4FFRA

Semet-labeled pylc (remote)
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
355
structure length
347
Chain Sequence
MKTICLVGGKLQGFEAAYLSKKAGMKVVLVDKNPQALIRNYADEFYCFDVIKEPEKLLELSKRVDAVLPVNENLACIEFLNSIKEKFSCPVLFDFEAYRISRDKKKSKDYFKSIGVPTPQDRPSKPPYFVKPPCESSSVGARIIYDDKDEPDTLVEEYVEGEVVSLEVVGDGSHFAVVKETLVHIDETYDCHMVTPLPANPLFRQISHDLAANLPLKGIMDVEAIFGPKGLRVIEIDARFPSQTPTVVYYSSGINLIELLFRAFTDGVEEIENKYCIYEHLMFGENGVLIPVGEQVLSMGSDYGKFYEEPGIEIFLCKGEYPVFTMVFWGKDREETGAKRCKGLSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PylC
publication title Biosynthesis of the 22nd genetically encoded amino acid pyrrolysine: structure and reaction mechanism of PylC at 1.5A resolution.
pubmed doi rcsb
source organism Methanosarcina barkeri
molecule tags Ligase
total genus 112
structure length 347
sequence length 355
ec nomenclature
pdb deposition date 2012-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02655 ATP-grasp_3 ATP-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 4ffrA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4ffrA01
3VPSA 1IE3A 1LTHR 1OAAA 5GZ6A 3TN7A 5IFLA 3DDNA 2NVWA 4GSKA 3I4FA 1ARZA 3DOJA 4A5OA 2FR1A 2RAFA 5T8KC 4OSOA 1U3VA 1PGJA 1PGOA 2HKIA 3QA9A 4HADA 4S3MA 2V6FA 3NJ4A 3LT1A 3D3WA 1YL7A 1NWCA 3GVCA 2W6ZA 4NIMA 3I9LA 1ZO8A 1Z2PX 2NU6A 1P45A 3M1AA 4O7RA 1V3TA 3O8QA 4D44A 4YAJB 3CUKA 1GEGA 1DB3A 1FXSA 4IIUA 4IQ0A 3OJEA 4RLHA 2B83A 3RUFA 1DFHA 8LDHA 1Z2NX 4WEOA 4K9DA 3GEDA 2VHVA 1X1EA 2CVQA 4MIYA 3X2EA 2PZLA 1U3TA 4GMFA 3GEMA 4CV3A 2GDZA 1HDOA 4O4LF 2YS6A 4JBGA 2HU2A 1C3OA 2X9VA 4AJOA 2NU6B 3O8QB 2C2YA 3RIHA 4E12A 4BVAA 1ZJZA 5AXDA 3HO8A 4BMVA 5DOVA 1MG0A 3W8DA 4YVFA 3ORQA 1P1RA 3PYMA 3BA1A 4MV6A 2I3AA 3CIFA 4IDEA 4MKRA 1G1AA 2FPGA 4GH5A 4HXYA 4Q3AA 3RFTA 1EK5A 3ZHBA 4NPCA 3ZWVA 3VZSA 4BNYA 4RZIA 3AWDA 4GX2A 3VPHA 4XB1A 3KREA 4J1QA 2IEBA 2FWMX 3GVHA 1O0SA 3OEWA 5THQA 4IMPA 3TF5A 3OQBA 2FPGB 2DBVO 1LC3A 1XDWA 4YA6A 1AXGA 2Q2VA 3AI1A 4JJFA 4Y6RA 1L7EA 5JW6A 5JVDF 4IXWA 4ZQHA 3WQRA 2UAGA 3HJAA 2R7LA 3KVOA 2NTJA 2NV6A 3H2ZA 4QXMA 4FGSA 4CM9D 1ISMA 1PTJA 3QWIA 3C8MA 1H6CA 2VQ3A 5LC1A 3TZHA 1JAYA 2W6QA 1OOEA 2I3GA 3HDQA 4IDDA 4DBZA 1EDZA 3H6KA 3MJEA 3ENNA 3IP1A 3RC9A 4L1KA 5JBIA 3WJAA 3PQDA 1E1KA 1LSUA 1X14A 2VPQA 2PLAA 4E5NA 4MV4A 5JQGF 2C54A 1HYGA 1UXKA 5JH7F 3GF4A 2VRCD 1XYGA 5KVQA 1EMDA 3FTNA 1ZK3A 3QIVA 4JK3A 1ONPA 5HBRA 1YKFA 5ENDA 3L4SO 1HE2A 2WD7A 2BH9A 1DIHA 3RJ5A 5DN9A 2YZNA 1LNQA 3DFUA 3K5PA 3HN7A 2J3IA 4B4UA 3NDRA 1Q0HA 1C3VA 3D4OA 3W1VA 1VBHA 3VZRA 2QG4A 3H3JA 4O5OA 2GQRA 4D3DA 3I6IA 3FBTA 3UH1A 3PI7A 1GUZA 5HBRB 3E1KA 5CDTA 1KC1A 4CUZA 1A7KA 2WD7B 1E7RA 2ZJ0A 1GYRA 4CQMA 1EE9A 1P1KA 5T57A 2YZMA 1B8VA 1MLDA 3FPLA 5ENVA 1RYEA 3JZFA 4MIOA 4WCFA 3GEGA 3JD4A 3S55A 2POQX 3G0OA 1N7GA 2AA3A 4FFLA 2P9CA 3GGGA 4FN4A 4XIJA 4PLVA 4Y8VA 3C24A 4KUHA 2ZTMA 3DMTA 3SJ7A 4BNNA 3PVZA 4NZ9A 1E92A 4BNLA 4F3YA 3W4KA 1CERA 4CQMB 3ROQA 3S2GA 3U62A 6ADHA 2J3HA 2DQ4A 3RVDA 3ZZNA 4WCFB 2BHLA 3RUPA 2Q50A 2YV2A 3OJFA 4OXNA 4BO6A 5A04A 1GCOA 3QQPA 4ND4A 1ISHA 4BNTA 5J2TF 3GT0A 2Q4EA 3QJ5A 5JY6A 1MV8A 3PWKA 1BDBA 1PGQA 1BHSA 1EVZA 2H9IA 3PHJA 3INTA 5FEUA 1YBMA 3HFGA 2EV9A 2ZJ1A 1HKUA 1BXZA 3M2TA 5CEEA 1YJ8A 2QRLA 4PN3A 3STHA 3FCOA 2NU9A 4DLKA 5CG1A 4BB6A 3GDOA 1NVTA 4XQ9A 5FI3A 5JCXA 5JFOA 1Y9EA 3EYWA 4XYEA 2GR9A 4HNGA 2HRZA 1BXKA 2QK4A 4URFA 4O7NA 2YJZA 1QP8A 2X86A 3VOSA 4KQXA 3KSZO 3PWZA 3VAZA 1QORA 3KYCA 5JMWA 5DBFA 1ZMOA 9LDTA 1E3WA 1QYVA 3RBZA 2XXBA 5TJ9A 1IOVA 4O6VA 1K0UA 2V7PA 5C7LO 4IHJF 1Q7GA 3H9GA 2NU9B 1Z45A 3NT2A 4GGOA 2OXIA 2C20A 4R3WA 2ZCUA 1Q7CA 1X15A 4XYGA 2IODA 1X13A 1KVRA 3EDMA 4CMEA 1RWBA 2EGGA 4L9RA 1A9ZA 5TLSA 3AU8A 4BGUA 3QVTA 3OQ6A 2EEZA 3KYCB 2GN9A 3NT4A 5H83A 3H8VA 4UEJA 4MVJF 4XGNA 1ZIDA 2IDZA 3IDSA 1E3WB 3PJFA 2WM3A 4ILKA 3TQHA 3DZIA 3R1IA 4MIEA 1HE5A 4BQPA 3NUAA 1B3RA 4YRDA 3ANMA 3NTRA 5C1PA 4CM6A 4BNXA 2FOIA 2Y1GA 4O7TA 3Q1LA 2YHIA 3UCEA 3NV9A 4AJNA 3FR8A 5I9MA 3COSA 2BFMA 1EYZA 3VVCA 5IG2A 3NT5A 1E7YA 4I50F 1PZFA 4U6SA 3Q11A 3TSCA 2CUKA 4YJ3F 5HRUA 1E3LA 1EVJA 1F0YA 3H9JA 3RUEA 1LA2A 4FQ8A 4E33A 4NR0A 4A26A 4LSWA 1XEAA 1ULSA 4O0LA 1HYEA 4QO8A 2J5KA 4ZQBA 3VHRA 1KUTA 2YHIB 1IPEA 1V0JA 4FFOA 2P91A 4BB5A 3R23A 1WVGA 1OI7A 2I87A 4DYDA 3WX0A 2FR0A 1QKIA 4YT8A 4J49A 4KMSA 4RF3A 1ZUD1 1YOVA 4F46A 1P1IA 3ZWBA 1ZH8A 3JQDA 2W70A 4CL3A 2PA3A 4E21A 4S1VA 5C1OA 2FMUA 4ZQFA 1JN0A 3G49A 3PPIA 2VNAA 3H4VA 4TV9F 4B79A 3PEFA 5A9SA 3RSHA 4TMFA 3D5TA 4X54A 3V8BA 3U9LA 2W71A 5KKNB 1YDEA 4XR9A 3R5FA 1WLYA 2BGMA 1FJHA 1YOVB 2HAEA 4JQCA 1LBEA 1JVBA 1MG5A 4RF5A 3VH2A 4PRLA 4DLBA 3PWSA 1UZNA 3RUIA 3AOEA 4ROSA 1R37A 2QYSA 5A9SB 3DR3A 4I5EA 1CF2O 3I9JA 4IJUA 3TJRA 1HDRA 3CH6A 2PWZA 2H5LA 4BV8A 3PZBA 1N8KA 2DZDA 3GQVA 4JNKA 3WGZA 2UUPA 1UDBA 5HWSA 2X22A 4ZOLF 1BXRA 1XSEA 3AM3A 3PGXA 5DCYA 2EG9A 3AJRA 3F5SA 4HBGA 4M86A 4J7CA 3VA7A 4Q9NA 1AUVA 3H9EO 4A27A 2DFVA 2EP5A 2B4RO 3ZHZA 4YYZA 2DT5A 3ONDA 5DP1A 5LDHA 2X0NA 4DC0A 1TI7A 4NNJA 2BGLA 1X0XA 1YL6A 5FWNA 2X58A 5KJ1A 5T64A 4P4LA 2UVDA 4M1QA 1DRVA 2O3TA 3S2FA 1TEHA 1XG5A 2HLPA 3DBLA 4J4HA 3QLJA 4TQGA 1EVYA 1M67A 5U1PA 3WGGA 4E13A 4W7HA 5GY7A 2VYVD 