4FFWD

Crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with fab + sitagliptin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
217
structure length
209
Chain Sequence
EFQLQQSGPELVKPGASVKISCKASGYSFTDYNINWMKQSNGKSLEWIGVVIPKYGTTNYNQKFQGKATLTVDQSSSTAYIQLNSLTSEDSAVYYCTRFRDVFFDVWGTGTTVTVSSAKTTAPSVYPLAPVVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 4
publication title An Inhibitory Antibody Against DPP IV Improves Glucose Tolerance in vivo - Validation of Large Molecule Approach for DPP IV Inhibition
rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/immune system, inhibitor
total genus 28
structure length 209
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ffwD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ffwD02
1Z5LA 1NCBL 1ONQA 2NR6D 5HJ3A 1BQHG 1GZPA 3V4UL 3MA7A 5DDHA 4Q9RH 1SM3L 2WNGA 1J0KA 5AD0A 3WXVL 3BO8A 5CEZH 1MVUA 4ODUB 4D0BA 2ADIB 1T2QL 4RMUA 1ACYL 4XX1G 3IVKA 2YUZA 2D2OA 3O3BB 5GRVK 3WD5L 2QSCH 2VQ1B 2IANA 1L4IA 3LDBB 1N5YH 3BW9A 5T33H 3SDYH 3LMJH 4JFFE 2AKRA 1U8MB 4WHTB 3VXOB 3E6FB 5JUEH 3V5KA 2Z35A 5K59F 3O45A 4NZJA 4QRSB 2DB8A 4LPTA 2VDRH 3RWIB 5D9SB 1YPZE 1TTFA 1NCUA 4MD5A 4OKVB 2QLVB 3B6SB 4ALAL 4OZ4B 3ZMRA 1UM5H 3TEUA 5HGAB 3X13A 4HKBB 1AO7D 4Y4FA 4RGMC 3PHQB 4X6FA 5CS7A 1WC7A 2AK1L 3OKKA 32C2B 4KDTA 5EO1A 1CBVL 1PFCA 5ABDE 4TSCH 4UQ2B 4R2GB 5JW3H 4K7PY 2FZ3A 3OMZA 1OGTA 5D70L 1NLDH 4HJGB 5CP3A 2OTUB 2EDXA 1HI6A 4PD4K 1CDUA 1UB5A 4TUJB 3VXPA 1NANI 2HVKB 3VJ6A 4E5XA 4LNRA 3M1BB 5GRUH 3OJMB 4F7MA 5TF1H 3CSGA 1HZHH 3C09C 5BZWA 3TH4T 3OR6B 2XKSA 1HOCB 4KXZH 1OSZA 2AXHA 4DOHE 1OT2A 2Y07H 4K7PX 4QOKD 1U58B 3D25A 3MV01 5BVJA 1G1CA 3V7AG 1X6LA 5DD6A 1EIBA 5I18L 4MAYC 3V5HB 5IB3B 3FOMA 4KRLB 4P3CL 2X10A 2OXHA 1P7HL 4PBVC 1B6UA 1YMME 1I9JH 4K3EH 1ZLWK 2R1XB 4UILH 2HLFC 1AQKH 4HFWA 3B5HA 1TETL 4PJAB 4FXGA 4RNRB 2JCCE 3VWKC 1UCTA 4YHPA 4N1CA 3IF1B 4KK8D 5L0QC 2YD2A 5A16B 3TA3A 4MXWL 3WJJA 4ZUTB 2HFEB 1RMFH 1F42A 4ONGH 2ZG1A 1DBKL 2YBRA 4JJ5A 1MH5B 3IDIA 2HLFD 3MJ6A 2VDKL 4ERSH 3VWKD 5GGTL 1JYWA 1HIMH 1UCBL 2BNRA 5JW4N 1YMHA 1V7NL 2BVPA 4JREC 5D6DC 3U36B 1F58H 1IZJA 3UTPE 2FB4H 5AAWA 4KROC 4P5TC 2CXKA 3S3JA 2ADGB 5DUBA 3HLAB 4LP5A 2QQKH 4MNQE 4ZYKB 3SHSA 4N68A 1NUGA 3O9WC 4LBEB 3FQRB 5EDXA 1UM4L 3PHOA 2NX5E 4KROD 1ZHNB 1LP9A 4P5TD 4LCCA 2ZNXA 2NY6B 1KPRB 1RIUL 3FRPA 4NQCA 3VWJB 1J1OL 4GSDL 4XPGL 3UZVB 4XNYH 3I3BA 2GSGB 2GT9A 4RWYH 5IT2H 4ZPTA 2CLZB 5TQ2L 2J8UF 3O9WD 5C7XH 2H6PA 1L7IH 3LQAL 3FOLB 3HMXA 2FCBA 2FYYA 1ZGLB 4DZBA 4JG1H 1R5IB 2ICEA 3NPZB 3O2DA 5JXED 2VISA 1D3CA 2Y1VA 4G8IB 3RUGF 4HIEA 3UBXB 2X89A 1VSCA 4MA8H 4QXUH 1WT5A 3QEHB 1DLHB 4K3DH 2CSPA 1ZLVH 3MJGX 5EZIH 2YPLD 4ZODA 4LDEB 3WIFB 5T1KD 4PV8A 5CILH 3V4PH 1LEIA 2HH0L 5DHVH 1G7JA 4NWTH 1KELH 3Q5OA 4BKLB 1TCRA 1A7OL 5E6IA 3UJJL 4OJFL 2Z31A 4NJ9L 3QFDA 6CGTA 1YY9C 3OV6A 5TPWL 3L9RB 2YC1A 1EXUB 1H5BB 4BSWB 5D7JD 3FQTA 1OOAA 4JQIL 4DAGL 1PYWB 1G7LB 1MWAH 3EYQC 1A1OA 3CX5J 3LKSA 2ITCB 5JR1H 1B0GB 3O3EB 4IS6A 1HHKB 1C7SA 4WW1A 1MHCA 1NCTA 4QHUB 1JRHL 1T4KA 4XPTH 4CNIA 3UTPD 1YY9D 1MOEA 3DTXB 5DJXA 1HWHB 3VXQB 3UAJD 4DUVA 1JFQH 5EBGA 4MB3A 4GKZB 2O93L 4GLRI 1M71B 5EN2B 2VLJB 1HHIB 3CK0L 3NPSC 4F2MA 5DZNA 5JW4R 3RJDA 4MNQD 3DX6A 4G7VH 5EOQH 3DX7A 3U9UB 4Y19A 4HUWB 2H2SC 5FOBB 3U0PA 1I1AB 4ELKA 1RUML 4YE4H 1C5BH 2M26A 5AUMA 3RWDA 2AJ3A 5DRWB 1J8HB 1VFUA 4TUKH 3S35X 3V9FA 4KAQL 4LPXA 1IQWH 4F9LC 2P5EA 3SDCC 1UKQA 2FO1A 1AKJD 2JK5B 5CEYB 4N0UE 4LPWA 5IF0A 2H2SD 2FJFB 4DEPB 5KVDH 1S7SB 1TIUA 3IJYB 4WRLA 5CEXB 5D96B 1VGEL 1QSFA 5BV7B 2X4PB 3M17A 5D2LF 1X5ZA 3TJHC 1LE5A 4HGWA 5LBSL 5FF6A 1R0AL 2KKQA 2QQQA 1MCQA 1PW3A 5T3ZD 3T3PF 5CBEB 3HZMA 4M7ZB 2CKNA 1L7TL 3OGCA 3MACH 1ZVSB 1UYWH 1NSNH 4IRJD 4OZIF 1IAIM 2GAZA 3LN5A 3U6RA 4WU5A 3GJEB 1PZUB 2CRZA 5GGRY 3N9GL 4KQ4H 3HE7A 2IAMC 3RRQA 4DZ8A 4HGKC 1WQVT 4NHUA 5JO5B 1JJUA 5IK3A 2YUWA 1FFPB 4YXHL 4PP2A 1I8KA 3P0VL 5I1KL 1K5NA 4Z0XB 3BEVB 1FGVH 2OS7A 1J0ZA 3CSYA 3GJFA 4HS3A 3KXFD 3BJLA 4ORGB 3RL2B 1GPOH 3QDJE 4H8WC 4X7SL 1MJUH 4JZNA 2VRAA 1NEUA 3DGGA 2IAMD 3UTTA 2LVEA 5DLML 4WW2C 4MS8C 5DUPH 4LHQB 1OPGL 3ROOA 4RBPK 1IGYA 2BNQB 4KMQA 3QWOB 1NMAL 1G7MA 3U1SL 4ISVA 4LSUL 3T2NL 3FO0H 1JYNA 3MXWL 5I66A 1EBAA 4MS8D 2DBLL 1RU9L 1MCLA 1KCRH 1URLA 1RJZB 2NQCA 4O51B 3UTZA 2ZPKH 25C8L 4FQXC 3FONA 5JHDE 1WWWX 3MRJA 2XQBL 3EYFB 2XFXB 5J57B 1CE1L 4JPVH 1HSBB 3NABL 1A22B 4P3WA 1GGCL 4OLYL 4K94H 1L0YA 3H9HB 4ZAKA 4JQVA 3RWCA 2EZ0C 3SEPA 1JGLH 3EOBA 1AP2A 1AFVL 1MIEL 4TQEL 3VXMA 4ESKA 2P47B 2BMKA 5D1ZA 4FQXD 5I1AB 3VG0L 5FA3B 4LOUD 1D6EB 5A2FA 2P46B 4OCXL 5IFHL 4U7SA 4OLEA 3S88H 2J8UA 1J05B 2D9CA 1N6QL 4NZTL 3T77A 1LD9A 5KSBE 4PR5A 5AWNH 2Z4QB 3T65B 1MLBA 3RTQD 2MKWA 2OTWA 1C1EH 3IFNH 1HXMA 1P7KB 4WI6A 5C0CA 1Q9LB 1BBJA 3LV3B 2DQIL 3U0WH 4RISH 2PYFB 3RUGA 3K1KC 3WO4C 1JTTA 3QNXB 4MZ3A 1YQVL 3Q5YA 1PLGL 1Y6MR 4YDVB 2WQRA 4KK9C 2Q8AH 1TVHB 3MC0A 4D0CB 3EIFA 1FYTB 3LEYL 3MGOB 1VGKA 4LRIC 2XA3A 3ZKXC 5FYKD 4E0RA 1NC2A 1F3DH 4ZSOB 1TDQA 3HAEG 3GI8H 5LQBL 4JY5H 3KPSE 4NDMB 4P4KA 3DUSA 4HWEL 4YHKL 3MXVH 1JGUL 3WXWL 4N9GB 4TTDC 3RY5A 1JV5B 1F4AA 