2KA 3GUVA 4L28A 4KI7A 1Q11A 3C7CB 2QE6A 5AK0A 3CH7A 3VHQA 1B6SA 4AF8A 2B1QA 2EP8A 3I6BA 4IZHA 4QBHA 4F5DA 1NJFA 5ALSA 1MB2A 3VH3A 1M0WA 4HV4A 1UWCA 2YWXA 4RUKA 5EGSA 1V6SA 4YJ2A 1BYIA 3P1JA 2VDWB 3C39A 5IMSA 3IQGX 1IG0A 5GQSA 3DTYA 4R1OA 2W0MA 2FPPA 3E5MA 3EGOA 3HI6A 2MSDB 4LJYA 2GPAA 3QYJA 2AWOA 1UZNA 4YCLA 3VV2A 3DOHA 2QNRA 4LTMA 3L0OA 3P9PA 4O4JA 1FY2A 1IQPA 1RYBA 2JI8A 2O2ZA 3UAOA 1E7WA 1JMVA 1XZEA 3ELUA 3PHHA 4G5SA 1G9TA 4MV5A 4PSKA 4YONB 4N6OA 4C14A 4Y2GA 2K2WA 5CA1F 2FMKA 2BKUA 3EGVA 4MVJE 3L5OA 2RHBA 2C5EA 4ZPJA 2JIZA 4TTIA 4CLEA 1I3MA 3PLRA 4BLSA 2UZ4A 2AHOA 2BELA 4MS3B 1U8XX 3H8WA 4D99A 4DWVA 1X9IA 3LCVB 4OK3A 9LDBA 4QT4A 3GRVA 3TD6A 4ZICA 1KO5A 2XCLA 1L8LA 3UCFA 3W34A 4RIIA 1LDMA 1IYDA 2VKTA 2MYNA 2XQJA 3U37A 4A6EA 2J3HA 3H3FA 4F71A 5GONF 1I2BA 1JFTA 3LQ4A 2Y1OA 4RLFA 5DBEX 4JV5B 3AJ8A 1MOQA 3OICA 2UU9B 1VJDA 1H4TA 3DFUA 1JXMA 8AT1A 3THWB 1ZP6A 3ZEIA 4G86A 4ZQFA 3OT1A 3KVNA 4OHYA 1XJ0A 1HORA 4BE4A 2PGOA 2N9UA 5E25A 3BH7A 3DHWC 4G85A 1JFSA 1PN3A 3FFWA 3N07A 2X3UA 3B9QA 4IGFA 1Y1LA 2QX9A 3WK6A 2VBGA 3X2EA 2MR5A 4XEUA 3LBFA 3U1BA 1XRNA 1XZ8A 2ZRAA 2ZTHA 3DULA 4XRGA 4QUGA 5GZ3A 1ISHA 1PF7E 3IDOA 3K94A 4F9EA 2HRRA 5CB4A 4CU5A 4JKYA 2RGWA 4JBGA 4YGXB 1M7GA 3BK1A 4DB4A 3AY0A 4OQZA 2EZTA 1TI7A 4X85A 3VAAA 1FS4A 1ZJYA 2UVPB 4U2KA 1TM5E 5DM60 2IXEA 5ELXA 3EVCA 3Q5DA 1KK0A 1CZKA 3A1SA 1D5WA 4HI0E 4XIGS 2EZ4A 3G7UA 1XFDA 1EFPA 1J5PA 5KU1A 5FLKA 1JWAB 4AIIA 2RG1A 5MN6A 1RYMA 3I32A 4MVCA 3HDGA 1A9OA 1USUA 3M6VA 4H7HA 4M99A 4QTXA 4E2XA 1TEZA 2YV3A 3KYIB 1ECFA 1PX0A 2IJGX 3EFOB 3EOBI 2FEKA 1FIUA 3DW3X 4GI2A 4BWVA 2XT9A 1HDCA 1M10A 3ICPA 1I7SB 1N6HA 1PKXA 1OV4A 1UJBA 3E7WA 1A48A 3AJ9A 3G89A 1G63A 1O77A 1S2IA 1SHUX 1GRQA 5J2TF 2JZOA 4RMNA 4AP9A 4DLTA 1H4SA 2MINA 4FTWA 3CINA 2VAMA 4L51A 4TMVA 3ZWXA 4CV1A 4HG2A 5HE9A 4FFBA 3SHVA 3T5BA 3K2BA 1U2RA 2VNIA 5AW9A 2P1ZA 3UG7A 5G1PA 1BGVA 4MHTA 3P32A 1M5UA 3PE3A 2DFPA 4G5HA 1MP0A 2VFAA 3NI2A 3NWEA 2DHRA 3OQJA 3E3OA 4Q9NA 3TE7A 4BMYA 3CB2A 1G7SA 3MTBA 4JC0A 1RKXA 1L7EA 2O2JA 