5F3RA 4MKZA 3JRXA 1ZZEA 1W93A 3GFBA 3QWAA 5G4LA 2OGUA 3DAPA 2HJRA 2XPCA 2A92A 3DO5A 1YQXA 4W9NA 3SVTA 3HE3A 4FB5A 1DAOA 2Y0CA 3M1LA 3N58A 5K9ZA 3QRWA 3ROMA 3DBLB 2HMSA 5TGDA 1U9JA 1OFGA 2CF5A 2BFPA 3CEAA 3DHEA 4K28A 2PD6A 3KV3O 2NQTA 2PH5A 1PIWA 3CMCO 2GLXA 5ICSA 3PJEA 3DBRA 5JY1A 2DBQA 5TF4A 4CMCA 2CDBA 4UVDA 3JCZA 1VLLA 2CFCA 3JQEA 4H15A 4FU0A 4Q3NA 4BO2A 1CYDA 2W6MA 4D3FA 1MA0A 4B3HA 2D3TA 5A03A 3KZVA 4PLTA 4TZTA 4DREA 1GADO 3LT0A 3PHLA 3ULKA 4CLHA 2IZZA 2GSDA 3DBRB 2PKQP 4YT5A 4PGFA 3OJ0A 3N7UA 2OOSA 3DOCA 1MFZA 3ZDFA 3ZWAA 2OL4A 4KP7A 3F3SA 4WLVA 5FYDA 1HL3A 4AJPA 4BV9A 2BI7A 3LT2A 3PIIA 3VVBA 2CY0A 2C5AA 2ZTLA 2EKLA 3I9KA 2Q99A 3BMNA 1R12A 4BKQA 5BNTA 2ZQYA 3FNHA 3KSDO 5EESA 1NNUA 3C3XA 1GUFA 2G76A 2RHRA 3O03A 1DO8A 3G17A 1H5QA 4NFHA 3TL3A 3VPXA 1IUKA 3RFVA 3ETJA 3S1LA 1O95A 3TPCA 5KKAA 3SJUA 4DLLA 3ON5A 1IOWA 2GO1A 1Q7BA 4JCOA 3WTCA 3JQFC 4DUPA 2DPGA 2PV7A 3Q6IA 3GLQA 4YACA 1S6YA 4BNUA 4P38A 3ZNPA 3JYOA 3L4BC 1NAIA 5JQWA 1PGPA 1VJ0A 1GV0A 4G2NA 5F5NA 2ZB8A 1XLTA 1ORRA 2FZEA 4RZHA 3E9QA 4QEDA 4ZA2A 1AHHA 1MGOA 3UF0A 2Q4BA 2B4TO 4RQTA 3TOZA 5L40A 4JIGA 1BTOA 1XELA 2VWHA 3AFMA 4PLZA 2ZIZA 4YTEA 1I33A 5BSHA 1DC3A 1E7SA 1UZLA 2Y1EA 3OJOA 4RCVA 4N18A 4ZVVA 3FD8A 3DC2A 3AY6A 1VM6A 4J1NA 2YUTA 3S8MA 1P1JA 2C07A 2Z02A 3D64A 1A27A 3RAJA 2AE2A 4J9UE 1V9LA 5JC8A 1U4OA 4RO0A 4DQUA 4L0QA 2I66A 3L77A 3ZWCA 2X0IA 3BTVA 3E6AA 5KKCA 3BMQA 3KO8A 3MEQA 3K92A 4AFNA 3INGA 3NYWA 3Q9UA 4IINA 1JKFA 5I8ZA 4J2HA 2Q2WA 3ANLA 3F47A 4R9SA 3U55A 1VBGA 1LLDA 3Q3CA 3RFCA 2CNUA 4MDHA 2PD4A 2Q46A 2WE8A 2OMEA 4JBIA 2LDXA 1TA4A 1RJWA 3BMQB 2GN6A 4OMUA 3GA0A 3TFQA 1C0PA 4FFRA 4MP8A 5B4TA 3GG2A 2QZ9A 1NR1A 1F8GA 4MVJD 2A35A 1XWFA 4TSKA 4EITA 4QUKA 2QRJA 5CDSA 4F6LA 3HDJA 3P5SA 2O3QA 2Y68A 4DLAA 3JQ9A 3DB2A 3D4PA 2AE1A 1Y9AA 4R16A 3I5MA 1CJCA 3OJLA 2H63A 1EUCA 1YL5A 1O5IA 4IZHA 4P22A 5JYEA 3R6DA 2PR2A 4JJGA 5C7IO 5C37A 1DBVO 3JQBA 2IE0A 3GGPA 1NVGA 4P8RA 3RCBA 1DOHA 3AFNA 5CPFA 1QMGA 2RIRA 4R68A 2I80A 3JYPA 4EG0A 4WASA 3HQ4O 2B36A 3PXXA 1PWZA 3JD2A 4CL8A 1C0LA 1EUCB 2RH4A 1U5CA 2EW2A 2Y99A 4H16A 2WTBA 2FHSA 1JWBB 4ZICA 3VZPA 4WNIA 4TKMA 1O8CA 1E77A 2O23A 2O2SA 2ZB4A 4E6PA 3N6RA 1IZ9A 4IJWA 3U4DA 2JCYA 2QQ5A 1GY8A 2UUOA 1E6WA 1P1HA 1NASA 4D0SA 3V2GA 4EGQA 1ZSVA 3MTJA 2V59A 4O63O 3UFXA 1NYTA 3CTMA 3WBFA 2Y0DA 1LDYA 3HZZA 4WUVA 2IZ0A 3G8DA 1DIBA 1HDXA 4HFNA 3OIDA 3TZ6A 2Y1FA 1LDBA 4J91A 5CB4F 4NQZA 3WICA 2GNAA 2PZMA 2NM0A 1N1EA 4IZIA 4YB8A 4L4XA 1B0AA 1O89A 1LJ8A 1T25A 2XAAA 4XR4A 2NU8A 5BQFA 1NVMB 3O9ZA 5HS6A 1ZCJA 4DWVA 1KBLA 1EUZA 3P2YA 3UFXB 4XYBA 1YJQA 4KZPA 4MP6A 2VUUA 4FGWA 4EGJA 1GTMA 4ZQEA 3WYBA 4BKOA 3JRWA 3WO0A 2VWQA 5THKA 4B4VA 1Y5RA 4BNFA 4PG8A 3WWZA 4BO0A 4XGIA 2GGSA 1H6AA 3I9OA 4MKXA 1PJTA 2ZYDA 4Z0TA 4YB8B 2EJWA 2NACA 1PS9A 1HEUA 1JQBA 4XRRA 5IXSA 2NU8B 2VHWA 2B5VA 1SEVA 1GD1O 3CMMA 3WYCA 3ZU3A 4IJVA 4E5KA 5JE8A 5FNVF 4EGFA 1CS0A 2VNSA 4BGEA 3JQ8B 2OBNA 3IJPA 2I5PO 2J8ZA 2DTXA 1RYDA 3CINA 4BKUA 4ZGWA 2GD1O 1YXMA 2QZZA 4Z9XA 2JAHA 4AJ4A 1GUYA 1AE1A 3T4XA 2YY7A 3RFXA 2P9GA 4L4SA 1M6VA 3DOOA 2I9PA 1PQUA 3GZNA 1V6AA 2GASA 1VKNA 3UCFA 4PG4A 5KJCA 4Q3EA 4RPHA 5DBIA 3JQAA 3HNPA 4C5CA 4O4JF 5JC1A 3KXDA 4PFJA 4I55F 2D8AA 1UXIA 1MB4A 4YAJA 2OLSA 1HLPA 3TZCA 3ORFA 3GIDA 3GZNB 3LQFA 4R1UA 3JYNA 4ZHSA 4HFRA 2DUWA 2FB9A 1F8FA 2YYYA 3BZUA 1VL8A 4UAGA 2YW2A 3JV7A 3ITKA 1OBFO 3JQAB 1LLUA 3RUCA 1G0NA 5AXCA 4GVLA 4OXYA 4L8VA 4EEZA 5FF9A 2O3RA 4EJMA 5MDHA 4RVUA 3KSUA 5IAAA 4BNZA 2D59A 4BNIA 3H5AA 3HB4X 3C1AA 3CE6A 3VH1A 2X5KO 1H2BA 4FOSA 2X5JO 1GQ2A 1PZGA 2PTGA 2P4HX 2NUAA 3I9NA 1NFRA 5C5IA 3WIEA 3D5QA 1SCUA 1Z7BA 2YDXA 3GGOA 4WK6A 1U8FO 5LCXA 4XD2A 4R9RA 3WLFA 4WLOA 4Y67A 4YEDA 4MPDA 1IHYA 5TJHA 1XGKA 1U28A 5L7YA 3F5QA 3I3OA 3DHYA 3ETHA 3DZKA 4PRKA 1DV2A 4OYRA 2TMDA 4PLCA 3ICCA 4YJFA 4YQYA 3QP9A 2NVBA 2NUAB 2ZCVA 3GPDG 2C59A 3JQ6A 4UULA 3DZJA 3GVPA 2EF1A 4ALJA 1WP4A 1UP6A 1I3NA 2R00C 1I7LA 4CLRA 1SCUB 3HUDA 1QYXA 1EDOA 1S7CA 3VC7A 3B20A 3U0BA 4YCAA 1XIVA 4KDEA 1UXGA 1HWYA 1P31A 1AUPA 4R01A 1GPJA 3IS3A 1EBUA 1KETA 4W4TA 4CUKA 2WD8A 4RV9A 2C29D 4EBFA 4UUNA 4YJFB 1LDEA 4OO3A 1IZ0A 5GZ3A 3GHYA 1B15A 1PK8A 4ZD6A 4CLRB 3K6JA 2BFAA 1I5RA 1KY5A 4YAIA 1PX2A 4PZEA 1YH3A 2QF7A 4BO7A 1JDBB 4J90A 1DRWA 1LEHA 5IN4A 3U4CA 3AX6A 1N7HA 4CM5A 4NMHA 3OMLA 4HKTA 4CJXA 5F1OA 3RBVA 3H9QA 2AEMA 1M66A 3Q1KA 4LCEA 3AM4A 4XB2A 2DVMA 3IC5A 5L4NA 1PJ4A 1C14A 5GONF 1I3LA 4K1LA 1NFQA 4TWRA 4XDYA 4RPJA 2CNQA 5AXAA 3AI3A 4FPXA 2NU7A 1FMCA 1BW9A 4ZQIA 3BAZA 2W2LD 3PDJA 3EK2A 4E31A 1CQIA 1GGOA 4GL4A 4N7RA 1Y81A 3K3PA 2H1SA 1ZNQO 2HMWA 3IL2A 4WLUA 5EPOA 5BT9A 1H9AA 1JTVA 5G0VA 3ETEA 5JDCC 1DC4A 4TZKA 3IP3A 3PLNA 3ZWNA 3CZRA 4DMMA 4E5PA 1LUAA 4U8GA 4GBJA 1SEPA 5JPIA 2NU7B 1Q2XA 1BW9B 1FDUA 3AUAA 4BKRA 1I32A 4O7VA 5L9AA 1CQIB 4YQZA 4ALIA 1Q1NA 3Q2KA 3PJDA 3SC4A 4LVUA 3MJTA 3H9UA 3ZNQA 2DKNA 1A71A 1YB5A 4YJ2F 2I65A 1Y5MA 3NDJA 3UOGA 4CMHA 5JS6A 1KEUA 1KC3A 1HE4A 1XR3A 3I4CA 1NBOA 3ZWOA 3KRTA 4ZQGA 1XQ6A 1CRWG 4MA5A 5DBGA 1YGYA 4H7PA 3R3SA 2O48X 3JD1A 4YR9A 1HYHA 4D3SA 1V8BA 5KVVA 1PS8A 4G81A 2RCYA 5L51A 4TV8F 3UVEA 5JDIA 5JAMA 3JSAA 2VHXA 1RM4A 3FF4A 2V6MA 3MWDA 