1P84J 3EFDH 1W72L 5ADPH 5I1HH 3WEXB 3ZTJH 2EICA 4H0HB 1ZKAA 1X5AA 3VMOA 1CICD 3WDHA 1LO4H 1JHKL 2HKFL 3KLAA 3U0TA 3EFFB 1WBXB 3WFZA 4DGVL 4AZ8A 4GXVH 3WKMH 3BH9A 4JDTH 2NY3C 3HPJB 4YHLH 5EORH 2P8MA 1D7FA 3OAZK 4Z7WE 5SWQB 5HYEA 4KRPB 1QP1A 2VYRE 1GYAA 2UZIH 3AS2A 4WUUB 2B5IC 4KDVA 2R56L 4V2BA 3SY0A 2Q8BL 3NVQA 4DKFL 4LCYA 4GMSL 1UZ8A 5D6CB 4PUBH 5I71C 1S5IL 4M43L 3PXHA 5CJXC 1KFAL 1RULH 2VZSA 2NY3D 3OHXB 1WUNT 4U1MB 3HC4H 5EUOE 4DTGH 5F7YC 1HDMB 2NY1C 4W4OC 3TNMB 4NQSA 5H37G 4GRLC 2VZOA 2N1KA 5F1SA 5I17B 3DURB 3TBTA 1PGRB 3DMMB 2FLRT 1HH6A 3BWAB 1ZEAH 1WIUA 2H3NB 3ARWA 5JZ7C 1UKTA 1NC4D 4ZS7L 1TPXB 4F8TA 1DUZB 5D2LA 3UZQA 2DIJA 2NY1D 2FLBT 1RZGB 5D7LA 2PR4L 1VA9A 4GRLD 4XNMB 3PWUB 4R8WL 3OKDB 3QNZA 1QA9B 3DIFA 2HJLA 2UZYB 5L2KB 1BFOA 5KAQF 3D3VE 5M7QA 4P49A 5JZ7D 4XX1E 1WFNA 1ONQB 3KNBB 3LQMA 2AXGA 3MA7B 4LLMA 4ZXBA 4K9EL 5AD0B 1BPVA 4BZYA 1IC1A 4OZIA 1KENL 4Z7QF 4U0RC 3KPSD 2BOBB 5FYJL 1WTGT 5I8KH 2VDKH 3IVKB 5C09D 2A6DB 4ZOBA 3BKML 2X1OA 3H2WA 4HV8B 4OM0L 1FNHA 4PTTA 5DWUH 4UNVA 4MDJA 2ZG2A 1WLHA 4JGUA 4HUVA 1W0VA 1IEHA 3HUJB 2OZ4H 2AKRB 5CGYC 1KNOB 3V5KB 2Z35B 3O3AA 5ALBH 1G84A 5C07A 3QQ3B 4MNGE 1CT8A 4MD5B 4Z5RB 1ED3B 4XPBH 4K7FA 4JAMB 4UIMA 1T2XA 3S36X 5J12B 1BJ8A 1IE5A 2B7DT 1T1WB 5E0QA 5IHZA 4L4TA 3G5YA 3IETB 2R69L 2D31B 3T2PA 4X6FB 1GGYA 1IGFL 2ZUYA 1BQLH 3OKKB 1KBGL 5CGYD 5AYUL 1KG0B 4IRSC 4PJHE 3MV9A 3KGRA 3SCMC 4TOYH 2YD5A 4K2UH 4OZFB 3ISWA 2PYEB 1FQ9C 3VJ6B 4XNZC 4LNRB 4JFYB 4U1NA 4EI6B 4Y5XA 4MXQC 5BZWB 3PGCA 5E8DL 1DZBA 3ZT7A 4IRSD 1U6AH 4MA3A 5BVPH 5J1TC 2VDOH 5L8LB 1RUQL 2D7QA 3D25B 5BVJB 2ORBH 1WBZA 4P9HC 5DD6B 3TN0C 2C5DC 4K71B 4OF7A 4M1CD 3HC3H 2B0SH 3QO1A 2HFGL 1R3IL 4D8PB 1V3LA 4PG9A 1XMWA 2UUDK 5CP7A 5I1JL 5FUZH 2FL5A 1A1MB 1OW0A 2BNUA 1N7ML 3QIWC 1Y0LA 1UWEL 1DQML 3LEXA 4FXGB 3WHE1 5HYJE 4TYUA 3UJJH 3QBTB 5I1CH 1G7HA 3TN0D 3RDTB 4GBXA 2VQUA 3CMOL 4ODWB 4UTBL 3VFOB 3BD3A 5I0DA 1QPPA 3DRTA 3ILPB 3PV6B 4PRNB 4PGDA 1JZ6A 3V8CA 1MCIA 5KANI 4P2OC 3WKNA 3BIAX 4R3SA 4QF1A 1H0DB 3L7FA 3JUYA 2VLME 3CVHL 4F7TB 1FZJA 4HZLB 5TDNA 4QTIH 2PO6C 4PJ7F 5DTFB 1KEGL 1ZWIA 4OD3L 4JQXA 1N0XL 1RJCA 3OJVC 4KI5C 2QHRL 4P2OD 1NAML 2AS5M 3VXUD 2VXUH 2VDLL 3U7YH 3FN0H 3VGHA 4RCAA 3T0DA 1RUMH 4LGSB 1N6VA 3JVGC 1A6WH 2NY2B 2PO6D 4JRXB 4Y2OA 3S9DB 1LP9B 1ZMYA 3WJLA 2HYMA 4XP6L 3MRMA 1UADC 4NQCB 2PKDA 3MFGB 4KI5D 4ZO9A 1T1ZA 1AJ7L 4X5XA 4FQHA 4JO3H 4XZUA 5GISH 1E4WL 3S4SA 5MEPA 3KYNA 3MOBL 2H6PB 3RQ3A 1RIVH 1A3LL 3GHBH 2FYYB 3IXAA 4JPIB 4P4RB 1YC8A 1R0AH 3T0EE 4GH7B 3GSNH 4BK4A 4RGOL 2VAJA 3T0XA 5H2BB 3JTTB 3BJ91 3MV7B 3KYKH 5HYJD 3C09B 4HPYL 4MJ6B 1BGXL 1RV6X 5DD0L 1KJ2A 4PG2A 2I25N 4IOSD 4WFED 4JFOA 4JN1L 3HC0A 2ZUTA 1TCRB 4MWFA 5E6IB 5I1GH 4WWKC 1QFOA 4L29B 2HMIC 2AK4E 3PQYA 3V0VA 3O6MH 4HC1H 4MAYB 2CK0H 3V6OC 1D9KC 4M9OA 3ARDB 1XF2A 5DJ6B 5I1LB 2B39A 3D0VA 3QDGB 5EBLA 2X40A 2IQ9L 3V6FA 2CKBB 4OUUA 3G5ZA 4WWKD 2X9YA 1TZHB 4CDGC 2HMID 3IJHB 4HT1H 4IIQA 3LS5L 5DJXB 4KGJA 3GRWL 4Y4HD 4QCIB 5CKAA 5KVEH 4ZO7A 1OAZL 5A1AA 1D5ZB 5I76A 3QHFH 2V17L 1Q9WA 1SEQH 4WEBH 4NQDD 3E3QE 4S1RH 1AE6L 3WS6C 3BGAA 5BS0E 3V0AC 1FFRA 3P9MA 3O41B 4MJIB 1HYRC 3F62A 8FABA 1DBJL 4Y1AE 1EO5A 4Y19B 1BZ7B 4PJGE 3SE4C 5E24E 2AGJL 1UENA 1YEGH 1UEYA 2OI9C 2FHCA 1RJLB 4JFHD 3O2WH 5F93C 2IH3A 3NAAH 4MD4A 1FFNB 5ITFA 5IF0B 4Y4KA 5FUOL 1E27A 2D7NA 4OQ1A 1JK8B 3GBNL 3TNNB 5A43C 1YNLL 4W70A 5I19L 1ZLSL 3O9WB 2J2ZA 1MCSA 1BHGA 3V6ZA 1AGFB 3QHZL 1FNGA 3GMQB 4HS6B 3GK8L 5FF6B 2CGRL 4FQLL 3HZMB 4GRWE 5DI8A 3U48A 5I1EH 3UTSE 4APQC 3AREC 4F7CA 3VD9A 4HBCH 5F7HA 1LO5A 1DN0A 3LN5B 4C56A 1U3HD 2MHAA 1XGRA 3L95B 2E7CA 5HDQH 5K9JL 4XHQA 4ONFL 1FNFA 1T7VA 4NHUB 1BEYH 4DN4H 5IK3B 2MWCA 3ARED 3QEGH 4PP2B 1I8KB 1RHHA 2HRPH 5EU6A 1K85A 4P2YA 1FO0A 4DK6A 2GEEA 1F11A 4UU9B 4C4KO 4F15C 2GQHA 4BQBA 4UDTA 2DMBA 1GGIL 4LVOC 4WFHE 4L3CB 2UWEE 3UTTB 4J4PA 3D2UD 3PWPA 4YIQA 4WO4D 3BGMB 3IFPA 4M8QB 4RX4D 3EYVB 4P23C 1IAOA 1C7TA 1L9MA 1H15A 1UJ3C 1FIEA 1N8ZA 1FNLA 1CXHA 1G7MB 4ZFOA 2HRLA 4R90H 1T1YB 4HW6A 3EYUH 3QPQC 1Q0YL 2VKXA 1BFSA 4C54A 1U8KA 2BJMH 4EXPX 2H1PH 1T22B 4P23D 4WEUD 1F4HA 1M6OA 3G6AA 4PJ7A 4O4YH 1CLOH 3BX7C 5SWZE 1QRNE 1PX4A 3NPSB 1AR1C 1AD9B 4JY6A 43C9A 2Q6WB 2EE3A 2EH8L 5IKCA 4ZAKB 4HK0A 5EO9A 2B4CC 1W0YT 4KMTL 3RWCB 5C0JB 1KN4H 3EGSA 1EA9C 4KJWC 1P4LB 1WZMA 4YXLH 5A40E 3VXMB 3RZCC 2BMKB 3VDBA 2IBGA 4RAUA 3JWDC 1UKSA 3FB6B 1AR1D 3T1FB 3ZYOA 1B4JL 3SDCB 4N8VB 4M1DL 1DVFA 2X6MA 3HCVA 4UNUA 4Z9KB 4JFEA 3I50L 3SO3C 4AENA 3HZYB 3B2VH 4OUOA 1B2WL 2W9DH 3S35L 1LD9B 2ESVE 2VMFA 2C3VB 2BVEA 2EDEA 3CFCH 3FKUS 4EDWL 2CIKA 3VMPA 4NP4H 4KTDL 3BT2L 5EZOH 3VMNA 4DKEL 5IW1A 4MJ4A 1BZQK 3P77B 3HNSL 5F6IB 3MLZL 1MCPH 5D72L 3OKMB 1GCFA 1IEBB 1XF3A 1KV3A 2VKWA 4NBXB 2R0ZH 3HMXH 1VGKB 4JLRA 3E8UL 5FGRA 1SJEB 2Q76A 5F7EL 4WFHD 2X4NA 4DKDC 3GMPB 2I60H 4ZTPL 3O2DH 1ZA3B 5DD1L 5CFHA 2VDQL 4P4KB 4TUOB 4MSWB 2VLLB 4OM0H 3DUSB 1XGPA 3BPOB 2RIKA 5D7IE 1J1XL 3AMKA 4PJ9C 6FABL 3TZVA 5SWSA 4LKCA 2ARWA 3VA2C 3HPLA 4PJ5A 4ZO6A 1T7WA 4LQFH 1KXTB 1DSFL 3ZE2E 4Q0XH 3IGAB 4PJBA 5DMIL 1EO7A 1WIPA 2FDBP 1FPTL 4LLYA 2XN9A 4WI2A 4NQEA 3OXSA 2DQUH 