4KPEC 3U7GA 1W5FA 2DQ4A 1MAHA 2CJPA 3R0IA 1UAYA 4GR9A 5D01A 2COUA 3TIVA 2XJ4A 3EQZA 4PZZA 5ALPA 3SIPA 1NY5A 3EA4A 4IIVA 3LCJA 4JYBA 1H42A 2AB0A 1QJCA 1X39A 2H5IA 2PKQO 4GZMA 4B8YA 1O9GA 4C0SA 4E2YA 4L5JA 5FUWA 3M4YA 3U7RA 1QG0A 3FZGA 4DPKA 1ZL2A 1BKYA 4W9NA 4FEGA 5SV2A 1M2HA 1QZXA 5A4IS 1JEOA 2YS7A 3H83A 3DTVD 3EXHC 1VPEA 2QP4A 2HSZA 2OO7A 2ZYUX 1VKJA 3KQKA 5I5YA 2BFEA 2H16A 1CKNA 4IRMA 1TZ2A 1B1AA 3NETA 3GRCA 5LZ5A 2FSVC 3WB9A 1L4KA 3MSXA 3IJEB 4Z4CA 4NMXB 3KUDA 5GONA 3X1KA 1MDBA 4TKUB 1TUGA 1Y1PA 4K6GA 2QZ9A 1RQRA 4O2AB 3C5CA 1KF0A 1R37A 2YMMA 4UUPA 1KOGA 4H3SA 1EK0A 1QVRA 1EDOA 2EF1A 3X3HA 1SFRA 2VZ0A 2R7LA 1A69A 4U2BA 2IVFA 6ABPA 4RHTA 3R2JA 3B6IA 1YULA 4BWYA 4KR3A 1AKYA 3INTA 1PW7A 1KYYA 3KWLA 5E9WA 1WDKA 1JJBA 3QXGA 1G0NA 1QBKC 1HE8B 4TOIA 5K8VA 4AJ4A 3OE5A 5C8DA 2AK2A 3HWSA 3ZIDA 3D5TA 3ETEA 2WUGA 5IH3A 4B84A 1RWBA 1H2YA 3RABA 1NP7A 3U1TA 3QEMA 4AMVA 4NCAA 2YX1A 1YR8A 2HSEA 4PSCA 1HH4A 4CG1A 3V4FA 2RH8A 2QAJA 4LYYA 5F78A 3ZS9A 2LD4A 2J41A 3KD2A 1NYQA 3CLUD 4ZOLF 1Y0BA 4Q3OA 4DLLA 4DPLA 4RY9A 3PEWA 1PJ4A 5U4QA 1S2LA 4LNUA 4B47A 2VQEB 1T5OA 2WTEA 1AHPA 3DO8A 4XFKA 4CM9D 1E2QA 4XFDA 3MWDA 3P97A 4RY2A 1V5EA 1Q84A 1HYEA 5FWAA 1V8FA 4LH6A 1OBCA 1YJQA 1PU2A 3PP8A 4Q7KA 3UA4A 1ORDA 2QTRA 2VT7A 1B23P 3AGPA 4TLLB 3RKUA 3L0CA 4FDLA 1PR6A 5AI9A 3IAEA 3VNNA 1K1EA 1QK4A 3QKWA 1WZCA 4Y1FA 1M2NA 4ZI7A 4GFDA 2XYHA 2REBA 1XYYA 3MIIA 1P72A 2VCEA 4S0ZA 3RS4A 3UJAA 1QU3A 2PA3A 1KI8A 1S1CA 2D0PB 2JIMA 3O91A 1FDTA 5C1IA 4L0CA 3B3JA 7YASA 1BH2A 2ZE8A 3PENA 3DHNA 1H05A 4MCJA 1P0FA 2PRIA 1DGSA 3L6DA 3LUFA 4UUNA 1DAAA 4JB3A 1IWBB 4KFUA 2ZJ7A 4KTVE 4QECA 4FFMA 5EPUA 5EYPA 3EPRA 4JUAA 3ZE1B 2IQ5A 2JIQA 4ZYTA 1TA8A 3I9KA 3T7RA 3Q2IA 3B1XA 1FPQA 3KFLA 1DIOB 1RKQA 2IU4A 2VF4X 5H3HA 3VBCA 3JY6A 3RW9A 1J97A 3QI2A 4FKBA 5H5JA 2FZ4A 4QELA 4B6PA 3TW6A 1CDDA 1YVRA 3A04A 4QG7A 3QMPA 3P2JA 4EL5A 1QGUA 4ZDKA 1KMQA 5CVDA 1PR9A 1PZFA 5KYTA 3ONWA 1IVNA 1RP1A 1ZD3A 2B92A 1E6KA 1LDEA 2WE8A 3DL4A 1SQ0A 2D62A 4EG0A 4KXLA 3E7XA 4V39A 3H05A 5EJ8A 1ZMRA 4O7ZA 