3K2EA 4IDFA 4TKLA 4O7ZA 1VKZA 3GNQA 3GK3A 4A0SA 1R0KA 1B6RA 4HNVA 3B1JA 4RORA 5TQVA 3UAGA 5IDYA 3ZWPA 3RC2A 1F06A 3GMSA 1KC7A 1MC5A 2GPWA 3OHSX 1C1DA 5BR7A 3KAJA 2YRXA 2JJYA 1LX6A 4O1MA 3O4RA 3MWEA 1BVRA 2O3SA 3WQSB 1XHLA 2ZB7A 3FHLA 5IXYA 5JVLA 4QFCA 1BXGB 1UAGA 3VPBA 3MWDB 1T36A 2NLOA 2VT2A 4Z3DA 5KJ6A 3H3FA 4JX8A 4ID9A 3F4LA 3V4ZA 1ZBQA 2VUTA 4CM1A 3JQFA 3GR6A 3GPIA 3NRCA 4Z9YA 5JCJA 5F5LA 5J23A 4RVGA 4LMPA 4DA9A 1CIVA 1C1DB 5DCUA 1ZMTA 1Z74A 3DQPA 1P33A 3GVXA 4CLXA 2OP1A 3L4BA 2GPTA 4DTIA 5A06A 3MWEB 1RKXA 5HTOA 3GH3A 3ASVA 3MJVA 3M2PA 4MAMA 2Z1MA 3U49A 3QV1A 2B69A 3WGTA 2BI8A 5JMPA 3IKTA 2W6NA 5DNAA 4GQAA 4N5LA 2QIOA 5F1PA 1PJQA 2R2GA 3RUHA 3OEYA 4JROA 2VTEA 1DDOA 4GKBA 4IIVA 5COAA 2VWPA 5L4SA 5A3JA 1GFSA 1EZ4A 4WGGA 1B8PA 4IDGA 2VHYA 3PQFA 1W8DA 5T67A 3OIFA 3ONEA 1WAMA 4W82A 4UVEA 1DIKA 1LXCA 3FSRA 8ADHA 4IPTA 2P2SA 3OA0A 1DIRA 4DC1A 1CDOA 2P0AA 2QHXA 4Q3DA 3JZIA 3C85A 1QYDA 5EJ2A 3LZ6A 1I8TA 4RF2A 3I12A 2Z95A 4YRAA 3ADPA 1U3WA 4GWKA 1QR6A 3EVTA 1K6JA 2FY8A 1ENPA 4U0JA 4BOYA 1LU9A 3ZV3A 4NBUA 4D0RA 3BMOA 3E5RA 4HFMA 2HMTA 4GX0A 4OL9A 3CSDA 2OORA 1ZK0A 4EI2A 1N1GA 1NR7A 3R3JA 4XX0A 3WNZA 1ID1A 4O86A 1J0XO 4Q3CA 3B1FA 4N54A 4I4TF 4Z0PA 2GQSA 4IS3A 2DFDA 2PD3A 3E03A 1K5HA 4R5HA 2IXAA 2EIHA 1NQ5A 3H2SA 1F14A 3KB6A 2OBYA 3ZHYA 1BG6A 1BSVA 3PTZA 3BIOA 3U4IA 1E7WA 3GUYA 4AJEA 3BMOB 4B7UA 5ITWA 4ZRNA 5CEJA 4XX0B 1LDGA 1DJNA 5CHEA 4ZJUA 3DAFA 1K89A 4NU5A 3K5HA 5F1KA 3WBBA 3WQQA 5CPBA 2R7NA 5EZYF 5LP6F 1ZFNA 2LDBA 5CP8A 1GYPA 3H5NA 3RD5A 1I2BA 3KLPX 4F6CA 2Q1SA 4EEXA 2PK3A 3AUTA 4OSPA 1EFLA 4EUFA 4OKNA 5IZCA 2IRWA 2JFFA 1DC6A 2BLLA 3K5IA 2RBEA 3MJ4A 3HFSA 1E3IA 1E5LA 4PLFA 5G0UA 3VMMA 1UDAA 2CNVA 1ZKMA 2HJWA 4IDCA 4ESOA 1QSGA 2PGJA 2Y0EA 2A94A 1HDZA 1HLDA 3GG9A 4L75A 1FDWA 2G5CA 3JQGA 5ILOA 1DV1A 3R0IA 5DDIP 1LLQA 4CM7A 4AJIA 5KJFA 2IYPA 3GUCA 4MV1A 1QLJA 5I7VA 4K26A 1WNTA 4CMKA 2NVUA 5DOZA 3NTOA 4RVSA 4QT0A 3BMCA 5BNIA 4BQRA 4R4JA 1PZEA 3I6QA 3GDFA 4NH4A 2B0JA 2VUSA 4OIMA 3FR7A 3RQSA 1P3DA 3WTBA 4PG6A 4ND5A 1JVSA 1WPQA 4OQZA 3IIEA 3C7AA 3JQGB 1EUDA 2HK9A 3GNSA 5CAEA 3NKLA 4AVYA 4FJ1A 2YFQA 3JQ7B 1UP4A 2OUIA 3FBGA 4YJDA 2NVUB 3FNEA 1M2WA 1ZSNA 1B3BA 4R5MA 2VYND 2WYUA 3BMCB 4XQEA 5EQFA 4GVXA 1PGNA 3AUUA 4U6QA 2PH3A 2V5AA 1ADFA 2WDZA 2DM6A 3BHJA 1ISIA 4CM9A 3ZU5A 5IDWA 5KTKA 5EERA 2BMAA 2GCGA 1EUDB 2JCVA 3IMFA 5CAEB 1MC4A 3WWYA 1ZSYA 4I9UA 3ZV6A 1GL3A 4LRTB 1Y8RA 4BIIA 5CA0F 1SAYA 2ZKLA 1I01A 5GZ1A 2R84A 4OJNA 4INAA 3ZW8A 5F21A 3AUSA 3LDHA 2GLTA 5KX5F 1PL6A 1B2LA 1ULUA 3RBXA 5A4DA 1M76A 2D5AA 5IZ4A 4YRBA 2Q2QA 1T2CA 2CSUA 3LU1A 3BTSA 4GLOA 5T6BA 4BNWA 4HQ6A 4QO7A 2VRCA 4GSLA 3IJRA 4C7JA 4E5YA 2IXBA 4W99A 1Y8RB 4HFJA 4W6ZA 4HNTA 3RROA 4B8ZA 4E32A 2BELA 5KCZA 5J2UF 3KLMX 1C0KA 5A5EA 1UR5A 2I8CA 4KTVE 1X0VA 1X7GA 1SNYA 1PQWA 2AQKA 4KDFA 5FI5A 2WWRA 1KOLA 3O38A 2DIKA 3EGOA 4QECA 2Z5LA 4DIOA 1WXDA 2AHRA 4L74A 3HN2A 1I24A 4Y9DA 4I08A 2P68A 2WSBA 1RM5A 3E18A 5AYVA 4IMRA 4DL9A 4XRGA 3D0OA 4WE3A 4XJTA 3K9QO 1HDYA 3W4JA 2Y05A 3BHMA 1JU9A 2J6IA 3LLSA 5T8KA 3P19A 1K6XA 4E4YA 3JYQA 1JDEA 4TRNA 3W8EA 4J43A 1LQUA 1QYWA 1I0ZA 2O7QA 3OBBA 3OH8A 4CMGA 1ADGA 1SOWA 1TVEA 2C7GA 2HK8A 3OP4A 3U9SA 1EHIA 2B35A 4B4OA 4ZN6A 3L6DA 2HDHA 1BDMA 4FFMA 3K2BA 3BG5A 4M9UA 4II3A 3HADA 1IY8A 4BO1A 1GDHA 3V1YA 1FK8A 2JFGA 3PHGA 2X23A 2V65A 2O4UX 3ZV5A 1CQJA 1H93A 3VPCA 4OH1A 2RHCA 3GAZA 3CKYA 1KJIA 2NTVA 3CZMA 4E2WA 1U5AA 3PRJA 4LMRA 1R16A 1YB1A 5BPFA 2G0TA 5A1TA 3N74A 3MTGA 1DLIA 1QRRA 5BPHA 5A02A 4CV2A 3SLKA 3WGHA 1HDCA 4DIBA 7ADHA 3OETA 3MJCA 3SC6A 5MGBA 3DMTC 3RV4A 2P5YA 2YV3A 1E3EA 1QV6A 3U4HA 4XYLA 1CQJB 3ORRA 3V1UA 2BD0A 1TLTA 3GVIA 4MOWA 3VZQA 2D5CA 4ND3A 4K6FA 4OKIA 3KTDA 4MVJH 1YRLA 2R85A 2PKQO 1SPXA 1PJSA 1R4MA 5EMHA 2R86A 1CWUA 4M54A 4B4WA 1E3SA 4J7UA 4E2YA 1DJQA 5EN4A 1HRDA 4RPLA 3FWZA 4ALNA 4U7WA 1MX3A 4LN1A 5KVCA 3M6IA 3H5RA 5TX7A 1A48A 2GPSA 2P4QA 4IBOA 3E5NA 4HY3A 4XYLB 1A72A 4B7CA 3G1UA 1LDMA 4ALKA 4G65A 1ZW1A 3D3EA 4LK3A 2A9FA 3LLVA 4EYEA 2FP4A 1OBDA 3TFOA 1R4MB 4FBGA 5HM8A 2VRBA 3ZWXA 4OOFA 5I9NA 4RDIA 1JDJA 2EHDA 5B4UA 5BNFA 2B5WA 4NYEA 4JGBA 2X9GA 5A3VA 1UP7A 1P9LA 3HB5X 2NSDA 4M87A 1A9XA 3TRIA 4Q3BA 3GRKA 2FP4B 5B1YA 1E6EA 1AN9A 4BO4A 1IULA 4ZRMA 1EE2A 1XKQA 4CMEC 2X0SA 4J1SA 3W8FA 3Q2OA 5JDCA 1JKJA 3PYLA 4L4RA 3H7AA 3NGXA 3VPFA 1Y8QA 2E49A 4NDNE 1HSZA 1B26A 4GX5A 2W4QA 4IDAA 4CLOA 2GUGA 1E6UA 4NBVA 1YB4A 2G1UA 3OF2A 2EW8A 2R6JA 3QW2A 1KY4A 4O82A 4I9NA 1D7OA 4MJLA 3VH4A 1JKJB 1DHRA 1I30A 5DULA 1EFKA 4MV7A 3B70A 4FJ2A 1EBFA 1Y8QB 4XDZA 4ZHQF 1ZEJA 4ALLA 3WMWA 4LGVA 1M0WA 1EQ2A 4BNVA 4CLOB 3FTPA 1T2AA 4WOKA 4B3IA 1MUUA 1BNCA 1KIFA 4LCJA 4FIZA 3CXRA 2HO5A 1W0CA 1OC4A 3SX2A 4I9HA 2CZCA 4HNHA 3FRJA 2RH8A 4MVJM 4XEHA 4WLNA 4WOJA 2DBZA 3EUWA 3NEPX 4FR5A 4BNKA 1HF3A 1X1TA 3QE3A 2D0IA 4B8WA 5KOIA 3PQEA 1M75A 4BS9A 4XQGA 1N9GA 2QRKA 5KNLA 4L73A 4CMIA 3PHIA 2JKVA 3GOHA 4NK5A 4IM7A 2ZQZA 1VJTA 3SE7A 2DAPA 1C0IA 1Z82A 2PGDA 3QY9A 5TT0A 2VOJA 4O2AF 2HJSA 3I83A 3LC1O 3W6UA 3OUZA 1CEQA 5CG2A 4KOAA 5BSEA 3DZBA 3QVOA 3HWRA 2W6PA 3L07A 4E2ZA 2W8ZA 2GYYA 5D8DA 1R0SA 4CQMD 2W98A 1N9GB 2IYOA 3Q9NA 2BGKA 4CMIB 1G6KA 1B14A 2GERA 