3F58L 2BFVH 4GAJH 1T5WB 1S7WA 4TNVK 5E08H 1KPUA 4LCYB 3OXRB 4PRIE 2DIBA 4WV1C 4ZNEA 3L5XH 3O6KH 3U2SB 2XZZA 3GDBA 3HN3A 3NZ8B 3L1OL 1U92B 4HKJA 1YY8A 5I16B 1DBML 5E8DH 2OP4L 1U41A 3ESVF 4JGMA 5DMJB 3ULVC 3BDXA 2EDYA 1NCCL 1HH6B 3TH2T 1VKXB 3VFPA 3GB7B 1J0IA 2IFFL 1JGVL 1YA5A 4ZOCA 4WTWA 3MOAL 5E99L 4Y2DA 2AJXH 4O2EA 5IWLA 1ZHLA 5HHQB 5D2LB 1A4KB 2C7UB 2A74A 3PJSA 4P0DA 3B83A 3O3UN 5IB5B 3DV6B 1DLFH 3CZFA 3P40A 4JHWL 1CGSH 3QNZB 4JKMA 3DIFB 3DV4A 1BFOB 2CXGA 5HYSA 1YPZF 1T83C 4R4BA 3R1GH 2WANA 4JZJA 4QXWA 4DUXA 3ULUL 2CJUH 2JJUA 4NOBA 4ZXBB 3EAKA 5C0AE 3VFRB 3CMOH 2EO9A 4XBGA 4KXZI 4OZIB 3WFCH 2W38A 4AEIL 3PUCA 1I3RA 3D69A 4MLIA 2VDNH 3UX9B 2WINA 4AY0A 5LCVH 4M6OH 2AEPL 4NNPH 4XRCB 3H9SE 3MLSL 1EFXD 1FE8L 1QYGL 3FTGB 3RIAF 4PTTB 4GQ9L 4PBWD 2KUTA 3TH3T 4PRHA 5F9DC 3Q3GA 3VD5A 5FYLL 1ZE3C 2IF7A 3RGVA 2VABA 3MCKB 5GJSH 1ZT7B 1W0VB 3LKRA 3TYFA 1SEBA 1F6AB 1RZ8A 5T1DL 1A64A 2AEIT 4OZHE 4H1LA 3C5ZA 3ZKXB 5C07B 3P11L 2AVGA 4K7FB 1TFHA 2J6EA 4KFZC 4Q6IA 4UIMB 3VRJB 2GFBB 3FFCD 1MY5A 5IHZB 1DP0A 1QFUL 4YBHA 4L4TB 1E6OH 3QI9A 4KK6C 5CZXC 4YNYA 1NMBL 4OLUL 3GJFH 1RURH 4XXDB 4R26H 5HHNA 5BJTA 1CG9B 4LLWA 5D8JH 4X7DC 1X5GA 4NO2A 2HVJB 4H0IA 5CWSB 4YGVA 1E4WH 4KK6D 2DMCA 5CZXD 3VFUB 2OL3A 3MJ8B 4V1DA 5FYKU 4P2QD 1NFDE 4Y5XB 1XIWC 4H26A 4YDKL 4U6HB 3C08L 3A67H 5LG1A 4KGLA 1LO3L 4X80H 5GGUA 4MA3B 4CDHA 4YFEA 3OAYH 2B5IB 3FO1A 1DQQB 5FA4B 2VO5A 4NQTA 5JDSB 1OP3H 1WBZB 1HH9A 5HHOB 1KLGA 3KLHD 1CTNA 3QO1B 4MMXC 3MLUH 1A9BB 3VG9B 1X5LA 1KYOJ 1XIWD 3HI1B 1NCDH 5J0BA 3D39B 3QQ9D 1VCAA 2FL5B 4HPYH 3SJVD 4JDVA 1LO2L 5E2TH 2UY7A 5BV7L 1JF5A 4TNVF 2LVCA 4F33B 5C0IB 2NY7L 3FFDB 5C0AD 1EGJL 5C2BH 1QFWL 2ARJA 4J6RH 1OSPL 3D18B 4UAOC 3QUYD 2YPVL 1RZIA 1AXTH 1HE7A 3D85D 1ZSDA 1KJVA 5BRZA 4CN6A 4CBPA 3ZTNH 4K7PH 5CGTA 1M7XA 3ZL4L 4FQ2H 1I9IL 2J3SA 1QFHA 1INDL 4OBSA 3RPIA 1K6QH 1WTLA 4TNWK 2IBBA 5FXCH 1BP3B 3L7FB 3O6LH 4XVSL 3Q1SL 2P5WE 3I84A 4ZUVA 3MV8D 4Z7VB 4U0RB 4P57A 4JCLA 5AG8A 4PLKD 4LARL 3V2AR 1AO7A 2X4QB 4XCEA 1CFVH 3FB7A 2E9BA 1FRGL 4KDWA 1MI5E 2PUQT 5DJ8B 4K3JL 5MENB 1KIRB 3KPLB 1MJJB 4Y16C 3MZTA 4P2RB 3RHWF 3T8XA 5BO1H 2DLGA 5DJCB 3L5WA 3A6BH 3ECBA 1FYHB 1MRFH 4YX2L 1K8DB 3DROA 4ACPA 2G5BA 4WU7B 3QDME 3H3BC 4X5XB 4FQHB 1MFNA 4QOKA 3S4SB 3IKCA 2XY1A 3O4LD 3ORJA 3RWHA 4OB5H 3RVUC 3QRGH 3IXAB 4EN3D 2K3TA 4UV4L 3PP3K 1QSED 1KCVH 3S36L 3BRDA 1D6VL 1G9NH 3QIBC 3HE6B 4ZFGL 3WUWG 1DDHB 3SCMB 1HXYB 3I2CL 5DF0A 1P4IH 3GBMH 3GM0A 4QRRB 3GSOA 1ZLWH 1CDJA 4XNZB 1KUMA 2YMXL 4NM4H 2NYYC 2DM3A 2GTWB 1KJ2B 2W59A 4IOFC 1EEYA 1QSVA 2HFFA 1T04B 4LSTL 2XY2A 3MRBB 4JFOB 4JE4B 3HC0B 1A6ZA 5F3HA 4KVCL 1J7VR 2DQEH 5DEZA 3S96A 3TN0B 2C4XA 4S2SA 3QR2A 1TJGL 3KPTA 1XF4A 4M5ZL 2A6KB 2R2EB 3VI4F 4U1GC 5D93B 5E6ZA 4GW4A 3EJYD 3TO4D 2A6JB 4IOFD 3D0VB 3QIWB 5DJ2A 5H94A 2HT2C 3DECA 1YPZA 4YXKL 1XT5A 2N56A 4U6XB 3G5ZB 1MIMH 1JVKA 4KTYA 4LKXA 3TT1H 5CBAB 3MR9A 4WI8A 2P8LB 4Z95H 1YUHA 4G6JH 1AI1L 4N90E 2WIIA 5CAYB 2FO4B 2GCYB 1CXEA 3B8SA 5I76B 2FGWL 2C1PA 1HHGB 4L5FL 2YSSA 1NCWL 4HFUL 2HT3C 1FNEA 4X6CE 1MI5D 1DUYA 1QNZH 2HT2D 2R2HB 4UB0H 1GOGA 3QXWA 3REWB 2YD1A 1WAAE 4POUB 5E2WL 3PGDA 3ZHDA 4CW1A 3TC9A 3ZKQD 3S34L 2X4SB 4HH9B 2QBWA 3SDAC 1G7PA 2BZDA 3INUH 4Y5VB 3UDWC 1YEDA 4M7JL 5JIKA 2WLZA 4QWWC 3VXSB 1XZ0A 2EE9A 3EDJA 4QYOA 4AH2A 2IH3B 3FQXA 3MRGB 3W2DL 4WGVB 2YD3A 2XWJA 5ITFB 5IQ7L 3ZKNC 4Y4KB 1E27B 3VFNA 1MCJA 4OD1L 3G08A 4EI5A 4XVUD 5JXEA 3IDYC 1NLBH 3BP7B 1NH6A 1RUPL 5K9KA 1X5FA 3TWCL 2ITDA 4PRAA 5IVXA 4QWWD 2A2QT 3UPAA 1QR1B 4UTAH 2HJFA 4QXGH 4X9BA 4HJJL 4E41B 4GQPH 3MRHA 3ZKND 5ESQA 1N4XL 2XZCL 2DL2A 1NFKA 3QXDB 3U7WH 4F7CB 1EBPA 3O8XD 5C0RL 1JPFA 2LAAA 3C9NB 2GJZB 4XNUH 5D2NE 1DN0B 4J8RB 5B3JE 3BPCB 4KTDH 4PJIE 1L0XA 4Z76B 1XGRB 1F90L 4PP1C 1EERB 5D7JA 4YR6B 2W60A 4MQTB 5DHXB 1FL3A 1BJ1J 1NGYA 1OCWL 3TO2A 5ID1B 1FL6A 3HNSH 1F13A 5E8NB 3MLZH 4TSBH 4XCYA 4P59L 5HHMD 2L4OA 2YKLH 3PL6C 4YFLI 1MAML 3DVGB 1A47A 1P9MA 3KPRE 4JRYD 5I15H 1IT9L 5F7EH 4M61B 1NGQL 2OJEA 3ZT5A 4PP1D 5IOPB 3E6HB 5DEFB 5EFIA 5C6TH 4QRTB 1H3VA 5LVEA 4R4NC 4LFHG 4RMWA 3F8UB 3FO2B 4MNQA 3ROLB 3B9KC 3RBSA 4YIQB 4Q9QL 3OR7B 1S7RB 5FGCB 5JIPA 3BKYH 1IKNA 1D9KB 5E9DB 2VLKD 3B9VA 1V05A 4J3SA 2NX5A 4PJCE 1CGVA 1LK2A 1T0MA 2X4RA 3L3DB 4NQDB 4KKLC 2Y9RT 4C83A 4PJXB 3QG7L 2B2XL 3QCVH 1U8KB 2HT4C 5F1IB 2PXYC 4OT1H 2IANE 7FABL 1LK3L 2FNBA 4ONOA 1AKJA 2D9QB 5IW6B 2H8PA 5DYOA 5F9OL 4HDIA 2ZUQB 3G6AB 4PJ7B 3KPPB 4OLZL 1CFSB 1U8IA 1FDLL 4P9ML 4I5BB 2OCFD 4KKLD 1VFOA 2XICA 4HK0B 5EO9B 4NKDA 5TE7H 3TIEB 5M94B 1ZS8B 2PXYD 4OQTA 1BM3H 3DRQA 4L8SA 2AI0L 4KKAC 4EUPA 5HVWA 2ZUSA 1IMHC 3DSFL 4G6FB 2XOTA 3QXAA 5DJDB 2XT1B 1BF2A 2X41A 1U2HA 3W9EA 1RZ7H 5DVOA 5C6WH 4JFEB 4IRJA 5GSVA 3QFJB 4K8RL 5C08B 1TQCC 2OYPA 5J89A 3HI6H 4GS7C 3OX8B 3O6FD 4XCFH 5KW9H 4KKAD 4D9QD 1Q1JH 5D1QC 2WUCH 1F2XK 3VGAC 5JOFB 3P4NB 4OLWL 4L3EB 4DWHA 4N5EC 4LASL 1BX2A 3KXFA 4NJAL 1DANU 1A7RL 1EHAA 1YJDH 1HWGB 3MRCB 4X6DB 3LRGA 5DRZA 4APQB 4OFKA 5D1QD 4OF8A 5GRZA 3H7BA 3VXTA 4M93C 2IADB 1G9MC 2Q76B 2E27L 4Z7WF 4CMMB 1HILA 1H9VA 5B22A 4N5ED 1CIDA 1Q9KB 1UXWA 4YHYB 1XGPB 2CLRA 3SE3C 4RBPH 