2JGEA 3CLRD 4CT5A 3SM9A 1TO2E 2UYYA 2IY9A 3L0YA 2ZYIA 4UFOA 4M8KA 3D5EA 3M9LA 4OV6B 1USWA 3NHSA 4P31A 4K6CA 1YZYA 2IOQA 4N5HX 5K3AA 3KUCA 5I7FA 2RBEA 4G65A 3ZW7A 5C4IA 1EX6A 2VK8A 1OU0A 4Q12A 2ZAYA 4TUYB 1C14A 3MTQA 1X6VA 3ZJYA 5ERYA 1BE8A 1SCQA 3FX2A 4PAQA 1KI4A 3AR3A 3U26A 2UZ1B 1XDWA 2ZYGA 4PLYA 5ALEA 4EI9A 3VZSA 1X77A 2BJWA 2CN1A 4BNGA 2QYTA 2DAPA 3EMBA 1T0BA 3GOQA 3K31A 1NASA 3KDPA 3W3AH 4P80A 1F5NA 1XA4A 1GGHA 1ZEJA 3LMKA 2HVRA 1ORIA 1LD3A 1SZDA 4NONA 5D87A 2PS1A 2WWYA 4I8IA 4OFBA 2P3LA 1FXWA 1Q3TA 1TCAA 3HKEA 4O86A 3S70A 4D4IA 1QHXA 2M32A 4U7DA 1OZFA 1SUFA 1JT2A 1I2MA 2PO5A 4A6PA 1R00A 2GF9A 2LUOA 2RGUA 2VZEA 2WF7A 2J59A 5I4CA 3EZ6A 4F2PA 1J2YA 2DR2A 2CE2X 5JADA 4PGFA 5C5IA 4LRTB 4UPEA 1TECE 1TZKA 4KXXA 3TLYA 1I9GA 1KFEB 1SQSA 3O4VA 4ZOQI 2WPDA 1ISMA 5AO9A 1DI0A 4KP7A 4QXMA 4CV2A 4TS3A 2IEBA 1URPA 4D82A 4DJJA 3NONA 1X2BA 2EFJA 2HCJB 2GZ1A 2PGXA 2ORVA 4X1YA 5CDSA 3LUBA 1JSZA 3R77A 4GHWA 5AJUA 4D8YA 5LMUB 3NBQA 1WZEA 2G77B 1YASA 3H7IA 2V6JA 3FCEA 3NRBA 4I6JA 4NG4A 3VMFA 2OBXA 1XVLA 4RF2A 2VTDA 1MIOA 4WFJA 2IOFA 2MMGA 4J4TA 4RS4A 4J0CA 1XZLA 3D0KA 5CLGA 3ROGA 1CEQA 3CRRA 4JP3A 5ITWA 5KYNA 3ZE7A 1CTQA 2GETA 4KPYA 1BU8A 1GAQA 5HEKA 1WD7A 3AR7A 2UZIR 3G8BA 4TV9A 1P80A 4WCFA 3ZGXA 1KQPA 1APBA 3IKLA 2DMRA 4J76A 5KKNB 1MNQA 3IH5A 4DC0A 3C8HA 1S02A 3AKZA 4LFAB 3WP1B 4P32A 4WGGA 4WCFC 4RTQA 3OU7A 4KOEC 2QU7A 3SZMA 4C0WA 4YPOA 5LYYA 4I1PA 2IBSA 3EYWA 3QBEA 2XE4A 1KNXA 1LVGA 4OHRA 3AVYA 5T3YA 1A9SA 4UPVA 4OD0A 2OPBA 1CHDA 1GLGA 1IRXA 1SR8A 1DEAA 2BF7A 1V7CA 1D4FA 2HIXA 1U6KA 2IZ1A 1WHTB 3KLOA 4MVJD 4LK3A 3VU9A 1NQTA 4AZTA 4DV1B 4J0DA 2Q4DA 3JZIA 3KNZA 4PLZA 1K0UA 1T9DA 3VR0A 4D8UA 3USZA 1FX0A 1CS4C 3NC4A 4RC9A 3K2QA 1FDOA 4GLLA 1XMVA 4XYMA 2OOKA 4UCXA 4AZVA 1B41A 1X1CA 4IDBA 1L7XA 3ANTA 3AFGA 4MKZA 4O4LB 2J1LA 4ZP1A 3SAJA 3QNUA 3KPYA 1P62B 4M88A 4EVQA 2WVAA 3F47A 3KYDB 2HPVA 2C2XA 4JA2A 2IUYA 2BR4A 3IS3A 4MA5A 4DRFA 4JSYA 1EG7A 4M0KA 4YT5A 1U8EA 4X90A 2GXAA 3IAAA 3SNHA 4HWRA 1C5KA 2QVXX 3BBLA 3F9IA 1P2VA 3K1YA 1PGOA