1B16A 2GZ2A 5AOVA 4CV1A 5K6AC 3AOEC 2V6BA 1VPDA 2YZ7A 1P0CA 1VSUA 2AXQA 2FSSA 3PFWO 3TOXA 5COQA 1DC5A 4HNUA 3UGKA 3VDQA 1DFGA 5G0SA 4D43A 5KVSA 3JQ8A 3RASA 3L6EA 2CF6A 2X1HA 4R41A 1ADBA 3FN4A 4DXHA 2J9GA 4D46A 3KOUA 2VYVA 2ZYGA 3F1KA 1T2EA 3PYXA 3KALA 5LA6F 1SMKA 2VCYA 2UV8A 3JD3A 3B6ZA 1JW9B 2C5EA 1HZZA 4P4GA 3OECA 1XU9A 5TT1A 1EZ1A 3WLEA 3MJSA 3KYBA 3QFFA 4PG7A 1GSHA 2EXXA 3QWBA 4PLPA 3ICPA 4XZ3A 1ADCA 1HZJA 4WLEA 4OXKA 3BTOA 1B8UA 2HMUA 3DXFA 4A03A 1X7HA 2H6EA 4BGIA 1GZ3A 1HXHA 1ONNA 5EINA 2XF8A 2VZ9A 4DBVO 1YQDA 5DMXA 3WDSA 3ANNA 3G8CA 4CPDA 1XCBA 3D1LA 4O83A 1XA0A 2PZKA 4R69A 5U4QA 4WPGA 3UICA 2ZB3A 3QVWA 4AJ1A 3WGOA 3C7CB 1UDCA 2ZDHA 2VZ0A 5I7FA 1LSSA 2YV1A 5L45A 3EVNA 4C5AA 3DHNA 1T1RA 4CODB 4W9NC 4XZ3B 4M49A 1VRWA 3BXXA 3UCXA 1NM5A 4B3JA 2D4AA 1YQGA 4CR6A 1GAEO 3KUXA 2CMDA 4G5HA 4JN6B 3U3XA 1E7QA 2VTDA 4OHUA 4JBHA 1I10A 2DUUA 1RM3A 5TSDA 4FFNA 4DGSA 4Z6KA 5T5QA 4DYVA 2E37A 3G79A 1VE9A 3E48A 2I6TA 4TVOA 4M89A 1YVEI 4CLEA 1NPYA 3JYLA 4DVJA 1KEPA 4FDAA 2I76A 4QSHA 1O9BA 1GLVA 1E5QA 1WWKA 2WEKA 4O81A 2Z1NA 2O2YA 3TZKA 4EUHA 2O3JA 1ISFA 1NWHA 4II2A 4PCVA 4ZU3A 3AW9A 3A4VA 5TC4A 2VWGA 3ZU2A 1SO8A 3GLKA 1HT0A 5L7WA 3F9IA 3AW8A 4MVJP 4J6FA 3KEOA 2OZPA 3NUGA 1MXFA 2DBRA 3D4NA 1KJ9A 3U54A 3DBHA 3GFGA 4AJLA 4PLWA 4A2CA 3R9RA 2PY6A 3NGLA 1W96A 4LISA 1N5DA 1NAHA 1CETA 4ND1A 2YDYA 5DCWA 3QSGA 3ZWYA 5AQ1A 2AQ8A 3UW3A 2HUNA 3UN1A 4UEKA 1I7NA 4XIYA 5DZSA 3V2UA 4RF4A 3D3WB 3ETGA 2EGHA 3L0DA 1JKIA 1GV1A 4D45A 3DBHB 1PX0A 3VTZA 1F17A 1H6BA 1V3UA 1WR2A 3KETA 1U2GA 2UYYA 2BKAA 3WYEA 3UXYA 3DWFA 3WIDA 1VL0A 4CR7A 5JAIA 1NHWA 1IL0A 2AEJA 3DL2A 4M8SA 5IDQA 3VKVA 2NQ8A 1I3MA 1LDNA 3G3EA 4CM4A 4Q39A 2O50A 1QXSA 3GN1A 2VZ8A 2SCUA 3ROKA 2W90A 3LC2O 3RJ9A 1SB8A 4IDBA 3EMKA 1I2ZA 2ILTA 3F4BA 1KERA 4MV3A 2Y67A 3SXPA 1ZVMA 4CLDA 4RZQA 1WMBA 2JAPA 3KBOA 3BHIA 4YT4A 4AG3A 1NXQA 1C30A 2FZWA 5G0WA 3RUDA 4CM4B 5CDUA 2CZGA 1MP0A 3UUWA 4FS3A 4RPKA 4BNMA 3F1LA 1VKOA 2BFOA 1OZAA 2SCUB 5ITVA 3NX4A 2P5UA 4CMAA 1N2SA 5C8YF 2P9EA 2ZDGA 1UAYA 2JFHA 2IEDA 3ENKA 4KTTE 1I3KA 4MVJA 4J4TA 4TRMA 4N5MA 4EDFA 3IAHA 4E4TA 1DFIA 2D2IA 1PL7A 3T7EA 1DAPA 2EJVA 4RVHA 1K3TA 1GCUA 2WYWA 3RC1A 2X4GA 4PZCA 4J4BA 2G82A 2Y1DA 3ONFA 5JNLA 3HSKA 2AQHA 4BO3A 4O7SA 2I99A 3E82A 3MOIA 4NI5A 3FNGA 4R1NA 3ZI0A 4E3ZA 2DC1A 3WXBA 3IOYA 4O84A 1K6IA 1YBVA 1P44A 3N8DA 3E5MA 4WJZA 5ER6A 1PR9A 4DPMA 1VL6A 4ZI7F 1ENOA 2EP7A 4BMSA 4U5QA 3QVSA 1ENYA 3A9WA 2PFGA 5JLAA 3WNQA 1SBYA 1KBZA 1OBGA 3UKOA 2VOEA 4DIFA 5G4KA 1Y1PA 1BXGA 2PZJA 3PFFA 3OICA 4JLWA 4ITUA 1EEHA 5IDXA 3JQ9C 3GC6A 2DWCA 5C7OO 2F00A 4NBTA 4ONEA 2X7HA 3KEQA 3E8XA 4BNJA 1C1XA 5DP2A 1DLJA 1UXJA 3TDKA 4BMNA 1AXEA 2GN4A 4WBNF 4D42A 3C1TA 1W4ZA 5TIIA 5COBA 4NBWA 4FC7A 3JQBC 3MOGA 2J3KA 3ITDA 1U7TA 1T26A 5KWEA 3PGJA 4JJIA 2AEFA 3A14A 3DZHA 3GN2A 4XKJA 5G4KB 4UVHA 1IHXA 3TZQA 4AL4A 3SLGA 1VC2A 4EUEA 4PIVA 4E30A 3DZGA 3HDYA 3TL2A 3Q0EA 4AJHA 3PLRA 3LWBA 4E5MA 1C1XB 3OSUA 1NFFA 2C7VA 3OUUA 2HSDA 2AG5A 2VQDA 1LI4A 1SB9A 3K8ZA 1Z2OX 1ISJA 2X0RA 1PS0A 4J16A 4A73A 4IS2A 3PIDA 3DONA 3B1KA 3DBVO 5CA1F 4A10A 5ES3A 4WNCA 2UDPA 1TT7A 5CDYA 3WFJA 3ABIA 4KWIA 2VR1A 1A4IA 1WDMA 1K2WA 2OO5A 4MVJE 1JLLA 1L1FA 4NK4A 1E4EA 4RJTA 4BUCA 5JSFA 5A9TA 3ZH2A 4IZOA 2A4KA 2XXJA 3QHAA 4QQRA 3TIIA 1OC2A 2JCXA 4Y8VB 4JP2A 4IUYA 4GPD1 1ISGA 4EJ6A 2Q3EA 3C1OA 1O94A 3V5NA 4BHTA 4YBZA 3U09A 1XU7A 4TUYF 4YAKA 1GQYA 4MO2A 1JLLB 3RV3A 1R66A 4XYMA 1E4EB 2VT3A 2Y1OA 5L3ZA 3V1TC 1L7DA 1YS4A 2HMVA 2YS7A 2R7KA 4YAGA 5H82A 2GZ1A 4BL5A 3ADOA 2IP4A 2R87A 3DZFA 2R82A 1V3VA 4RPGA 2GRAA 3FI9A 2ZTUA 3LF2A 4XGKA 4B7XA 4YBZB 1D4FA 1YO6A 4I8XA 1DPGA 1HETA 1U1IA 3DTTA 1IYZA 4YAKB 3RU9A 1Z75A 5L95A 4XYMB 4J0EA 2PGLA 4UUOA 4YDRA 4IY1A 5AXBA 3WFIA 1UJMA 1KJQA 4AJJA 1WW8A 3TWOA 3TINA 4U0KA 3AY3A 2W6OA 1PJBA 4UVGA 4AJKA 3PK0A 4FOOA 2JD2A 5A5FA 1NPDA 4YJHA 5L53A 1YBAA 4PVDA 3GNTA 3RC7A 1T24A 1T2DA 3FPCA 3HG7A 5B12A 3ZHXA 3Q2IA 3LSYA 4O7YA 1SOVA 1ZK1A 2QYTA 5IYZF 2YHUA 4GLLA 5B37A 1LSOA 3GZ4A 4WEQA 4D41A 2Y93A 4IQGA 1ZEMA 4TROA 2E48A 2Z04A 2CDAA 5JO9A 2XCLA 4EW6A 1M0TA 4YJHB 2CVZA 2GF2A 4MA0A 4OAQA 5JO0A 5ER9A 4RL6A 1JA9A 3AK4A 1X7DA 2W2KA 3LP8A 3V4SA 4E0BA 5GMOA 7MDHA 2FN7A 4PVCA 4HWKA 4XA8A 3MJFA 4NFYA 3AI2A 1GU7A 3SBOA 4C4OA 5LDGA 5TRTA 1T2FA 1PJLA 3U9TA 1PQPA 4YPOA 4FW8A 2B4QA 1KEVA 3LF1A 4TRRA 1AHIA 1E0DA 3PP8A 5C3MA 5ICMA 5L7TA 3JQ7A 2W2KB 4W7IA 4IGEA 4PG5A 4YWJA 1PSDA 3F6YA 2OFPA 4MVJI 1UUFA 1M6HA 5I9LA 4RVDA 1G0OA 4EZBA 4HV4A 3K30A 1P77A 3AY7A 1T4DA 2YRWA 4NJMA 5G0TA 1F12A 1P74A 1UZMA 5LXTF 3S2IA 1BWSA 3DFZA 3EZLA 3I1JA 2AW5A 1NX6A 3WO1A 3PDUA 4FGRA 2Y1CA 1GEEA 4FJ0A 1V35A 4HP8A 5ADHA 5K6AA 1BMDA 1EK6A 2QW8A 5HS4A 3A06A 2C82A 4BO9A 3K31A 4GMGA 4HUJA 2OHXA 4TVBA 3WOHA 4OGWA 1PEDA 4UEOA 4NJMB 1QLHA 4J1TA 5BSFA 1KVSA 4Z9FA 2YFHA 4WECA 1UXHA 2FSVA 2DTEA 4NHEA 4OM8A 3OM9A 5BSGA 1JWAB 3R5HA 1GSAA 3NTQA 1SZJG 2W2LA 2ZK7A 3QWHA 4NJOA 4YJGA 2YW9A 1KEEA 1TXGA 1KVQA 1U8XX 4KWHA 3OA2A 1D1TA 3K96A 4OOEA 3GAFA 1D3AA 3ST7A 3AM5A 1H94A 2J5RA 2PN1A 4TRJA 3RKRA 2PNFA 1DIAA 2ZATA 1U4SA 3WSWA 4CMJA 1PJ2A 3H65A 2YYAA 3ASUA 1DIGA 4Y6SA 1J5PA 1GQQA 1KJJA 3ETDA 3LC7O 3PZRA 4YJGB 4CM8A 