1R3JA 1YNKL 4FABH 1MHEB 4LKCB 5IMLA 1PSKH 2F54E 2QKIB 3DX8A 1KJ2H 5EUOF 5HVGB 3CC5A 4ZMAT 4F15B 3KPQA 3BXNB 4QXTA 4LVOB 1QVOA 4RRPA 4N0UA 4QRPE 3TV3L 4LLYB 2XN9B 1TNNA 3OXSB 5F1OB 5ICZA 3GMRB 4GOSA 2HWZL 2VXSH 3BAEH 3BHBB 3GKWH 4FQXA 3H8NA 4AIXA 3BSZH 3RNKA 4U3XA 5KVMC 2PTUA 4BZ2H 2EDJA 5BZDA 4ZFZB 1MHPL 2ERJB 1YY8B 4IOIB 1IM9D 1N26A 3MJ9L 3MLVH 3RNQB 1NGPL 2IPUG 4HQQH 2X4UA 4MD0A 3LN9A 3LZFL 3RTQA 2ICWI 4CAGA 5MI0C 4AG4H 3CX5K 1OWRM 4GMTH 2APFA 2XQYG 4G8FA 1CZ8L 2A74B 3RZCB 4KU1A 4PJFB 1L0QA 3IDUA 1OTTC 5ACMA 1MFCL 2HLAA 3DV4B 1O7VA 5FYJE 1ZGLM 4HWBL 2AJYL 3SO3B 4LU5H 1D5XB 4JB9L 4MAUL 5F3BB 2FR4B 1BIIB 2QR0A 1G6RB 4XBGB 2CUHA 3UBXG 3S5LB 2YHGA 1HQ4A 4BH8B 3D69B 2VE6A 4YC2B 1IGMH 1W2KT 4YO0A 4YPGA 1LO0L 1CR9L 4TVPH 4L4JA 1KCLA 4PJHF 1UWGH 1R5VA 5F1NA 3MBXL 3UJTH 2F54D 1CICA 4PRHB 5GRWA 3L7EB 4PRBB 5CD3B 1OB1B 4I0PC 2APVA 2NNAA 1SEBB 3O2VL 3RPKA 1KIPA 1RZ8B 2RQ8A 2DTML 5I30L 3NCBB 5IESH 3BH8B 2EXYD 4H1LB 5JHDA 3CU1A 1S7QB 2BY3A 3TM6A 1MFAH 5EBMA 4U33A 4Q6IB 2AABH 1MJ8L 2ZOKA 1ZANL 3L3JA 2EDFA 2FECL 3OAZH 4R7DA 4KVNL 2CKBL 3UYPA 4ODSH 1T21B 2XNAA 2ZCLL 4PJ9B 1FZKB 5TH2B 5HVHC 2LTQB 1FO0H 1A6AA 1IILE 1U91B 4NKMA 3IDJB 3RBGA 5IB2B 2FD6H 3U9PH 5HHNB 2ATKA 4ODXA 4NKOB 4EXKA 3OKNA 1KJ3H 1I7TA 1F8TL 2ZJSH 1Z6JT 1NDMA 3ME0A 1Q8MA 1RZKH 2E7HA 5DO2C 3IU4L 5CUSL 3EDEA 1CD1A 2OL3B 3KLDA 4V1DB 4GG6E 4G3YL 4H26B 4RFOL 5DSCA 3H9YA 1NC4A 5GGUB 3H7LA 3QULA 3B2UD 3ZHKA 3OJDA 4OD2A 5C86A 1UB6A 2BSSA 2RBLA 4GRLA 4WV1B 3V52H 5KSAC 4F80A 3P9LB 1MREL 2X4OA 4HUUB 4RIRA 3RAJL 3WIHL 1FAIH 1J86A 4WFGE 5FYJD 4ZFFA 4JDVB 4JFZH 4NRXB 5EOTA 4JANB 5JW4Q 3CU7A 1MUJA 1I8MB 4G43B 4KVCH 1QBML 3KPSA 3BZFA 1QFWM 5KSAD 4TN9A 5CJOH 4LF3B 2WBJD 5ENWA 1CQKA 4N0FA 2RFXB 4M1GH 4QRQB 1TJGH 5EWIH 3O81A 4X99B 4UBDC 1YECL 4FZ8H 4JPKH 4UV7L 5SX4H 4YUEL 2VXVL 3SGKA 4MA1C 1NKOA 1A7BA 3H0TA 2EXWC 1S7VA 3QT2A 5MEQB 4NO5B 4X4ME 2P7TA 3RPIB 3UPRB 3ARBC 4OCRL 5EO0A 1B3JA 1RI8A 5FOJA 1CF8L 4NIKB 1NGWA 3EZ8A 3Q2CA 4J3WA 4W6YB 3MLRL 2DQCH 4ZUVB 2G60H 4Z7WA 2CDFB 4X4XA 4I77L 1YN7A 4KMLB 5JW5A 4UZGA 4XCEB 1IAKA 1A7NL 2BSTB 1X4YA 3MROA 4J1UB 3LKPA 1M7IB 2WAHA 2I5YL 2AJVH 2X44D 2D3VA 4FQIH 1UT9A 2XA8H 5ANME 3OKEB 2GY7B 2W0LA 3ARPA 5EUOA 3NA9L 3GSQA 1MVFA 3T8XB 5DRNB 4UT6H 3QO0A 2JJTC 1XH3A 2YPKA 3L5WB 3ECBB 2NY4C 4R0LB 2Z91B 2WWKO 2NW2A 3OF6D 3DROB 4XAKE 2VZUA 3BQUA 1I85C 2MPAH 2EEDA 3RWHB 4ZD3L 4XPHL 3TWCH 4P2QB 3MZGB 2FHBA 2AEQL 3WIIL 1BQHA 1YYML 2HG5A 3DXAE 4EOWH 4G6AD 3FHAA 3VD4A 4NC2B 4LIQH 4DGIL 1JZ4A 3D3VA 3QJHB 2UUDH 4WFGD 2F19H 2PCPA 3GSOB 4PJ8D 1R5WB 4NO3A 3WE6A 4XNXH 3MLTB 5FO7A 1E6JL 2XZQH 1EAPA 3VDAA 1F4XL 4NFDA 1RIHL 2OXGA 2CMRL 3OKLB 4FFYL 2HFFB 5TFSL 4U1LA 1QKZL 1P84K 4FFVC 1A6ZB 5F3HB 4NBYB 1FIGL 1OCWH 1HNFA 1DANT 35C8L 4OGZA 4KTEL 2MJWA 5C0NC 5IEHA 3G5VA 3GGWB 3SOBH 4BK5A 1PEWA 4PJGF 5HGHA 1A3RH 4JM2F 5FUCE 4H88H 2BHUA 4CVXB 3L3KA 4JFFB 2QQNH 4N9OB 5EU4B 4GAGH 2V5SA 3MRDB 2I07A 5H94B 3VFTB 1YPZB 1JGEB 2NXYD 3CFEB 2FSEB 3L3OA 4L4VB 1U8QA 4LCIL 4WHDA 2XG4A 2PW2A 1YEKH 3W39B 5C0ND 1YUHB 4G8GD 3RUGE 3RU8H 2ZCHL 4XVJL 1KF9B 1C16B 1A3QA 3VXUA 1B0RB 3MV8B 4O02L 1X7QB 1DFBL 3NACL 1FNEB 3CDGA 3T4AA 4O5LL 4PJHA 3ZKMC 2R8SH 3K2UH 5HDLA 4NZRH 4H20H 4JFQB 4IDJH 1QBAA 1R3LB 3VD7A 3M8OL 5IMOB 1QLEH 1I3UA 4PRPD 3BEWB 3OZ9L 4GRWF 2A9NL 1V7MH 1G7PB 4Z7OE 4OZGE 4XAKD 3SKNA 5DVNA 5C71A 3STBA 3ZKMD 1NL0H 2CR6A 4LMQE 5TGBA 4G5ZL 4G80A 4DOHB 3FN9A 4O2FA 4X7EC 5E03A 2XWJB 1CYGA 2FATH 1BF8A 4O9HL 4H8WL 3G08B 4EI5B 4H5SA 5ADOL 5ERWB 4YDJB 5GS0H 2ITDB 4HHAB 4Y16B 5DQ9B 1YMMB 4H1LH 5DVKA 3VRLE 2GK2A 1A7QL 2MNUA 5IMMA 3HG1B 2HJFB 1LVEA 2KBGA 4NQXB 4XBEH 5DA4A 5HYJA 2JCCB 2Z8VC 4WNQB 4G9FD 2UVEA 3MRHB 4YWGH 1RSFA 2EH7L 5ESQB 3WCYA 5C8JA 1A6VL 4D9RE 2CDGA 1JPFB 2MCPH 2UWEF 3AB0C 5I8OL 5CJBA 5I75C 4Q6YA 1AIFA 1IL1B 4M6NH 1I3VA 1E4XH 1MPAL 3QIBB 4GLRH 1FL6B 3AY4A 1ES0A 4UUJA 2P1YA 5DC9B 1FNAA 3LQZB 4PRDA 2OL3H 4F58H 2AJSL 3VFGL 3CFBA 4Z8FL 3X3FL 4CVUA 1QO3B 3W0WB 4PGZA 4Y4HA 3QXUA 3QP3A 3V6OA 5C0EB 1M05A 4GW5B 1AGCB 3MLYL 4KJPC 1IM3A 2X1PA 1EHLH 4QT5B 5IFAH 3MO1B 4U1KA 3ZSSA 2X9XA 1BOGA 4W4NA 1AGBA 2NX5B 3GMLB 3KPNA 3ARRA 2A77L 5IROC 1U8PA 5FYKL 5B39A 3WS6A 2F53D 3QPXL 5L6YH 5EA0L 5HHVL 3FB5A 2P45B 3EDDA 5DA0B 2H8PB 4JG0L 5J9PB 1S3KL 4A6YA 5IBTL 4XHJC 1INEL 1CD0A 1B6DA 2F9BT 3T0EA 4NKDB 3GSRA 5TE4L 2DQJL 1SVZA 2MCG1 3DRQB 4L8SB 3VFMB 4EUPB 1AHWC 3SDAB 1HK6A 3CNKA 3QXAB 3KS0H 4XHJD 1H3PL 3W9EB 1A2YB 2WV3A 4OGXH 2WUBL 3MV9E 1EVUA 3NCYS 2J7LA 2DQGH 4DKAA 5T1LA 4WTXA 4FS0A 2R23A 1U3HA 3MUY1 5E2VH 2EIBA 1JWSB 2AK4A 4OZFG 1J18A 5D7IF 5TDOA 3IDNA 4X98B 3IDYB 3FT3B 4F7PA 3T4YA 1OTUC 4HIIB 1OAYL 4IMLA 5HBBA 1QBBA 4M3KB 5DJYA 3ARGB 5D7SH 4D9LH 3GO1L 4HWBH 4R4FH 3SKMA 5DD3L 3T2OA 3ZE2F 4I9WE 4LFHD 2NZ9C 1C5DA 4HKZA 3QHTC 5HHMB 3VXTB 3IDMA 2DF3A 5JA9A 4FXKB 4K23L 5SV4A 3QNYB 5IV2A 2N4IA 5L7XH 2ID5A 3D2UA 1JYXA 3S6CA 2XWBA 1CR9H 4WO4A 1HILB 5BS0A 1Q9OB 4RX4A 2EYRA 2VR5A 2XKNA 1CK0H 1UXWB 4OM1L 4RA0C 3BN9C 3SBWC 1AGDB 3W5NA 2R1WA 4XCCL 4JFDB 4WUKL 4Y1AA 4JO4H 2NZ9D 4PJGA 1I7ZB 4YFLF 4JM2A 4Z7UB 2F5BH 1ND0A 1QSZA 5ESVA 5KBNC 4HXAL 3PL6B 3OAUH 4QRUA 4U7MA 3SDXF 5IMLB 4YHZH 4NRYA 3DX8B 4S1DC 4DQOH 1Z9LA 3NZHH 1N6UA 1IAMA 1A8JH 3P4MB 2DLEA 5JXAL 2ADJB 3TBWA 5GHWH 1I1YA 4N1HB 1JGDA 4Z0BH 4KVNH 1HKLH 4B41A 4HIXH 3B9KB 2Y72A 3WSQH 2JJSA 3D48R 5EH1A 2WK2A 4MA7H 2HJKB 3W5MA 2YZ1A 3CFKB 5J6GB 3MNVB 4N8CH 1JNJA 2NTFB 5HD8D 5DJ0A 2JB6B 4JN2A 1A0QL 5I1IH 1MFBL 3QUMA 3OKOB 3RNKB 5E2UL 1BVLA 4XMKH 1SJHB 1HHJA 2VC2L 4YQXH 4NC1E 4LAQL 1IFHL 1KCSH 4AT6A 1TZGL 4WEMB 4QGTA 2X4UB 4MD0B 1V3MA 3S7GA 1CVSC 1MSPA 4BQCA 4HIHA 4G8FB 1OAKL 2Y06L 2PW1B 2XRAH 1SY6L 4OF5A 4KJQD 4S1SH 2HLAB 4I9WD 1ZT4A 1D5MA 3SE9H 3CPLB 4OZHF 3QDJB 5B8CC 2X4TA 3SO5A 2VNCA 2UWEA 5FKPA 3OPZL 3BD5A 3N85H 4K94C 1TQCB 1OARL 5J1AB 2IALB 1KCUH 2BVOA 4POYA 4GS7B 4LSSH 5GRJH 1RUAL 2Y4SA 1KB5L 1X4XA 4N5UA 2VR4A 5FYLE 4FP8L 4NKIH 2GUOA 3LRHA 5LKNA 3VGAB 4PV9B 3MRFA 3KS0J 5CLWA 4DJMA 2V2WB 3NFPB 2DLIA 4KUZH 3UPCA 3IAGC 3QUZC 1EEZB 5I8EA 4ZUWB 5DUMH 4X6EA 2ENYA 3WN5A 4JFPA 5DURB 4M93B 5EC1A 1AQDA 1WICA 1NFDF 3F6IA 1MCCA 5F9WB 5SWZA 5JHDB 1X5YA 3DNKA 4LLVA 4J3OC 5EC2A 1QRNA 1LNUB 3UO1H 4JVWA 4OI8A 3IKKA 4L1HA 4HK3N 4L8DB 3AGVA 3L3JB 4ODBD 2ADFL 4OLXH 4R7DB 3VWJC 3MLWL 1N64L 2XNAB 4MYWB 5DR5H 3ILQD 3LN4A 3MYJA 1A6AB 3FMGH 4LCUA 4MNHA 1QZ1A 3KG5A 4HUMB 3CCHB 4ONHA 2VN7A 2A83A 2KL6A 1RFDL 1KIQA 3PGFL 4AIOA 2EYSA 3BRGC 3OKNB 2CDEA 1I7TB 2NY6D 2Q86B 4YHIA 5IGXH 1NDMB 1C08A 3ULUC 1TMCB 3VWJD 1J8HE 4FOMA 3BPLB 1T5XB 1EZVX 1H3XA 5KSBB 4MCYB 4DCQB 3TVMB 3QYCA 3KJ4C 3GNML 4P5MB 3QULB 2Z93A 3OJDB 5DS8B 5GIRA 3GI9H 3SGDH 5FKAA 5GZNC 2BSSB 3F65A 1CFQB 1NCAH 3ULUD 3FQNA 2CH8A 3IDGB 1O5DT 3EYOA 3MRKB 3MUJA 3DARA 4HCRL 5GJTL 1CDIA 3MJ7B 4JFXA 1H5BC 2RAMA 1RIHH 3SKOA 2AW2A 2C1OA 2FWOB 3CMGA 2V2TB 7CGTA 2C3XA 1MUJB 4DVBA 2QADB 5JOEA 4YDIL 4UI2A 5GZND 1T66D 3BZFB 1INQA 4TVPE 1F4YH 3PABA 5D7IA 4OQTH 5FYLD 4WCYH 2G2RB 5FHBH 1EFXA 2X2YA 1T83A 2BVQB 5T3ZH 1IGJA 2C26A 3DUHA 4NYLB 4DFIA 1PZ5A 3NH7L 4JZOB 4TRPL 1OP9A 1L9NA 2W9LA 1S7VB 5HHPA 4JJHA 5KVGH 1CE6B 1WBYA 2P7TB 3KPMB 2ZP0T 2VITB 2N7AA 1GAFH 4RMQA 4UQ3A 4FMKA 1NGWB 2ZCHH 4G6KH 5LXGH 1JWMB 1I1AC 2SEBA 3FFCA 5DMGC 2QQLL 3GHEL 5HGBB 2VLJD 3IRZA 2C3HA 3O0RL 4X4XB 5E5UB 4YAQA 3CGTA 5I0ZA 2L7JA 1IAKB 1PY4A 4HXBL 4FNLL 4PRIA 5E2JA 4Z78A 5MHSD 4NHCL 3TJEL 2BNQE 1P7QB 3DGCR 3I9GL 3SDXA 4HWUA 4U2ZA 5EUOB 5JNYA 1I1AD 4I0PB 5DMGD 1IEAA 2P43B 1FCCA 1JUFA 3MRPB 1K3ZA 3QO0B 1XH3B 2YPKB 1J8HD 2NW2B 4FTVE 4OCSL 1S9XB 1JNHA 1OL0A 1YEHH 1NGZA 5IB4A 3BQUB 2X7LB 4H8WH 2NW3A 5FV1L 1YYLH 2DD8L 4NO0B 4TSAH 2I27N 1P4BH 4QNPF 4OTXL 4ELME 3CX2A 2V5RA 2B8OT 5HYQB 5E8EA 4U1IA 4UOJA 3NCMA 4BSVA 2HG5B 5EOCH 1XIWA 4S11A 1DEDA 3LPWA 1HHHA 1HSAA 4WY7L 3VW3L 4I18A 3D3VB 3PWJB 4M62H 3RJQB 3GSVA 1T20A 5C0AA 1MQ8A 3REVB 2R2BA 4UINH 5FO7B 3C60C 4NRZB 3QUYA 4CJ0A 4MZ2A 3MNZB 3OGOE 1EEQA 3UJIH 4FFZH 3D85A 5C3TA 2F5AH 4EBQL 3H9SA 4B7LA 4N8VG 2X70A 4LSQL 4C4KT 4U1HB 3GMOA 1TJIH 5IEHB 3CFJB 1WAAF 4MB5A 1RVFH 1N5AB 1TCMA 5IP4A 2O5XL 2QEJA 4O58L 1CS6A 4OZHA 3BIKA 1MCOL 4JO1H 4MNGB 3MBEA 4P46A 1FYTE 1UEMA 4NM8H 5BXFA 5JHLH 4LSRL 2DYPA 1AXSB 3PNWB 4L9LC 1CU4L 2YWYA 1SYSB 5EU3A 1JN6B 4HAGA 5JMRA 1NGXA 3T2QA 3QIUA 5IEKA 5E00B 3CDGB 3T4AB 2WP3T 1MHHA 3V6BR 3HZVB 2BNQD 3VFWA 3CXHJ 1PG7W 1A4JA 1DE4A 4XGZA 4KKBC 4XMPL 3ARBB 4Q97A 3NMEA 1BZ9B 1MCEA 4P99A 3X3GH 1H3WM 3RWGA 2Y25A 1NFDA 1UFUA 3SKNB 3Q48A 4BELD 1GGTA 1J1PL 1N59A 1C8PA 5B3JF 3ARFC 3O4LA 4PJIF 3THMH 4BUHA 1GZQA 2AXFB 2RCSL 5IG7B 3FQWA 4EN3A 2CUIA 5CSZB 4WUUE 4H5SB 5EBWB 4PJBE 4AEHL 4S1QL 3PP3H 3I6KA 5DK2A 1S5HB 4H25B 1R3KA 3X11B 1IGTA 3MCLH 5E1HB 3QH3A 5IJKC 2AV1A 2NY4B 2I24N 3N1PC 2ZUVA 3FB8A 5IFJB 1HEZA 5IJVA 1FVCB 2R0KH 3EDKA 5GGTA 2CDGB 4ZNEE 3JWOH 3MODH 2XV6B 3V0WH 3SQOH 3HR5B 3LHPL 4OI7A 3FQUB 2F74B 4KRNA 5F88B 3WHXB 1NAKL 4PJCF 3DYPA 4Y5YC 5E4IA 4PB9H 3TO4A 1A6UH 3U46A 1WCBB 1BVKA 1FNSL 3HNVL 3BDYL 4PRDB 5LWYL 2DQHL 1ORSB 5FAAA 5L2KE 2B4CL 3U4BL 3OL2A 1A5FH 2GJJA 2GJ6D 4YJZL 1C5CH 1FVEA 3ZE0E 5AZ2H 1HNGA 5HGDA 5ESAB 1GGBL 2APBA 3LSOB 1AXIB 4PS4L 1M05B 3Q6GL 2DQTL 2GITB 3STLB 3JWDL 2YZ8A 4OCLC 5ALCL 3ZLQC 4ZDHA 3GSXA 2E7LA 1EJOH 1MI5A 2ARJQ 4G8GB 1BLNA 1M7DA 4RDQG 3EOTL 5GS1C 5DD5H 1BOGB 1G6RL 2VXTH 4MX7B 1LDPL 5EZLB 5K9QG 3HR6A 1MY7A 4U05A 3EJZC 3WS3A 2Q3ZA 3HFML 5EULV 5B39B 1S7TA 5A3ID 1A14H 3HUJE 3QDMA 1IQDA 3FB5B 3RVTC 3DVNA 4PRPB 3SGEH 1QPXA 5ICYA 4M7LT 1MRDH 1JWUA 5CMAA 1FGNL 4KRPD 3IU3B 2NCMA 4WUUD 1KYOK 3T0EB 5BW7C 4UIKH 2NY0B 1RK1B 4WI9A 4JR9L 2XIDA 2DI8A 2AJZB 3QSKB 2J6EL 2IBZX 1RZJH 5AG9A 2IG2L 5I8CB 5JPMA 1N2RA 1XGYH 3O8XA 1D5IL 1MNUL 2PYEE 4R6UA 4CUCA 5ACZA 1Y18B 5T1LB 3DMMD 1X5HA 2AK4B 2BSED 3HS0A 1I3GH 1BFVH 3QG6A 2MTPA 3HI5H 2NY5C 4FZEH 3V95A 2OMBA 3QUXA 3RVWC 3LKQA 5LGKA 5IVNA 1VEPA 3CVIH 2R0WH 1PG7X 2CLVB 2VH5H 5DJYB 4JKPL 4GAYA 4DGYH 2FX9L 3HMWH 2VJXA 5L2KD 1C5DB 3E0GA 5JDJA 4W81A 4CVZA 1JPSH 3CZJA 4NUGL 5ETUA 3K0WA 1MCFA 5DK0A 3GBLA 3RVWD 5IV2B 5I75B 4P5KA 2GTZB 5DJAA 5BS0B 3FN3A 5F7WC 2CRYA 2XKNB 3L3GA 2VLKA 5C0DA 4X7TB 2MMXA 2R1WB 1WAAA 4Y1AB 3ULVL 1OGAB 4GRMB 4ORZC 5J12C 5L9DL 2VWEC 2FX8L 4P9HH 3EO0B 1W0WA 4JDZA 1II4E 4Y4FC 5MP6L 5F96H 2H32A 4X83A 4U6YB 1F3RB 2XWTB 1R6VA 3QZWA 4KDTC 