3HB9A 1CE8A 1ZXLA 3GRPA 1VI2A 2FRDA 2BF7A 2R7MA 2AMFA 2TMGA 4FC6A 4J7XA 2JD1A 1ONOA 4R1SA 2WJPA 3BTUA 3W6ZA 3RWBA 3ZNNA 1GPDG 2E6UX 1DHTA 1T4BA 1A7AA 4DQVA 5I8WA 1KVUA 2C0CA 5EL0A 2JHGA 3SEFA 1OMOA 3ZNOA 4LVCA 3WGQA 4GI2A 4CM8B 4DIMA 5CDGA 3IKVA 4CUJA 1FDTA 1ML3A 1NQAO 5ILGA 1PL8A 1R0LA 4DMLA 2C2XA 4DPKA 9LDBA 3LYLA 4UUMA 1ZXBA 1EVIA 4IXTA 5U9CA 1NTOA 2Q49A 3O26A 1R6DA 2HK7A 4UVIA 3KHUA 2NADA 4Y98A 1FF9A 3RU7A 2DLDA 2FPPA 2YQ4A 2V58A 4C5BA 2OP0A 4R54A 4RVFA 1M6WA 3E9NA 3OIGA 3INRA 5IF3A 2JD0A 3JQCA 4LSMA 1Q0QA 3P7MA 4XCVA 3E9MA 4O4IF 3JQAD 1ZK2A 4RLSA 2F1KA 4BNHA 2ZTVA 3AU9A 2NNLD 4FFPA 2EKPA 3HDHA 1LC0A 1HTBA 3WJ7A 5JDIC 2FPPB 4MVJG 4ND2A 2Q1UA 3AOGA 2YWVA 3WSVA 4WCFC 2B37A 1E1NA 3ZWWA 4Z0HO 1KVTA 2PVPA 1LRLA 4L76A 1W73A 6LDHA 4PLYA 4QFDA 4Y6PA 3NDIA 1ENZA 4O59O 2R00A 3QWFA 1E3JA 2VHZA 3R5XA 4NFSA 1R4NA 3ZU4A 5G2OA 2DPHA 4FD3A 1KS9A 4I5GA 4GX1A 5EQDA 4DQXA 4YAEA 2X6TA 3ZV4A 1HE3A 2GN8A 5A9RA 1EQUA 2Q1WA 2V6GA 4XWYA 4KQWA 4OQYA 4P4NA 1B6SA 4PLHA 3EY4A 3ZCXA 3NJ8A 2HGSA 1J4AA 1WMAA 2AG8A 3DTYA 4J9VA 2JHFA 5LOVF 4MP3A 3CPSA 1D8AA 1U7HA 1IPFA 3DAGA 2YQ5A 3ZWMA 1TB4A 3I23A 3BMNB 4FCCA 3WGYA 1E7MA 4WKGA 1LQTA 1Q0LA 1R4NB 3A1NA 4UUPA 4QX6A 3ZN2A 3VDRA 1O6ZA 4BNGA 4XJSA 2DU8A 4QSMA 4UREA 4LRSB 3T4EA 1U2DA 4HX5A 3VKUA 1T1SA 3F46A 1PJ3A 3ZGYA 3I9MA 3WGIA 1Y7TA 2DTDA 4O7LA 3L9WA 3HHPA 5L4LA 3WR5A 1H0KA 2CDCA 3IUPA 4CMBA 3BYZA 4WLFA 1JAXA 1PWXA 2Q45A 3LK7A 3IUSA 1PR3A 2WMDA 4MINA 5IN5A 4F45A 1XQ1A 1UH5A 3RI3A 5HV6A 5K0ZA 1I36A 3L6OO 1I2CA 3VTFA 2E4AA 5JXWA 5CEFA 4FE2A 2YZLA 1WZIA 3PHHA 1KEWA 1YONA 3WS7A 1QYCA 4NU6A 4DPLA 3EW7A 4E2XA 1A4UA 4Z3KA 5H81A 4IGFA 1QV7A 4CR8A 1YE3A 2PBZA 5BMVF 4IJKA 2Q1TA 1D1SA 3EZYA 1LLCA 3JTMA 2FR8A 1E1MA 1FDSA 3OQ1A 4I5DA 3KYDA 4IIJF 2GZ3A 4J0FA 5H80A 5KIAA 2J5QA 4AJ2A 4J2OA 4NBRA 2G17A 3PJGA 3TNLA 4NG5A 3HBLA 2E82A 2PKRA 2QX7A 3DEYX 4JXKA 2ZYAA 1P1FA 4PLGA 1RM0A 3KAKA 2O4CA 2CD9A 4GGPA 4IQ8A 4XQCA 4D79A 1DSSG 4ALMA 3KYDB 4BO5A 3MZ0A 1KJ8A 4O7WA 3JD0A 1SC6A 4R3NA 5TNXA 2J3JA 4EJ0A 4CQLA 1MXHA 4A7PA 5DT9A 1BRMA 1A5ZA 3LT4A 2CNBA 4J3FA 3V2HA 2YL2A 1LSJA 5EIOA 5B4VA 5DF1A 5FFFA 3VOTA 1Z7EA 1U3UA 2DLNA 4YXFA 1YWGO 2ET6A 4JP3A 3WB9A 5IZCC 1GSOA 1W6UA 2XD4A 1YDWA 4KUGA 2VN8A 2NWQA 3G1TA 1Z6ZA 1H9BA 4GWGA 4CQLB 4O4HF 1LRKA 4GKVA 3T7CA 1J49A 5JAQA 3WMXA 3U5TA 4GAEA 1WDKA 1BVUA 3C7DB 1IB6A 1TT5A 4R1TA 4BGVA 3GMDA 2VYNA 2Y66A 1QG6A 5IJZA 2HRBA 3GY0A 4I5FA 1P0FA 1ULZA 4C7KA 3TW6A 3D7LA 4AICA 5JAZA 3DF7A 2EERA 1GZ4A 1NHGA 1BGVA 1NPTO 3P2OA 1H2HA 1NQTA 1DRUA 1A9YA 2X8LA 3TIGA 1HSOA 1TT5B 1DXYA 1NP3A 2EKQA 3NAQA 4BO8A 3IQDB 1GYQA 3OFSA 3EAGA 4M55A 4PZDA 5TS3A 4CM3A 4RGBA 2X9NA 4FSHA 3VH3A 1N92A 3S2EA 1R15A 5JCJD 2NTNA 5KJEA 1FDVA 1MFPA 5HA5A 2C00A 1H6DA 1KYQA 1GR0A 1Y6JA 1VJ1A 4BKPA 1WDLA 3KM0A 1ZK4A 5LYJF 3A28A 5JYDA 4MV8A 1PU2A 3FWNA 3ROPA 4I1IA 1LRJA 4MV9A 3I52A 1B7GO 1ZJYA 2X0JA 2X5OA 3W4IA 4N5NA 2JL1A 1IOLA 5I7SA 1DEHA 1PJCA 3WNVA 3TQTA 1GZ6A 4HR7A 2FPIA 3L9XA 4DRYA 2HCTA 3QVXA 3X2FA 3GDGA 4H3VA 4RDHA 4K6CA 5I7EA 1NQOA 1PZHA 4QTZA 1AGNA 3VPGA 2BRUA 3UHAA 2O7SA 3RKUA 1RPNA 1Z73A 4WCDA 1HDGO 2AQIA 2CVOA 3LVFO 3WG9A 4RQUA 2EWMA 4YT2A 4O2BF 2I67A 3DMYA 4CV0A 3EHEA 5AVOA 2HQ1A 2WYOA 5A05A 3RUAA 3K73O 2FPIB 2O3UA 2YZGA 1AUXA 1E1LA 4KUEA 1WZEA 2WYVA 4R51A 3ZW9A 2D1YA 2WE7A 3FNFA 4LW8A 2ZDQA 1VSVA 3EC7A 5CFZA 4D7AA 3GHHA 2XOXA 3MCVA 4ME6A 1J6UA 2IZ1A
chains in the Genus database with same CATH superfamily
4MYTA 3SF8A 3VPSA 2Z3ZA 1PHPA 1ARZA 1G8PA 5CVDA 2IH2A 4KV9A 2QTWB 4D0LB 2RAFA 2WMOB 2LCIA 3FBWA 2XUIA 4TV8A 4B6PA 2EDAA 1DARA 2FWBA 3H0CA 3NKFA 4G26A 1PGOA 4IVNA 1Y9JA 1R3DA 3QA9A 2XGSA 3ICEA 1LJUA 3SEAA 2ZYHA 3NJ4A 1DL5A 2GK6A 4R98A 2J9FB 1JFFA 4LZJA 4MSUA 1NWCA 4DBLE 1XCMA 3T8YA 2P5SA 4WINA 3I9LA 1XJ5A 1ZO8A 4ERNA 3OKFA 2L19A 2NU6A 1P45A 3M1AA 3WDLA 4D44A 4GR9A 5BWCA 3R9WA 1UT8A 2C4NA 2WK1A 3S29A 3PC2A 3UW1A 1GEGA 1I7DA 1RP1A 2NO1A 3C5HA 2HHJA 4IQ0A 3EOAI 1PNVA 2B83A 3OJEA 3DEHA 5H4HA 1G8FA 4BPBA 1DUVG 1Z2NX 4KMOA 3OP1A 1X1EA 3LPMA 1CPYA 1ATZA 1IB0A 4GMFA 1DBIA 1A50B 1OFHA 1Q7RA 1V26A 4QJIA 3PF9A 1HDOA 4FNMA 1U0EA 2APJA 3NU1A 4KQIA 5BWOA 5HKKA 3O8QB 1E2BA 3FHTA 1DRKA 1M6YA 2ADMA 3AWIA 4RL4A 3W5JA 1A8IA 5JAPA 2ZBUA 4DQ0A 5AXDA 1MRZA 2X8WA 5DOVA 4DJEC 4YVFA 4D26A 3EVDA 5K3WA 4EMUA 2I3AA 5C81A 5JRZA 1QP0A 2BP7A 3CEMA 5DWQA 2G06A 4IF4A 3AXSA 2VP2A 2P75A 2GBLC 1RXEA 1EG2A 1MNQA 2GJ4A 5JZMA 4LYJA 1L7RA 1EX6A 2XGGA 2GEVA 3CFYA 3GA5A 4DLNA 1GN8A 5BSKA 4XB1A 4RK7A 3KREA 2Q28A 4GC9A 3LYAA 2FWMX 3GVHA 1O0SA 2MYTA 3OEWA 3G2IA 2CJPA 3O8LA 1XVVA 2MSLA 3SBXA 2YN2A 3OIVA 3OQBA 3U44B 3JPWA 2FPGB 4QIHA 5CH3A 1XQVA 1CR2A 2Q2VA 1VRCA 2W00A 2XVYA 1FOEB 1R5OA 3PEEA 5JVDF 4MIKA 3BKXA 4RSMA 5IUNC 5JW6A 3P20A 3GRUA 3HLTA 4EECA 4AF7A 2UAGA 4IH1A 4OGFA 5LQUA 3LVRE 4C6HA 4NZNA 4YAWA 4QXMA 2YXDA 1Z0IA 4FGSA 2OQVA 3A4NA 1ISMA 3NASA 4WVFA 3HKCB 1JECA 3TUIC 1N2JA 1UFVA 1J70A 3J7TA 2I3GA 3ZGOA 3CJRA 2Z57A 4IDDA 3UJ6A 1EDZA 4ZEOA 3ZBPA 3GP5A 2FK7A 4KXYA 1W6RA 3H6KA 2OHVA 3ENNA 4B80A 3HV2A 3IP1A 4BDTA 4DCNA 1Z3IX 5JBIA 3QTLA 4GOMD 2D3WA 5DGTA 1QFMA 3WJAA 2I2DA 5CBPB 3U4QB 5DHTA 2V8OA 5M5BA 4KX5A 5ITZA 4X93A 4PNZA 4Y2QA 