5K33A 3W9DB 3LB6C 3EBAA 4JPWL 3GSUA 2VL5B 4NUJB 1SBSL 3TBWB 1J5OH 1JGDB 4LHUB 2J88L 3EJJX 3GSNA 1CDBA 1IBGH 1S78C 4WJ5B 5C0GB 5F7MC 1WEJL 4OAWB 1BBDH 4L9DA 1CQYA 4F9PA 5HPOA 3A6CL 1CCZA 3ES6A 1P2CB 4K8RD 1AO7E 4NT6A 4O2CB 2VIRB 4NCDA 1B90A 1BVLB 5DHVB 4JRXE 1T03H 3BKJL 5J4MA 3UTSB 5FDYA 2PYED 4KC3B 5IHBA 4K71C 5LGJB 4LEXH 1S78D 4M6MH 4MJ2A 4PLOB 4WHCA 5ITBH 4EQ2A 4HGMA 4AT6B 1PX3A 2DLTA 4PJIA 4UT9H 2DOCA 5E1AA 5EZJB 3O6FA 4WDIA 4LAJH 3MA9L 4HWZA 4XPFL 5IMKA 4I3RL 2DWDA 4OFPA 4PBXA 1FV1A 4XP9H 4FQ1H 5CHNA 3IJSB 3TA3C 3FT2A 1I7RB 2QSTA 3S4SG 3WJJC 1DQDH 5F1KC 1AHWB 1IZKA 3KPRA 3LEVL 4Q2ZA 3AROA 3QISA 1ZT4B 1VACA 4J12A 1JTPA 3S37H 2X4TB 3QA3A 1GC1L 1YEJL 5T3XL 1RAMA 4ODTH 5FKPB 2EKSB 3SKJH 3RDTD 3C2AH 2VZVA 5HPMA 5ID0B 1MCWM 5BMFL 1CGUA 1LEKB 3MRFB 3QXVA 3PDGA 4PJCA 1MAJA 1QR4A 2DMKA 3O3DB 1U8NB 3RWJA 1U8OB 2BRRH 2DJUA 5KJRL 2A6IA 3F12A 4HKXA 1IC4H 3QDGE 4E9LA 4LCWB 4JFPB 2ZSVA 2EDKA 4GG6F 4KZDH 1MFEH 4MHHI 1X44A 3OJ2C 3VCLA 1GOFA 2NY2C 1ZTXL 1QRNB 3GMNA 2I9LA 2UYLA 1TJHH 4HXBH 3S3PA 4FNLH 4LCCC 5KAQG 2VDPL 2EDRA 4UT7H 5IR1A 5ELIA 1FL5A 5SX4I 2BSRB 1RK0B 5FHAL 4XCNA 1KTLA 2RR3A 4OCYL 4KHXL 3CUPA 3ALXA 3FAXA 4MJIE 2EYTA 4U1SB 4BFIB 3P30H 1VERA 4PB0L 2XTLA 1KIQB 3RX7A 4XC1L 2NY2D 3C87A 1Q0XH 3X12B 3CLEH 3VXRB 4JRXD 2EYSB 1FN4B 4DN3L 3W82A 3KJ6H 4NQCD 5MEOB 1OF2B 1HINL 1I8IB 4FFWC 3PWLB 5D71H 2ESVB 4CKVX 4LLUB 3TBSA 1WT5C 2BP3A 3PDDA 3JUZA 5AZEH 3QQ4A 4JO2H 2BDNL 1Y6KR 2APWA 2Z93B 3KDMA 4G8EA 1MLCA 4M7KL 2R4RL 4HF5L 1T6WA 5E6IC 1A6TB 5BCAA 4GKNA 4FFWD 2Q20A 3K81A 3EYSL 4NQVB 5J7CC 1YEIL 4A6YH 1WV7T 4JFXB 2VXQL 1ADQL 3MV7D 3ZYJA 4I2XE 2C1OB 5C0FA 2BCKB 1AR2A 1W72A 3ARDC 5IVXE 1RUKL 3BUYA 5JLZA 3RY6A 4ODHL 4F57L 1YDPA 5EUKA 5E6ID 2YPLE 3B5TA 4RQQA 5D7KD 4XBPB 1F3JA 2VUOA 4MAYD 5KSVA 5T5FL 3NN8B 2VERN 1IC7L 2F54A 1UA6L 3ZDXF 2V7NA 4OSUL 3ARDD 2FIKA 3OWEA 4XAWL 4KZEL 1FBIH 1WBYB 3QDGD 4RAVA 5B8CB 1ZAGA 4KJYB 4FQJH 2Y5TB 3F6LA 4PFEA 2MKLC 1LHZA 1CU4H 4QRPA 1YEFL 1IJ9A 3HNTH 1OAXL 4X9FA 1EO8L 2B1AH 2M2DA 1EMTH 4W6WB 3DJ9A 4NFCA 5IM7A 1OD7A 1NFIA 4PRIB 1BAFH 3JTSA 3QUZB 1JMZA 5I1DA 3FRUB 2F8XC 4MJID 4E42B 1TITA 3U83A 4Y19D 1FHGA 5F9AC 3LAFA 4XP4L 1BWMA 2R29L 5CCKL 1KLFA 1IEAB 1JUFB 3V79C 2DRUA 3L3IA 4U6VH 1OAUL 4NZUH 4H0GA 1OT1A 3IS1X 3P4OA 2VAAA 5DMKA 4JCMA 5C0BB 1A6PA 2FBJL 5DHYB 3BP5B 5EIIB 4EDXB 2BY2A 3LIZH 1AY1L 5BOPA 1UM6H 3WL9B 3TIDA 1Z3GL 3BP4B 4L8BA 1WJ3A 1DQLL 3GIVB 3QRFM 5E8EB 1MEXL 5F89A 4HPOL 3CLFH 4G42B 4I18B 2PNDA 3HE7C 3GFUA 3GSVB 1JPGA 1T20B 3D1MC 3S98A 2WSKA 4JVPA 5FDWA 3KVQA 1VPOL 2R1YA 2WBJA 3RKDC 3KJ4B 2OR9L 3WFEL 1FFOA 5T3ZE 3WFHB 1QQDA 4XPAL 1IAIH 1T89A 4OCNC 3H9SB 4KK5C 5ICXA 3QUMH 4ZO8A 5DT1L 1WITA 4GRWH 4Z77B 1C12A 1HCFX 3D6GA 1IGCL 2ZKHL 2ZUUA 4IHOB 1DBAH 5FCUH 1TZIA 4QGYA 4ZQKA 3RKDD 3TF7C 4OZHB 4Z7OF 4OZGF 1XF5B 3NFSL 4CGTA 4B53A 4P46B 1ZGLP 5GGVL 5GRYA 5D5ME 4CRPA 2BX5A 3S97C 3KXFE 3FAWA 5EU3B 3UTTD 4Y8AA 3ZE1E 3QIUB 4XC3L 1E4XI 1LDPH 4J3VA 1MHHB 3VRLF 4LLQB 1XR9B 3AM8C 1TVDA 3EYQD 3LOWA 3BKCH 4XGZB 4M48L 2D7TH 3MRRA 4MCZB 1QBLL 2O5ZL 2P42B 2AJUH 2W9EH 1FLTX 3AUVA 3BI9X 2R15A 2IGFL 4JQVC 3OF6A 4ZAKC 1KC5H 4QHKI 4DVRH 4QY8A 3MRIB 3TPUA 4GG6A 1ZT1B 4LRNL 4XMLH 3VI4E 1Z9MA 3JV6A 3KLSA 2OSLA 4OGYL 3UYOD 3LH2H 2J4WH 3R0NA 1G7IB 3FQWB 3DHJA 5HGGS 4DW2H 1GHFL 3PDOB 3QEQB 3VFVA 5E8PA 4ZAKD 1Q72H 3VXNA 4IEFB 2AP2A 3VRIA 5DQJB 3ULSB 1VFBA 12E8H 3VXMD 3UXFA 4XXCA 3BP6B 1JHTA 3QCTL 4PJ8A 5FGBA 2JKXA 1DL7L 1D5BA 1JPTL 3SDCD 1HEZB 3BZEB 1KIUA 1NDGB 1OM3L 4YHNA 1FP5A 4NWUH 1YNTB 3RVVC 1U36A 4AL8H 5F6IC 2XZAH 1EFQA 2Q7YA 2IPUK 4ETQB 2I9TB 2A9ML 3CVHA 5E7BA 5FO9B 1UACH 3TJHD 1FORH 1IC5L 1SYVA 4J3XA 2XYCA 4X4MA 3E2HC 1N3NA 5JQ6L 2XQYK 5K9OA 5ISZB 4P4KC 3RVVD 5CSGA 3BPOC 5C3LD 1NAMA 4NPYA 3FCTB 4KPHH 2P5WB 2R2CA 4EZMA 5CGMA 3QJFA 3AS3A 3C60B 5HGDB 4M03A 5CZVL 2R39A 2ICWB 4AIZB 1KEML 1S9WB 3I3EA 3IYLW 4KHTH 1FH5H 5LGHH 4YHMH 1V5JA 3RVXC 5KTEL 1CFBA 1G9NC 2ZSWA 4P4KD 4M7LL 3HAEH 3X14A 3C8KA 5FYKE 4BJLA 1BLNB 1M7DB 2B1HH 5ANMA 2DQDH 3UTQA 3S5LG 2VOTA 2W0FA 1JZ2A 4M3JA 1TVBA 2HKHH 5TDPA 2DWEA 3WS3B 1QLFA 3HZKA 3KPOB 1S7TB 3BE1L 3PWNA 2EIZA 3QDMB 1RZFH 3QCUL 1UQSA 4L9LB 1XGTB 1S9VA 3T1WA 5FCSH 3WUWA 5J1SC 2DDQL 3STZA 1WEJH 2G75A 3LVEA 1FJ1B 4HX1B 4ZTOH 2DLFH 2R0LL 4LHJB 4I3SL 4H1LG 4NN7C 5KS9B 5CINL 1KJMB 1MQKL 1G9ML 3DXAA 1ZVHA 4YBLC 4G9DA 2ZG3A 3KR3H 1OAQH 2FJHB 1B4RA 2DBJA 4JHAL 1UZ6F 1ZHBB 1A7PH 4ZOEA 1H3GA 4CADA 2APXA 1CL7H 2ZCKH 4JM4L 1T1XB 2NLJA 1YEEL 2HTLC 4PTUA 5KZCB 3ARFB 3L3HA 1BD2B 4KQ3L 1GIGL 1MJ7L 43CAA 3I3DA 5H37H 2VLRB 1A9EB 4MDIB 1JNLH 4X8JA 5C6PB 3MRNA 5FM5M 1F4WH 2Q3AA 5TQ0H 1K4CB 3F7YA 1QD0A 5I2IB 1HKFA 4ZXBC 4YPJA 4X6BB 5DQDL 4EQ3A 2EZ0D 4QO1A 3QUXB 3GRWA 4U1JB 2HTLD 5HHOE 1X5KA 4YHOH 4AMKL 5D7LD 5DC0A 3TYGL 4FQCH 5ILTH 4GAYB 2CIIB 2A1WH 1CLZH 1YEJH 4GG8A 1S7XA 3D39E 3KHQA 3MLXL 1PKQE 4RZCB 1T3FB 3NGBC 2JB5L 4ZXBD 1NCBH 3UROR 3V4UH 2IQAA 3GIZL 2E9JA 1SM3H 2GJ6B 3WXVH 4P5KB 5DJAB 4X6CB 5B38A 2BC4B 1T2QH 2RHEA 1O0VA 1ACYH 2V7HA 3L3GB 4Y5YB 3AAZA 5IIEB 4OLVL 4N0YL 5C70A 3BVNB 2J5LC 2QHLA 3UC0L 3WD5H 3IAPA 2X1QA 4I3GA 2IPKA 4PJEE 5E94A 