3FCCA 2PJRA 5JQGF 2GAOA 2V5UA 3GL9A 3HBAA 4JLNA 4OI1A 4CWAA 5JH7F 5REQB 4WY2A 1G21B 1L7BA 3L0YA 3R5KA 3CG4A 1ZK3A 3FTNA 2OLJA 3QIVA 2VJQA 2V7TA 2X41A 3PNMA 5IAKA 5JAUA 4IGIA 1HE2A 5AJYA 3MVEA 1Q17A 4EX6A 2A9VA 3BHNA 2XYRA 1USWA 4YROA 4LF6B 1T6NA 4BN5A 3B3QA 3E8MA 1IIRA 2QTZA 2JEZA 3I6ZA 4BV3A 3ZC3A 4IJ5A 2BDUA 1VBHA 3VZRA 5F35A 1XMQB 3FAZA 2GQRA 2MU1A 3I6IA 3RSGA 1LWNA 3FBTA 2Q2OA 3UH1A 2G6BA 5F2KA 5KOJB 1S8AA 5HBRB 1W88B 2C2WA 1I2KA 4C0BA 3WP1B 2R8YA 4RXMA 1WEKA 5CLHA 1A7KA 4CUZA 5B5SA 1E7RA 3E84A 3ZHCA 1OLOA 4URHA 1N5IA 3FHJA 4ZVTA 1FPMA 5T57A 2GA9A 4DC9A 4J94A 4JOBA 2WB4A 2R1VB 4MIOA 1KAGA 2H92A 2POQX 3FJOA 3GFVA 5EWLB 1SIBE 1SXJC 4FFLA 1T5DX 2AA3A 2P9CA 1Y37A 1U7UA 1U6JA 2UZ1A 3LXMA 1RRGA 3P9NA 1JPUA 4PLVA 1P2TA 3C24A 4KODA 3JZMA 4CW7A 3H18A 3HYSA 4QFBA 4JGIA 1GNLA 4DV7B 2Q3FA 3COZA 1CERA 4DCGA 4RTPA 2JLZA 1NI5A 3D4LA 3ROQA 1J8FA 3S2GA 4AO6A 2O8CA 3DD1A 5F12A 5A3SA 2J3HA 5DNWA 3RVDA 3ZZNA 1W2WB 1QIIA 2ATCA 2HA3A 5CR5A 2WSSA 1GCOA 1JEDA 4QTUB 1EFAA 1PT9A 1ILWA 5J2TF 2WUWE 4Q4LA 4BNTA 3OHPA 2EC5A 1EVZA 3SHWA 2QNBA 4KYIB 5K51A 1WZ2A 3QXXA 1YBMA 3RVQA 5FEUA 1KZGB 4ZU1X 4OM7A 1MMFB 1TEZA 1LFAA 2QL6A 3T0FA 1USKA 3OJCA 4PAGA 2QRLA 5CEEA 3D3QA 3OFNA 2FRVA 2HF9A 3DDOA 3LBIA 2NU9A 3PD7A 3R40A 4IEFB 4RHYA 2P3OA 5BN3A 1NZJA 4XGQA 5FI3A 2QU8A 2XRFA 4BUJA 1Y9EA 3D7MA 4HNGA 2HRZA 3WRVA 2AWNA 4O7NA 2ID9A 1II8A 2JIMA 1FDIA 2YJZA 4UBOA 3NXKA 3PU6A 4KQXA 1A77A 3KYCA 5CA0A 4HAVA 1UQUA 9LDTA 1E3WA 4HSGA 3RBZA 3A8TA 5B6JA 1SVKA 2C2ZA 2XXBA 5K8VA 5JPCA 2J6CA 2J9XB 3RIMA 4DNXA 4GGOA 1FDOA 1GILA 4UFOA 4R3WA 3LG2A 1X15A 2NIPA 1VPEA 1X13A 3L8DA 2UXBB 1KAQA 3HUFA 4CMEA 3A7EA 3IBSA 3FMOB 4BGUA 1ABFA 4I4LA 3QVTA 3VR6H 1PUIA 5C1DA 3NT4A 3H8VA 4UEJA 4MVJF 3THOA 3PJFA 5EJ7A 1TJ4A 2P2CA 2QYHA 1OWNA 5FLXA 2WMNB 4DV3B 2ONJA 3PUJA 3I6YA 3S2SA 3R1IA 1FP4A 4B4DA 3A3PA 3IB3A 1JT9A 3NUAA 4FMDB 4Z8XA 3K0CC 5ARDA 3VZCA 4TSFD 3NTRA 5C1PA 1XMJA 2Y1GA 2YICA 2DHRA 3RWOA 4POAA 4K8OA 2BLNA 3NV9A 3LZDA 3TQIA 5I9MA 1TYDE 4OQEA 4ZV7A 4XAQA 4RKWA 1PSZA 1K9SA 3COSA 2BFMA 3VVCA 2PGXA 1USUA 1LI5A 1XLUA 4U6SA 3TSCA 1CQWA 4YJ3F 1TTTA 2A7XA 1P9WA 3RUEA 3LM8A 1MOZA 1NXPA 4LY0A 2I8LA 2I55A 3EJ6A 4YH1A 4A26A 4E09A 4LSWA 2JVJA 3F7OA 2J5KA 3VHRA 3X1JA 5B1DA 1LZKA 1V0JA 4BB5A 3R23A 1AU9A 1N33B 2VH1A 3DV9A 3E70C 2I87A 2H2DA 1T0PA 4D8VA 2QNIA 3AETA 3L1KA 3S28A 1U8CB 3NZEA 2MCFA 1ZUD1 1DRJA 3WE7A 5MGBA 3QVVA 1H2ZA 4FK8A 3OFVA 3R8CA 1K3FA 5CTJA 4CL3A 4PC3A 4B3FX 5IVHA 2FMUA 2FPUA 2IE8A 1JN0A 2RGYA 3VSDA 1E2LA 2VNAA 3WLRA 1V95A 5EXSA 1TFUA 3H4VA 1M7BA 1QC5A 2C03A 3EN0A 4W5OA 1XEWY 1YUBA 1IBSA 3RG2A 3RTXA 2Q6LA 4TZ6A 4PQFA 1YDEA 5AJXA 3UK7A 3U3DA 4KR3A 1YOVB 2DGDA 1N2IA 3NDPA 3TSZA 1U4NA 4EWLA 5DEIA 1JVBA 2ZIUB 4FTWA 3KKKA 4JR2A 4A16A 4DLBA 4BC0A 4R0VA 3PWSA 1UZNA 3LCRA 3AQIA 1L7OA 4LSGA 4V0LA 5G1OA 3U48A 1KS2A 5CITA 1CF2O 3I9JA 5TGZA 1ET0A 3TJRA 2O8EA 1RJEA 4MQ5A 1JLRA 2YBDA 2GN1A 4AN4A 3CH6A 4YCNA 4BV8A 1O7JA 2GDJA 2WVGA 3PQCA 4PBSA 4AMZA 2AMVA 4JNKA 1O54A 4P08A 4RELA 4TL6A 3WGZA 4JXXA 4RCNA 3QLVC 4M6WA 1BXRA 4WJKB 3AM3A 1F51E 3R9XA 5CK5A 1WNFA 2EG9A 3AJRA 2CLHB 2LUOA 4OUDB 3VDMA 2BFCB 2VQSA 4X61A 3X2SA 3NHYA 2XXAB 1OKKA 3S1SA 2X8BA 5BVGA 1PNOA 4KAAA 2Z9CA 3TPZA 2Z6QA 3ZVMA 5HBGA 3PUHA 4IG4A 3ZHZA 4YYZA 1V4NA 2GCPA 1N3BA 3EOBI 3ONDA 5DP1A 1WG8A 4LZLA 1CU1A 1NJ1A 2QRPA 3F98A 4UC0A 3UWKA 3DKKA 1ZS9A 3KZ1E 2JJ2A 2X1VA 4NCJA 5HNEA 3L0OA 4WD3A 1YL6A 4FLEA 2ZJYA 3ROEA 1EJBA 2G3YA 3IP7A 2YV4A 4P4LA 5BSUA 3MAJA 4U39A 1D1QA 1BFUA 1P7PA 4P7GA 3WZMA 1XF1A 2GM3A 2QP9X 5JJ5A 2IH5A 1U2RA 1XG5A 2HLPA 1YCFA 2EKBA 4HWRA 3HPQA 4N3AA 4RMJA 5LM3A 1XDBA 1RABA 1X3LA 2CFMA 1SOUA 1M67A 2NVOA 4QJBA 1K97A 4W7HA 5GY7A 3O6VA 1VPTA 3K1TA 3SOZA 3GFBA 4O2LA 2PFSA 4Q7JB 3KJQA 3CT6A 3K35A 2IFTA 2XPCA 2O0HA 2CKDA 4Q1EA 1ZAUA 2A92A 4ZAXA 2K7FA 3EZNA 3DFMA 4FBLA 3OE4A 3UG7A 1DAOA 1J97A 3ZHUA 3REQA 5IKMA 2RC5A 3LCMA 1J99A 5K9ZA 3DVAA 3QRWA 2I6QA 2HNBA 3GB8B 2QOEA 2AKEA 3EQ6A 3SYKA 4ZT7A 2QY6A 3MUNA 3H8SA 2YOGA 3CEHA 4N3NA 2F59A 3VYUB 4K28A 1HMYA 1QF7A 2WAMA 1KAMA 5EXDA 2VF8A 3IXLA 3V97A 3H2GA 3PXCX 1N8NA 3DBRA 4HS9A 5TF4A 4YRNA 1KQGA 4XWTA 1A5AB 2C2HA 1OI2A 1AKUA 3EIXA 2OV4A 5CLLA 1UM9B 1Z3CA 1T2VA 2DOKA 2I7XA 3N2YA 4H15A 2WKQA 3IH5A 4M8NE 4PS1A 4RH0A 2W6MA 2VATA 1MABB 4P53A 1NSTA 4FZJA 5KPJA 2HXYA 3H11A 2WJHA 3RVKA 2GEJA 3PE3A 3KZVA 4G09A 2KWIA 3N2GB 4RGQA 3PHLA 1ORTA 4JJEA 2GSDA 2Q1YA 3I04A 3SE0A 3A1CA 3WADA 4YT5A 1P62B 1EU1A 2FMFA 1NY6A 3KWFA 2VG8A 4HDSB 1DO2A 2CVFA 2O1XA 3IT0A 1MD9A 2JLCA 2WPDD 3DNPA 2XCSB 2FEKA 3I76A 3OEHA 1YRWA 1IXRC 4G86A 3IOBA 3VVBA 1AY0A 1RAFA 4CXMA 3HL4A 3QEAZ 3MA0A 4Q4DA 1U9ZA 2Q99A 4X24A 1GQRA 1H5UA 2VKQA 3CN9A 3HI6A 4ZZ2A 1T4CA 2EQ5A 4OFXA 3D8UA 3KQVA 2ZJ5A 4L72A 4ZOAA 3LD9A 3C3XA 4WXYB 1XVUA 1DO8A 1JR3E 1H5QA 1T6XA 2E21A 3O03A 2ZS7A 4NFHA 4RS4A 3TL3A 3VPXA 1CRLA 2GI4A 3L4JA 1OH5A 4PTLA 3J81A 1OTYA 3TPCA 5KKAA 3ON5A 1GPLA 2GO1A 4YO8A 2IZ6A 1ZOSA 3TNYA 2O2XA 5KYYA 2DPGA 1G5FA 1Q19A 3Q3JB 2XBMA 2ZIEA 3M3PA 4EHAA 1U7XA 3RVPA 3W6OA 3T1YB 3KQMA 1GV0A 3R3YA 2CDRA 2ZB8A 1KP9A 1GTVA 3PXGA 1ESDA 5ERXA 1MIOA 3LUFA 3E9QA 4QEDA 1T5IA 2VNIA 3NYQA 2M98A 1YFLA 3LDFA 4RQTA 1GNPA 1YHYA 4N3CA 4EELA 3TOZA 2FVXA 1BTOA 1CS4C 2DH5A 4RE6A 1E2GA 2VWHA 3AFMA 4PLZA 4N0QA 2ZIZA 3K4QA 1X3SA 3GLSA 3VR2D 2IWRA 3VHXB 1Y7LA 2HG8A 3N8NA 1YR2A 3AP2A 3OJOA 2WJVA 2Q5IA 3GARA 2REXB 3FY4A 5LA6A 3AY6A 4XTCS 1VM6A 1Z47A 2JHAA 4J0DA 4EM6A 5LL6P 1O6FA 2J0EA 5K0CA 3D64A 3G2HA 3EB9A 2G9ZA 4PNEA 4IOJA 1WMSA 3FZQA 5CGQB 2Y4RA 4J9UE 4IJ6A 3HSSA 3NC1C 3UXEA 1MVNA 2GQ0A 2PL1A 5JC8A 1JPVA 1X8LA 1BGXT 1MTOA 2I66A 3JXEA 3L77A 4HNAB 2AFRA 2QB5A 2QRZA 3ZWCA 2I3ZA 3FTQA 1DC8A 1XNRB 5CFQA 3FDFA 3ZHVA 3G5AA 1LCIA 4G4IA 3BMQA 3IESA 3AEKA 3H5WA 3MEQA 5CW2A 5AKKA 3ZK7A 2XVAA 5AKHA 5EIAA 3QE2A 3INGA 1WL8A 3DVSX 3NYWA 3T5CA 4L7QA 2Z8ZA 5B3LA 4U2DA 1J2UA 4G0NA 4L3OA 2JLYA 3KE9A 1JKFA 2J3LA 2Q2WA 3ANLA 4R9SA 4RH3A 1LLDA 1WO8A 2CNUA 1N0IA 4P2GA 2WLSA 2CXQA 4QHTA 2VUGA 2WE8A 3L1UA 4JBIA 2BSXA 2NXEA 2FMXA 1Y1KE 2G5TA 2QU7A 3GLGA 3AVYA 4JENA 2WVHA 4N5DA 1D0IA 1RBQA 3AHEA 3PX3A 2QZ9A 4MVJD 3L2PA 1T8YA 2CD7A 2OHOA 5CDSA 5JRDS 3LKZA 3NW9A 3M0EA 5DGIA 4KK4A 3OEEA 4DLAA 1Q84A 3FOAA 2RCNA 1RD4A 2AE1A 2AUMA 5B36A 1QV9A 1Y9AA 3VYWA 3ZVLA 2LGJA 2P9YA 4RTNA 3OWHA 5HEKA 3X1XA 3OJLA 4O2BB 3LI2A 1RNLA 1O5IA 1QHEA 3CWQA 3DUFB 3QLUA 5CR9A 2BHNA 1HV8A 4IZHA 2HSEA 4P22A 3R6DA 5JYEA 1D04A 4XPZA 5DIZA 2W0SA 1AS0A 3H4TA 5DB4A 1DBVO 3JQBA 3HZRA 5C37A 4ZOBA 1WUIS 2JAXA 3U61B 2D2VA 2XBLA 1SULA 3I32A 3OTGA 5E3HA 4HN4B 4R68A 2JZNA 2L42A 2F17A 3IUYA 1U81A 4DYHA 4L85A 2FWRA 5EKDA 5AW8A 3PXXA 4UUAA 1PWZA 4XVQA 2D7JA 2FPWA 1SJ9A 3DMDA 1QUFA 3WLTA 5B55A 5DVZA 1E4VA 4K3UA 1U31A 2EW2A 4H16A 1C9KA 1FUYB 4HAIA 1JWBB 1WE2A 4KXVA 4MW7A 3HB0A 4Y6OA 1PR2A 3CPEA 1P2DA 2BMWA 4QZVA 3FOEC 2O2SA 1UPTA 4ZI5A 2XUFA 4E6PA 2VXCA 1TO1E 1TZBA 4R9VA 3ZCTA 1MQSA 3HJHA 4HLDA 2KJQA 2UUOA 1MU0A 3D6HA 4OYHA 2CMHA 1X77A 2QD3A 3F7TA 4NCNA 3V2GA 4EGQA 1URPA 1DQPA 4LTNA 5A4KA 4V1CB 4LY9A 4OX9Y 4MUIA 3AJ8A 1XVTA 3QKSA 4OJYA 1AS2A 3TOCA 1NYTA 3AF6A 2GEDA 4IUDS 1ELOA 2EZTA 3HZZA 3WBFA 1MC1A 1SXJB 1MBZA 5KSOA 1TKRA 2B4AA 4DV0B 4JI2B 2G63A 3OMWA 1NI3A 3EXHB 4H17A 4HFNA 4ZARA 3GT3A 3UUGA 2RFLA 1WF3A 1LDBA 4J91A 4OMDA 2C4UA 5EA2A 5IM5A 2PZMA 3CRVA 5MN4A 1AN0A 3HKBB 1NL3A 3PNSA 1LJ8A 3OZFA 4B44A 1X80B 1T25A 4XR4A 1BCRB 3O9ZA 1GUAA 4QPZA 5GV7A 2WVJA 3UFXB 1PCXA 1YJQA 2O0LA 1DS6A 2VUUA 4XLTA 3TRFA 4BKOA 3QSYA 4OLAA 3WO0A 4HPJB 1IZ7A 4YP9A 1NMQA 4PYIA 3HVUA 3WWZA 2WBLC 2ATVA 3I3SR 4XGIA 3VR1A 4DJ5X 4BTEA 4QA9A 2KLBA 3H7IA 2CV2A 5J40A 5T4HA 3BH0A 4YB8B 2EJWA 2GARA 1NUPA 5CLIA 1TQHA 1NBWB 3C87A 2QRUA 1SEVA 3Q3GE 3L82B 1RXWA 1NE2A 2J33A 2MSWA 4BMDA 3KWMA 2ID7A 3HA5A 4EGFA 1RAEA 3Q10A 5E8JA 1QANA 4QTTB 4FWTA 4ENSA 4UTRA 2ZPAA 2PUTA 5A71A 1HR0B 1CUGA 1RHJA 5LUAA 1QHSA 4URZR 4V2UA 3GB9A 4DR7B 3ZE7A 4XPIB 2ZYTX 1YXMA 3TEMA 2JAHA 4P3OA 2OPBA 3AJDA 2HDWA 2D62A 3LXUX 4G9EA 4ZYYA 2A5JA 2JFXA 4FCVA 4NU0A 5JCPA 3AVXA 3ZZ1A 2XR1A 3MFQA 1PQUA 1CS0B 4L6IA 4MO9A 3DLTA 4PHGA 3GLHA 5EUQB 5FWXA 1YJAA 3UCFA 5C8YB 5KJCA 5LU8A 1MAUA 3BFVA 4RPHA 3JVIA 1HEIA 1PJ8A 2REBA 3B1VA 4IIFA 3WKDA 3T3OA 3WA6A 4BEJA 3D8NA 3OZ7A 3WNDA 4HYQA 1CZKA 3HGTA 4YHHB 4I55F 2D8AA 1CR0A 4JT8A 1Z56C 3RARA 3LTNC 2AN4A 2PX4A 3GIDA 2WWIA 3GZNB 3S99A 1PHRA 4ZHSA 1SBNE 1ES9A 2CC2A 3HLKA 3G2LA 3KUCA 2YW2A 4LJKA 1P7WA 5JJKA 2ACVA 4GVLA 2ZP1A 3D6FA 4OXYA 1NF2A 2SICE 2NZJA 2UZ0A 3IKLA 5E4JA 3ZCUA 3KSUA 1ZOLA 5EJIA 4CG0A 3HVJA 1X9HA 3F90A 3T5DA 2I3BA 5E6SA 3VZBA 2QA5A 4B2IA 5KNBH 3TCKA 3H5AA 4M99A 1M5RA 1DCTA 2AK3A 1BX1A 3CE6A 3VH1A 1RRFA 1PW5A 4FOSA 5EHZA 5AESA 1GQ2A 3PDWA 5GIPE 1FQWA 5GVSA 5C5IA 4HDQB 3ABSB 5J1TB 2GCOB 4BN0A 1GXSB 1S5PA 2PRYA 3GGOA 4WK6A 2IHUA 5E0KB 5AW6A 4RCZA 3GLTA 4F96A 4ZGGA 1BD4A 4XD2A 1AX9A 5JFTA 1JEQA 1GITA 4Y67A 3NH6A 3HCWA 3Q6NA 4FKMA 4L9WA 4NV3A 1LPSA 4YEDA 5TJHA 3H1PA 5A4MS 4F4HA 4JH0A 1SIWA 7ABPA 3HXOA 4DR5B 2BGWA 1ZMXA 1E3MA 2MOKA 3F5QA 1KI7A 3RVMA 3DHYA 1H23A 3DZKA 4DCMA 5I9IA 3ZIDA 4W8GA 2F7SA 2TMDA 3ICCA 4YQYA 1T5SA 1YZHA 1L8AA 2NVBA 4F1WA 1KAOA 2EF1A 2JCGA 2K6GA 2SKEA 1I3NA 2SECE 1I7LA 3IKMB 3OCXA 1SCUB 3C4QA 3UTDA 2XQIA 1GTSA 4Q0MA 1U7PA 1S3SA 1S7CA 1QAMA 2IQIA 3GCWA 1Q0TA 4Z53A 3O5AA 1YIOA 1UXGA 1EAMA 1NMZA 1LZLA 2CK3A 1AUPA 2QGZA 3AHIA 3DE5X 4R01A 3SQMA 2UKDA 3H97A 2XKJE 4B71A 2ZUEA 1JSLA 3ACBA 1P4RA 2QD4A 4MB6A 4KSCA 4E70A 4PC7A 4NL4H 4OO3A 5I5GA 5CA1B 1TJNA 1CRZA 1PK8A 1P39A 5AVTA 1OT3A 4ZTUB 1LPOA 1TLLA 1I5RA 2B98A 1KDTA 1N2CB 4Y6LA 5TMEA 1SHKA 1DRWA 5IAOA 5IN4A 4JITA 2QN1A 1DIOB 1Z35A 4AWXA 4NMHA 1ZG3A 4RVOA 2E6KA 3OMLA 2CV0A 1M2KA 4UHKA 4TLDA 5EMMA 5F1OA 3RBVA 3O74A 1W9MA 2GESA 4H60A 4MUJA 1FMLA 4QDUA 3ZLBA 1T8SA 3GYBA 4YQFA 3R3ZA 2NNWB 4V1CI 3GUUA 1NFQA 1DKNA 3F5FA 4XDYA 4AY6A 3ZW7A 1QCZA 2PL3A 2PU7A 1NI4A 1M8JA 1WQ3A 4B1FA 1IBMB 3GCXA 3BAZA 3CA8A 2W2LD 3FPGA 3VV2A 3LE8A 2QLLA 3PDJA 3SSOA 3IMKA 5AI4A 1IOZA 1CQIA 2CWDA 2O7RA 1PJRA 3DL0A 1E3QA 4MYCA 1S8FA 4N7RA 4QULA 2WV7A 3IJEB 3TRDA 3UJCA 3AIOA 4AT1A 2GXUA 4EY3A 1VJGA 2ISQA 4M22A 4PN7A 2R60A 4U6NA 5BT9A 1CLUA 1JTVA 4EVQA 5AQEA 3ETEA 5CX4A 4ZIRA 5TVKA 1DC4A 1UPCA 1XBTA 2HZ7A 3PLNA 3GZTB 3SEZA 3ZWNA 4DMMA 2A5DA 1LUAA 1SEPA 3L0SA 2NU7B 3X1MA 5IT5A 1BW9B 2P0EA 3FETA 3PQ8A 4HSEA 4ZMRA 2ODWA 2YINC 1NOIA 4JQSA 2XT9A 5L9AA 3UZBA 2OCDA 3KJHA 1HLGA 