2EDBA 4XP5L 5C09E 1P1ZB 3V4VL 4JDZB 4KK9D 2X1XR 4M00A 4OZGA 2H32B 1MFDL 3C6LB 1NEZB 4CMHC 3QZWB 5E56A 3AVEA 3C6SA 4D3CL 1VENA 2VTFA 5KN5B 4OFYD 5C07D 3C5SA 3GSUB 1XFPA 1WZLA 3AXLA 5DFVC 3ET9F 2MSPA 5FHAH 4KKCC 3LKNB 2D03L 4ALAH 3GSNB 4XWGL 1AD0B 2D7PA 4L4TD 2R4SL 4TTDD 4XP1L 5GS1B 2AV7A 4HIJA 3ULUF 5AYQA 4BH7A 4Y5XC 3VFSA 1FG2B 4NGHL 2AK1H 4DN3H 2OR7A 5INDB 1CBVH 5EU7C 4AQOA 5MENE 1I8LA 4ODVL 3TBVB 3G6DL 5D70H 5DRXA 4KKCD 4P2RE 3G5XA 4XWOC 4GAFB 4U4BA 2O5YL 5D2NB 3VG9C 3H6JA 2Y36L 5IMKB 4OV5B 2DWDB 5L88L 1ROWA 4BA8A 2HN7B 3I6LD 5CHNB 5HHOD 1YN6B 1KN2L 4ZUUA 4GBXC 5I18H 3TT3L 4I1NB 3IDXL 3KPRB 4P3CH 1CFTA 3D39D 4QRRE 1RUKH 1TETH 1MAKA 4HEPG 4TPRL 4ODUA 4EVNB 4GO6B 2ADIA 4BM7A 2H26B 4Z18A 4GBXD 1Z5LB 4MXWH 4RMRA 5HJ3B 1GZPB 5E8OA 2LU7A 5JIHA 5DDHB 3O3BA 3N1GC 4AQ1B 1SHMA 2FH6A 3SGDI 2VQ1A 1DBKH 3BO8B 1MVUB 4D0BB 2YA1A 3B9EA 5TE6L 5GGTH 1U8MA 2A6IB 3F12B 1UCBH 4HKXB 2IANB 4QRSA 3SBWA 1DBBL 5D9SA 3BW9B 2ZSVB 1PG7L 1NBVL 3B6SA 1V7NH 1AC6A 3CXDL 4OZ4A 3GMNB 2HP4A 5HGAA 3WJLC 1S7UA 2V5YA 1F5WA 3O45B 4HKBA 3TGXA 1NBQA 3PHQA 2Z8RA 32C2A 4XCNB 4KY1L 4UQ2A 1YJDC 3PP4L 3X13B 1FLRL 2IPTL 4HJGA 1MF2L 5MEND 2EEBA 2OTUA 4Y4FB 4TUJA 3VXUE 1UM4H 1WC7B 3V5DA 4P2RD 4ZS6C 5EO1B 4L3AA 2OJZL 3M1BA 5KVFL 5BQ7A 2FZ3B 4M9PA 1OGTB 1RIUH 3HE6C 1J1OH 3OR6A 4GSDH 4XPGH 1HI6B 1UB5B 3VXPB 2P4AB 3TBSB 1U58A 4WIQA 5TQ2H 4YBQC 1IGIL 5CD5C 4E5XB 5HI5C 4KI5E 4F7MB 3QWQB 1PY9A 3V7AE 3LQAH 4G8EB 3ETBF 4X5LA 3V5HA 5IB3A 4PG2C 4C55A 3FL7A 1OSZB 5GSRA 1WZKA 3HE6D 3SCMD 2G5RA 2R1XA 1I4FA 2YK1L 4GKNB 4WENB 4QRRD 4RNRA 3ARZA 3IF1A 3FOMB 3WFEH 1KSRA 5C0FB 5D93C 1W72B 4MXQD 4ZUTA 4HFWB 4Q9RL 1FSKB 2HH0H 5ECJE 5CEZL 1MH5A 5EUKB 4YHPB 2JIXA 3EW3B 3P9WB 1A7OH 4RQQB 4IIQC 4HG4J 4OJFH 3BMWA 3PQYD 4NJ9H 4MJ5A 4WFEE 1F3JB 3TA3B 5TPWH 4IJ3C 4LK4A 2QSCL 2V7NB 2OR8A 4JQIH 2YBRB 4JJ5B 4DAGH 1N5YL 3SDYL 5T33L 3IDIB 4M4RA 3LMJL 3QIWD 5GGRA 3K4ZA 3P3YA 5JUEL 1JRHH 2BNRB 1WCQA 4QRPB 3FHQA 4NOFA 2VDRL 1YMHB 5I9QB 1DN2A 1JF1A 2ADGA 2BVPB 4ELMF 1EAJA 3HLAA 2VZ1A 3CK0H 4Y5VC 4YK4C 5IM7B 3UZEA 2GIYA 4ZYKA 1NFIB 5IB1A 4LBEA 5FGCE 3FQRA 3V6OE 5E9DE 1UGNA 4NQDE 5DUBB 4Y4KC 5JW3L 1KPRA 3VGGA 2E6PA 1NLDL 4WI3A 3VWJA 5MERA 1JCKA 3R0MA 3L3IB 3PHOB 4NSKA 4MMZC 3VXSD 4KAQH 4LCCB 4WI4A 5GRUL 3P4OB 1VB9A 4WI5A 5TF1L 5INCA 1HZHL 1CVRA 3FOLA 3VGDA 1ZGLA 3CD4A 4JFHE 4Y4KD 1R5IA 2GT9B 4WFFE 2Y07L 3K1DA 4ZPTB 4OI9A 1UH4A 2H32H 2PETA 1JI2A 1VGEH 2DAVA 4G8IA 2V9QA 5A2JH 2CK2A 2Y23A 3QCTH 1X5JA 1DL7H 4DZBB 1KACB 5LBSH 3ZDYE 3J8F7 4AK1A 2ICEB 3I6GA 15C8L 4E41D 1I9JL 4K3EL 4UILL 1AQKL 2VISB 4HUNB 3EOAA 4NQUA 1OLZA 4HIEB 5IHLB 1L7TH 4HMEA 4X9GA 2R1YB 2A9MH 3QFJE 4BKLA 4EUPG 4RA3A 5FM4A 4GW1A 5SX5K 1QQDB 4PREA 3BD4A 1RMFL 3L9RA 4PV8B 1H5BA 4ONGL 1LEIB 1G7JB 1G7LA 3N9GH 3QQNA 4M4PA 1ZLUK 1B9ZA 2Z31B 4J4PC 1B0GA 1RZKC 3QFDB 1VEOA 3WUZA 4CL7A 4ERSL 1HIML 4YXHH 2YC1B 2JJVA 4QHUA 3P0VH 5I1KH 3FQTB 4XTRC 2V2XA 3DTXA 3VXQA 1E0OB 4NN6B 3SGJA 4X6DE 1T7ZA 4LQ1A 1A1OB 3LKSB 1F58L 1M71A 5EN2A 1RY7B 4IS6B 1HHIA 4X7SH 2FB4L 4WW1B 1MHCB 5E7FA 1T4KB 4CNIB 5DLMH 4PJBF 2YXMA 1OPGH 3U9UA 1D9KD 2ZUQC 5E9DD 5F70A 4HUWA 2QQKL 5FOBA 1Q38A 4F2MB 1BFTA 1NMAH 3U1SH 2HTKC 3DX6B 5DRWA 1AC0A 1J8HA 3DX7B 2GSIA 4LSUH 1KXQE 3T2NH 4RWHA 1CXKA 2D4DA 4QY8B 5B21A 3MXWH 3TPUB 2DBLH 3U0PB 3DWTA 3ALPA 1RU9H 4ELKB 2OSLB 2JK5A 4MVBC 4XNYL 5AUMB 4RWYL 2FJFA 3RWDB 5IT2L 2AJ3B 25C8H 1S7SA 3D5OF 3C2SA 2XQBH 2P5EB 5C7XL 1DVFC 1CE1H 4M8VA 2X4PA 4WFFD 3NABH 1L7IL 1GGCH 4OLYH 1K9TA 3VFVB 1EGJA 4RRPG 4BYHA 3R06A 3BGFC 4JG1L 4M6AA 1VFBB 4MVBD 1AFVH 1MIEH 4TQEH 5DFWH 1JHTB 1QSFB 4G6FD 5KANG 3GEWB 5CBEA 3M17B 3MRLA 3ZE0F 5LJYH 3VG0H 4MA8L 4QXUL 1GIGH 3OQ3B 4K3DL 1LE5B 4HGWB 1CLCA 3SGEI 4OCXH 5EZIL 3OKYA 4YHNB 1KGCE 4JFED 5IFHH 3QFJD 1V3KA 2DS4A 3GJEA 5C08D 5CILL 3V4PL 1I9EA 4NWTL 3P73A 3OGCB 1N6QH 4NZTH 5CIPA 5JO5A 2E9IA 2GAZB 4N0CC 5CSBA 1FFPA 4WU5B 3WNLA 3U6RB 1GGUA 1RQ5A 3Q5TA 4L3ED 4Z0XA 4PJFE 5HHXL 2DQIH 4YHYC 3HE7B 1MWAL 3HUJF 3RL2A 3ZSTA 3HA0A 3WNMA 4DZ8B 1YQVH 5JR1L 1PLGH 4APQD 2BXYA 3GIZH 3TZVC 1RD6A 1K5NB 4XPTL 3LEYH 3N1FC 3GJFB 3CSYB 4HS3B 1JFQL 3LS4L 3TFKC 5LQBH 4JZNB 3BPNC 2EC9T 3X14B 1GOHA 3DGGB 3WLBA 2BNQA 1KTDA 4HWEH 4YHKH 3QWOA 5ANMB 1JGUH 3WXWH 3I85A 3AFLA 4G7VL 5EOQL 4FG6C 1MFDH 5FM8A 2FX7L 3ROOB 1W72H 1H8NA 3RFZC 2APTA 2DWEB 1IGYB 3HZKB 4FTVA 2D0FA 2V6HA 4XI5C 3TFKD 1JHKH 1SVCP 2HKFH 3PWNB 4YE4L 4O51A 1C5BL 3AMLA 4TUKL 1UQSB 2DQFA 4ISVB 4DGVH 1IQWL 2XFXA 5I66B 1HSBA 4ELMA 2XN9D 2G75B 4FG6D 2ERJC 2KZWA 3UTZB 5KVDL 4RGNC 3FONB 5FECA 3DXAB 4KI1A 3MRJB 2R56H 4DKFH 3CDYA 2Q8BH 4GMSH 4NNYA 5I1AA 1S5IH 2WQ8A 4M43H 3QPQD 3BN3B 3HB3C 5FA3A 1D6EA 4LP4A 1KFAH 4Y2DC 5EG6C 4CADB 5IWLC 3EOBB 1CDYA 1AP2B 2XPGA 3N1MC 1KGCD 3VH8A 5D1ZB 4BQ6A 1PBYA 4RFNB 2WM0A 3MACL 2P8PA 1K3IA 1CFNA 1P6AB 2XXMB 1S9YA 2Z4QA 3T65A 4JZJC 3BUTA 4ZS7H 1P7KA 2J8UB 1Q9LA 1YQ2A 3LV3A 4KJWD 4KQ4L 1EHXA 3T77B 2PYFA 1WZ1L 3RZCD 4PR5B 4MQXC 4RFEA 5E5RB 5J6HA 4YC2C 4YDVA 2PR4H 1MLBB 3JZ7A 2OTWB 1TVHA 1OD9A 4R8WH 4D0CA 1JNNL 4RSVA 1FYTA 1HXMB 5C0CB 1BBJB 3MGOA 2CR3A 2CPCA 3RUGB 5C1MB 4ZSOA 3ULVE 2QV2A 3DLQR 1FZMA 1MJUL 4NDMA 3RGVC 5IBUB 4IDLA 4K9EH 2YWZA 1KENH 5GS0C 4MQXD 5DUPL 3C5ZC 5FYJH 4N9GA 3RGHA 4E0RB 1JV5A 1NC2B 3E2HB 3BKMH 4LSVL 4Q6IC 5F9JA 5E94B 4PRHD 4BUGA 3QI9C 3EFFA 2VSCA 4OZGB 2LTQC 3L5HA 3FO0L 4CU7A 5GS0D 4Q9BA 3HPJA 3VGBA 2JTDA 1KCRL 3C5SB 3KLAB 3U0TB 4MXVE 5SWQA 2ZPKL 2EO1A 4PGBA 5DZLA 4WUUA 2Y7QA 3B8YA 3BH9B 4JPVL 2XTJC 5D6CA 4PJ9D 4K94L 1NKRA 2R69H 4BH7B 2P8MB 4HULB 1IGFH 5GQBA 3FFCE 1KBGH 5AYUH 3OHXA 5JOPD 1JGLL 1HYSC 3SY0B 1HDMA 1UZ8B 4OFDA 1E4KC 3G5XB 5I17A 3DURA 3DMMA 3SDXE 4V1DD 3ZKSD 2C4FT 1CXLA 5D1XA 3BWAA 4PY7A 2H3NA 3CDFA 2OMNA 3S88L 1CGTA 1EV2E 2NR6C 4NN7B 4NQSB 3IFLL 3DX9A 1DUZA 5GPRA 4YBLB 3GUTA 4P2QE 2L7UA 3TBTB 1RUQH 5AWNL 1RZGA 4N1EA 4XNMA 2JLLA 3NCEB 3PWUA 4ZUUB 5T3XE 3OKDA 1QA9A 1C1EL 3IFNL 1VHPA 5L2KA 3U0WL 4RISL 2HFGH 3DO3A 1R3IH 5J56B 3H42L 5I1JH 4S0TD 3KNBA 5D7LB 1N7MH 5E6YA 2Q8AL 1UWEH 1DQMH 4GJTB 3ULVD 2HJLB 1IKFL 2BOBA 3SJVE 3C8HA 2YUXA 5F7NC 2A6DA 3CXHK 3GI8L 2AXGB 5E8OB 4HV8A 4LLMB 4JY5L 4UTBH 5BRZD 4J23A 3MXVL 3H3PL 3EFDL 5ADPL 3BYTA 3HUJA 5I1HL 1ZA6A 1KNOA 4IMKA 3RKPA 1JZ3A 3QQ3A 1LO4L 4L4VE 3PHSA 3NGBB 4Z5RA 1ED3A 4JAMA 5KOMC 4MDJB 5A2KH 5DFTA 3CVHH 4HUVB 2ENSA 4GXVL 3WKML 1T1WA 1S7UB 4JDTL 5EORL 4YHLL 4NZDA 3O3AB 3IETA 1KEGH 2COQA 2D31A 4LGPB 4OD3H 4R0LC 1JTOA 1CT8B 3MV8E 3MMEA 4TVSa 1N0XH 3BMVA 3WNOA 2J5LB 3IXTA 2QHRH 1KG0A 1NAMH 2UZIL 1EEUA 1OP5K 2VDLH 1AH1A 3IT8D 3G5YB 1OLLA 4PUBL 2JELL 3U4AA 4OZFA 3V5DB 2PYEA 4CMHB 4W6XB 1RULL 4RMSA 2FIRT 4JFYA 4XP6H 3MV9B 1GC1C 3HC4L 5IVXF 5BQ7B 4EI6A 4DTGL 2KDGA 2F8OA 1AJ7H 1ZV5A 3F7RA 4CU6A 2VZTA 2YEZA 2DM7A 4X7CC 4GUPA 4KK8C 3MOBH 4U1NB 1Q94A 1ZEAL 1EVTC 4EKXA 1A3LH 3SN6N 2FRGP 3PGCB 5T3XD 5GSRB 4D8PA 15C8H 3O4LE 3ARXA 3SDDA 1A1MA 1I4FB 3HG1E 1QSEE 4PIRF 3OB8A 4RGOH 4PG9B 5CP7B 3QXTA 3RDTA 2BNUB 1BGXH 1R3HA 4ODWA 5DD0H 3VFOA 3CAFA 1Y0LB 5J11B 3LEXB 4JN1H 3ILPA 4LVNB 2JIXB 2LE9A 3PV6A 1T0PB 4PRNA 5E4EC 3T0BA 1G7HB 2KQNA 5I8KL 4MJ5B 3L6FA 4GBXB 4LVHB 2BHZA 2FEEI 4X7FC 4JFFD 5DWUL 3DRTB 4PY8J 1H0DA 4PGDB 2QSQA 3BIBX 5J06A 4F3FA 5GGRB 4L4VD 4WVRA 4F7TA 2IQ9H 4HZLA 2OZ4L 3EOYG 3VD3A 3W0WE 5ALBL 5DTFA 5C92A 2EDLA 1KT2A 1I1RA 3LS5H 4R3SB 4PGEA 4QF1B 1JF1B 3HRPA 4XPBL 3GRWH 1IAII 4LGRB 2N7BA 1OAZH 4Z7NF 1FZJB 5TDNB 2V17H 1AE6H 3MJ9A 5HVFB 5IB1B 1ZWIB 3DPBA 4AM0A 1LQSR 1BQLL 4G6ML 3MGTA 4JRXA 1DBJH 2AGJH 4EI5C 5L2JA 5JXEC 3DHMA 4TOYL 5MERB 4K2UL 4NSKB 2BY1A 2YD6A 5INCB 4A2LA 4BZ1L 3MRMB 3WNPA 5B39G 4AEEA 1BJ1H 1WFOA 4JPIA 4P4RA 1T1ZB 1U6AL 4HWBA 5BVPL 2VDOL 5FUOH 3GBNH 4FRWA 4XZUB 4EI5D 1YNLH 5MEPB 3KYNB 5I19H 1ZLSH 3WDJA 2ORBL 4Y16D 1YMMD 3HC3L 3HG1D 2B0SL 5H2BA 3JTTA 5JMOC 3ARYA 3I6GB 3MV7A 5D7JC 3QHZH 5FUZL 3GK8H 4MJ6A 3JWNC 2Z0BA 5D5MF 2CGRH 3EOAB 4FQLH 3I02A 1A1NA 2FH8A 5I1CL 4V2CB 1P9MC 3ZE1F 4GW1B 2LU3A 4L29A 3RVUD 4PREB 5A2IH 3UAJC 4MAYA 1JZ5A 2M8XA 1U3YA 1V8HA 3RP1A 4GXUM 5HHXH 3QIBD 5K9JH 3JXAA 4ONFH 3ARDA 4MWFB 5DJ6A 1T80A 5FK9A 5I1LA 3QDGA 2YOCA 3PQYB 3V0VB 4QNPE 3NA4A 3VWKA 2CKBA 1FZOA 1MCDA 1TZHA 2V2XB 3IJHA 1IKNC 4Y0GA 2NYYD 3W0WD 1XF2B 2VN4A 3LS4H 1F45A 4QCIA 5HHME 1XGQA 4WW2F 1P5UA 1D5ZA 5EBLB 3V6FB 1GGIH 2BY0A 4JRYE 4QTIL 1MCWW 4OUUB 1SMAA 4IIQB 3KYAA 5GS2D 3O41A 2P49B 9CGTA 4IJ3B 4MJIA 1J8KA 1RJYA 2FX7H 4JFDE 1M1SA 1BZ7A 2VXUL 5HDBE 3U7YL 3FN0L 1Q9WB 2NX5D 4Z7UE 4TULL 4UMGA 4YDLC 1FAKT 5D6DA 3P9MB 1A6WL 2CQVA 2VLKE 2GSIB 1RJLA 2GHWB 1Q0YH 8FABB 4P5TA 3O11A 1OWWA 4P48A 4L8SC 1FFNA 2A73A 1ZOXA 3WIHA 3TNNA 1JK8A 4JO3L 5GISL 4YK4B 5ACLA 1G0DA 2HT3D 1XF1A 3P0YL 3O9WA 3QDHA 4QEGA 1RIVL 3GHBL 4IRJC 2EH8H 2DJSA 1WFTA 1QLRA 4MD4B 3R06B 4TNWF 1AGFA 4LHUG 3GMQA 4KMTH 4HS6A 1EK3A 4GFTB 5T5NG 3GSNL 3SDAD 3TCLA 4I2XA 3CDCA 3MRLB 3V6ZB 4RDQF 5K93A 1B4JH 3KYKL 1FNGB 4M1DH 3ARGC 2EDWA 2YPLA 3I50H 2XKUA 5T1KA 3L95A 5DI8B 3P73B 1B2WH 4OIBA 3S35H 5CIPB 5I1GL 1WZ1H 3NBNA 1TTUA 4XH2A 1LO5B 4EDWH 3O6ML 4HC1L 4C56B 3BT2H 4U2YA 2MHAB 2CK0L 4DKEH 1JNNH 4D9QE 3ARGD 1U9KA 4UU9A 4UDUA 1CL7I 1NCNA 5A2LH 5D72H 1JBJA 1RHHB 5EU6B 2Z9TA 4L3CA 4HT1L 1FO0B 2DJ4A 3E8UH 1F11B 4ZOAA 3BGMA 5KVEL 4UDTB 4M8QA 4ZTPH 3EYVA 5DD1H 4LSVH 3QHFL 2VDQH 1SEQL 3WLBB 4WEBL 1KTDB 4S1RL 4JFDD 1J1XH 3GKZA 1T1YA 3PWPB 6FABH 3J7HA 3PL6D 3IFPB 3RI5K 5JPNA 1IAOB 2NY5L 4EJ1C 1H15B 1YEGL 3NCFB 4FTVB 1N8ZB 1T22A 4ZFOB 1DSFH 2DQFB 3DOSA 3AM8A 3O2WL 1S9KC 1O7SA 4LOUC 4R4ND 1AD9A 5DMIH 5IVOA 2NZIA 3QDAA 2Q6WA 4ELMB 3B9KD 1FPTH 1U0QA 3NAAL 1J0HA 3OBAA 2DKUA 4OF6A 1M6OB 5C0JA 3F58H 5FECB 2NXZB 1P4LA 2LU4A 4JY6B 4B50A 43C9B 4NNYB 3CJJA 3RTQC 3FB6A 5IKCB 4F9LA 2HT4D 3T1FA 3SDCA 4N8VA 2L0DA 3NOIA 3LKOA 3EGSB 5F6HJ 1CLYL 3L1OH 3CSPA 2XPGB 4WI7A 1GJIA 3HZYA 3VH8B 5I1EL 1DBMH 2OP4H 3IFLH 4RAUB 4LLDA 4R97B 4HBCL 2C3VA 2P8PB 1CFNB 5I6XC 2ED9A 5F7LB 1DVFB 2AEWA 1S9YB 1NCCH 3HCVB 4R7NA 3D0LA 4AENB 1VFMA 3BGFB 2IFFH 1JGVH 5E99H 3MOAH 3KWWA 4K3HA 5HDQL 3P77A 4PJEF 5KG9A 3H42H 5EU5A 4RFEB 1BEYL 2YA2A 5J6HB 2CIKB 3P2TA 4PYGA 4DN4L 3QEGL 4JHWH 3OKMA 2HRPL 1IEBA 4Q74A 3QDJD 5IW1B 5D5MA 1IKFH 1SJEA 2FJGA 4Z7VF 3GMPA 1CICC 3ULUH 4S0SD 1ZA3A 2IWGA 1FZMB 1OHQA 4TUOA 4CJ1A 4MSWA 2VLLA 1XF3B 1TENA 2LQRA 2IAMA 2YD8A 1XR8A 3H3PH 4AEIH 4JLRB 4UOW0 5F9WC 2X4NB