5TQ2B 4GP7A 2H1HA 3ROZA 1R9NA 2AFVA 1RJ9A 1F9EA 1UMCB 1ODLA 1OHHD 3T3MB 2VDVE 3H9UA 2CNOA 1A71A 1Z7YA 3U0VA 4YJ2F 3BE5A 2EJBA 3NR2A 8MHTA 3ESRA 1FYWA 1XJWA 2OHIA 1B42A 4HAXA 4C29A 2FGKA 3I4CA 2D4HA 2P7IA 3ZWOA 3QBDA 1CRWG 5H3CA 4UQOA 3BICA 3R3SA 2OV3A 3JD1A 2IXFA 2G9UA 5EPEA 1EUYA 4H7IA 1HYHA 5IYZB 1KMHB 3HM9A 3T3EA 2NYUA 4EI9A 2RCYA 4TV8F 3UVEA 5JDIA 3FZNA 1EKPA 2IUTA 1RM4A 4W63A 3MWDA 5BOSA 1H4TA 1LI7A 2B34A 2D5BA 5EMKA 1B6RA 1WUHS 3B1JA 3EARA 3RSOA 3RC2A 4WBXC 4C7OB 2PXHA 1EFTA 1OFVA 3U16A 2XZLA 1Q7TA 3RVRA 2XMBA 2JJYA 1EFRD 3DZDA 1HT1E 2FQWA 1DOAA 2PT9A 1VSTA 2ZB7A 3DAYA 2VAWA 3WQSB 3EDYA 4EABA 4F56A 1I0LA 2AJTA 4NCAA 4QATA 3VX4A 3EDOA 1W85B 2W6JA 5DGDA 4JX8A 4ID9A 3F4LA 5DRTA 1ZBQA 4BZPA 4MUFA 4ZKDA 4GBED 3JQFA 4PRZA 1GU0A 3WK9A 1KE2A 5J23A 1CIVA 5C4IA 4CEJA 3GVXA 1PDOA 3T4PA 1EA7A 3DMRA 3TMYA 1IJEA 1YSCA 4CLXA 3MWEB 2VCHA 1KKLA 4Q4JA 4KR9A 1J2EA 4ZV9A 5FTNA 5FI1B 3KQYA 1YRBA 2P35A 3HKDA 3MJVA 3TIFA 3UY4A 2COIA 4MAMA 1Q1EA 3MFYA 3ZIAA 4DRXA 4F4UA 2FG7C 1T36B 3L8ZA 1UJCA 4MQMA 1M7GA 5IJXA 5LXTB 2UZIR 3D3JA 4FT2A 4WGFA 4K9MA 2BI8A 1U2QA 2YJTD 2W6NA 3L7CA 4NKRA 5ARCA 1JSXA 2RB5A 4IMJB 1V7PC 3FKSA 1DTWA 3DLAA 4JROA 4EQ5A 1IY2A 1YCDA 4GKBA 1XNQB 3DCNA 4Y2YA 2XB9A 3DEAA 5EUMA 1EZ4A 1TRKA 2HV8A 3QTBA 1B8PA 4KHPB 3BK2A 1XRPA 2WP8J 3FOBA 5D1OB 1H22A 2O5RA 1Q1AA 4MS1A 1DIKA 4FGUA 1LXCA 4I1YA 5DU2A 5AW9A 2GUWA 3FSRA 1Q3HA 2Q4RA 4HGYA 1C29B 2P2SA 1JSZA 3OA0A 5FDFA 2H29A 4GLXA 5LQSA 2BTQA 3EVAA 5JALA 3IMCA 4ZWNA 8GPBA 3OCVA 1KOFA 1XTSA 2P0AA 1PR6A 4Q3DA 4U2FA 3WHLA 1FNSA 4DAEA 2C57A 4KSBA 1ZRNA 5A6SA 4QPDA 4YRAA 3E22B 1P1CA 1QR6A 3X3HA 3BIWA 1F2TA 2FY8A 2NTYC 1Q0PA 5KDLA 3GJYA 1N0WA 4NBUA 3TE6A 3VTAA 3ZV3A 5IEBA 3E5RA 3MQ4A 1WD7A 2V1XA 4CKYA 4BATA 1T2NA 1ZK0A 3E2IA 4IOLA 4URVR 2QRVA 1CEEA 1I1LA 1YQQA 1ID1A 3IOMA 2X13A 1J0XO 4PZ0A 2QR3A 3ZDEA 1KRWA 4IS3A 5KWVA 2VJMB 2QJFA 2IXAA 4U8HA 4US0R 2TRSB 2EIHA 3EF0A 5SZHB 1NATA 1F14A 4IUCS 2KB0A 2HSZA 2OK7A 2QLBA 1BG6A 4S2UA 3QWUA 1L5LA 3WRYC 1EIWA 1SGWA 2DY1A 4OQQA 1EIZA 1G20E 4M0CA 2WAAA 1E7WA 1ZN8A 1EBBA 3WRWA 3BMOB 1EXDA 1TLFA 2WTEA 3BDVA 4CETA 3GUZA 3CVWA 1D6MA 4XX0B 4EHNA 1RYNA 1D0SA 2GEKA 2MSCB 1LDGA 1QGUA 5CHEA 2OYRA 4ZJUA 3O4HA 2ZSJA 2QLFA 4BBAA 1K89A 4LWZA 1G9XA 5F1KA 1FFEA 3WBBA 5JADA 1Q2UA 5MN5A 3EZGA 2O2HA 3HVKA 3VBEA 3AUJB 1DQNA 1I1HA 5EJAA 2OAP1 1GQFA 1LV7A 4PCLA 5EJEA 5GP1A 2PK3A 3B9RA 1EFLA 3GXOA 1E2NA 3D8BA 4ICIA 3KR1A 4UNNA 1CD5A 4YFYA 1DKMA 3DLIA 5IZCA 4KPEC 2BLLA 3CZQA 1L3BA 3MJ4A 3OAAD 3PFIA 4HI0E 2Z6VA 4LRYA 1E3IA 2OWEA 2W83A 1E5LA 1ZW6A 3RIXA 1ORIA 1E2JA 1UDAA 1EQAA 5KC9A 1ZKMA 2UUBB 3USCS 2HJWA 1DZ3A 2BFBA 2GF9A 3MLAA 4ESOA 1QSGA 2F9MA 2A94A 3OG9A 4LV5B 4OQLA 3OU2A 1WKBA 3GG9A 3CBGA 4L75A 1FDWA 4N9WA 4QRIA 4UPDA 2G5CA 3W6NA 3QKIA 4TYNA 3QVGA 5DDIP 3OO0A 4JYBA 4KO8A 4HXFB 4QYXA 4TKUB 1WNTA 2B1RA 4CMKA 3HABA 4EYQA 2WICA 4RVSA 3BMCA 2GAFA 1AF7A 3RBAA 4R4JA 5KYWA 3I6QA 4NH4A 4EW6A 4CF6A 1B4DA 4OIMA 2IV7A 1P3DA 2CEKA 1P4GA 2YJ3A 1W5FA 2H4HA 1WPQA 5LOVA 3IIEA 5CYOA 1I1OA 4Y1RA 3RK1A 3WLIA 1Z4OA 2HK9A 3O2SB 5CAEA 1SCNE 2YNMA 3NKLA 5I5YA 4TMVA 3ZY2A 4BAGA 4F93B 1UP4A 3TRHA 3G6WA 5ALYA 5DYNA 2NVUB 2KX7A 1B3BA 1MAVA 1L7QA 2WYUA 1CP2A 1YNOA 4HWTA 3C70A 5IBRA 4U6QA 4LG1A 4U00A 1R27A 2R11A 1ZU5A 3G9ZA 5CCXA 2V5AA 2GTHA 2DM6A 5IDWA 4CM9A 3QENA 1V1JA 1RDFA 4GDMA 5AJWA 1EUDB 3IMFA 4P0QB 1L4LA 1ZSYA 3MBKA 1GL3A 2Z4SA 3DUWA 2TSYB 3ED1A 2UYHA 2X3UA 3HO6A 5CA0F 1TL7C 2OKGA 3C5CA 2ZVQX 2V0GA 4CTMA 2ZKLA 3DCJA 1AO3A 2R84A 3EGDB 1D0VA 5F21A 4MTCA 3W7VA 1PL6A 1B2LA 3G8BA 3RBXA 3TNJA 5EC8A 3ZDYB 3WGVA 2Q2QA 5BYJA 2FW9A 4XSGA 2Q0QA 2JFQA 4GSLA 1XTRA 3EIOA 3PEVA 4C7JA 2FK8A 3LSTA 3PDHA 1JXOA 4W6ZA 1Y8RB 3GRFA 4LOJA 1L8XA 1F8UA 3RROA 3AEUA 4IVPA 5IJAA 3QUQA 1S2LA 5GM2A 3BXPA 1CUJA 1K7FB 5ETJA 5JXIA 2AQKA 3FPJA 4KDFA 2ZM6B 2Z5FA 2WWRA 3LLCA 3O38A 1FVHA 2HIGA 4QECA 4C2TA 4MRVA 3FX2A 3N75A 2WTNA 1NW6A 2Z5LA 1WXDA 2CXTA 1W5AA 2D74A 1TU3A 3U7QA 3MWLA 4LRUA 3CRNA 4G5FA 1I24A 2IPLA 2ZRCA 3DH0A 3DEZA 4EJSB 2P68A 4G1UC 3QFCA 4BWFB 3X0DA 4OB6A 1QZ3A 5BMVB 1RMTA 1SHJA 5B2EA 3AV0B 1S2NA 2QRNA 4O8ZA 1VJDA 5BW6B 2ZUDA 3X1KA 4B8YA 1Z0JA 2DPXA 4IQ4A 3CCCA 1QX4A 4II7A 3OJXA 4V3BA 4EG5A 5BW5A 2FGJA 4GYYA 2C42A 4PHHA 1DMRA 3IMGA 4KKXB 3N5KA 4QUBA 1FTNA 1EFDN 2IX9A 2O2JA 3PGA1 4LK2A 1VJ5A 3L40A 3NV7A 3OBBA 4TWJA 1DTSA 4EAAA 3FWHA 1Z6YA 4MWCA 1MQ9A 4OU4A 3L7OA 2WUFA 4N0EA 3TW0A 1SRRA 3OP4A 1ZICA 4B4OA 1IBCA 4ZN6A 3QQMA 3KVVA 3O93A 4GT1A 2IYNA 2HDHA 3TO5A 4A6EA 5EHQA 4FFMA 3IT1A 4AECA 5DSTA 1RQGA 3KJFA 2C1ZA 3SBEA 4MMZB 3TQRA 3V1YA 2JFGA 1AHPA 4IEEA 4LFBB 3PG5A 2O4UX 1CQJA 1XDZA 2GPNA 1NNI1 4OH1A 2O5EA 3GAZA 2BOVA 1G17A 4C9BA 4ARZA 2HX1A 4KBYA 1KJIA 1O97C 3CZMA 3NXSA 4E2WA 1U5AA 1CUDA 1JILA 4LMRA 1RHQA 4RAOA 2PS9A 3QNMA 1LKZA 4TMYA 4ZKEA 1KYVA 3N74A 4MX8A 4EVRA 1G38A 1P61B 3E3NA 3UA4A 4WY8A 5FRDA 3EIHA 3WGHA 1OD6A 7ADHA 4NOLA 3I2JA 4RV5A 4BGIA 2UYGA 3MJCA 3QBVA 3KQQA 4BBJA 5JSZA 4KRYA 1YZNA 2JAOA 2OESA 4Z4QA 3H5IA 1OIVA 3BBLA 3F96A 4XYLA 3HY3A 3ORRA 1GTG1 3PF8A 3PC8C 4ISBA 2ZR9A 4O4HB 4BVEA 2H2HA 3BK7A 4F4FA 3QEOA 3LC0A 1AGPA 4G1VA 2IHVA 4AI6A 1FYEA 3JZAA 3T94A 4BE9A 3TGLA 1AD2A 4MVJH