4FFWD

Crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with fab + sitagliptin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
217
structure length
209
Chain Sequence
b'EFQLQQSGPELVKPGASVKISCKASGYSFTDYNINWMKQSNGKSLEWIGVVIPKYGTTNYNQKFQGKATLTVDQSSSTAYIQLNSLTSEDSAVYYCTRFRDVFFDVWGTGTTVTVSSAKTTAPSVYPLAPVVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl peptidase 4
publication title An Inhibitory Antibody Against DPP IV Improves Glucose Tolerance in vivo - Validation of Large Molecule Approach for DPP IV Inhibition
rcsb
source organism Rattus norvegicus
molecule tags Hydrolase/immune system, inhibitor
total genus 28
structure length 209
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ffwD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ffwD02
5I6XC 4Q6IB 4XPGL 1IC4L 2QSCH 2WLYA 3RWHA 1U8PA 3FB6A 3GKWL 4XCFH 2QLVB 3SDXE 4HMEA 3QI9A 2BOBA 4JRXE 2DQEH 3ZKMD 3WS6A 5E7BA 1GOFA 3CH1B 3KPPA 3LN9A 4J3TA 4K7FB 4YO0B 4JM4L 1U8IB 3DXAB 1ODAA 5F9JA 1RZKL 1KIRA 3GSVA 1DQLH 1BLNB 1A6AB 3KPSA 3LQAH 1TJIL 5LVEA 5IT2L 3CFIC 2H2SD 1OSZA 2DJUA 1D6VH 4AEIL 3MLRL 4A6YL 3FKUS 4MXQD 3F7VB 2QQLL 3LEYL 3T2NL 4D0CB 1OWRM 1MUJA 4C58B 4YX2H 1U6AL 4LRIC 3U0PA 5TF1L 4XXDB 5D1ZD 3MGOA 3DRTB 1RUQH 1WLHA 3FT2A 2AXFB 4TTGA 3LKQA 2CK0H 2BXYA 4IOFC 5J8OA 3FRPG 1ZVSA 4KMQA 2DQIH 4U6XB 4PJBA 1QNZH 1DLFH 1B0RB 1OF2B 4NZRH 3BP4A 3QO0A 3B2VL 1F4XL 5JA8B 2X40A 4KAQH 4LCWD 4RGND 3OG6B 2GSIA 5B39G 4NSKB 5BQ7B 3HZYB 1J1XH 1J0ZA 2BSRA 3UDWC 2B7DT 1NGWA 2D3VA 1KFAL 1HIMH 5KZCD 2GJZB 5E8NB 4H8WH 3QJFB 1S9YA 4D8PA 4G9FA 1TDQA 1BVLA 3SKNB 2I9LA 3SBWC 2NXYB 1Z3GH 1BM3L 4QT5A 2R9HD 1GGBL 1G6VK 3ARSA 5DUBB 1RZ8A 3IFOA 3NCBB 4F8TA 4GRLB 3WYRA 3MUGB 5C7XH 4S1SH 3RAJH 1MH5A 3MBXH 4RDQF 3ZYIA 1RJYA 3ILPA 1A14L 4M1DL 4Y16C 3PIQA 1SY6H 1N7ML 3EDFA 2Q86A 1LDSA 5DSCA 5C0ND 3OAZH 2BHUA 4XC3L 3VD7A 2AJXL 1JZ8A 1FVDA 4XMKH 4JM2F 2XA8L 4RFEA 4JN1L 3MLUL 5B8CB 3EJZC 2EEBA 2L0DA 3OF6A 1LO2L 2QADD 5D7LE 3FMGL 2IALA 2QR0A 3TCLA 3CUPB 3JTSB 5IV2A 3LOWA 5J1AA 5JMRA 3MBEA 2OL3B 1QSFB 2FEEI 5GZOD 4OAWB 3SDXA 2FHFA 2A83B 1S7XA 5F1OB 3TO2A 4JRXA 4WO4C 1EBPA 1P1ZA 3ZO0A 4RAUB 4PP2A 5K59F 1N26A 2QSTA 1SBSL 2F5AH 1GL4B 3D48R 3SKMA 4PJAB 4CW1B 4C55A 4HWZA 3T77B 1PFCA 1KB5B 3JWOL 1IM3B 4RIRB 2DJSA 4ETQA 1IKFH 4HZLA 5FYJL 3DV4A 3R8BB 1NMAH 2AK4D 1GZQA 4G6FB 4XAWH 5GGQL 1OP3K 2P42B 1TENA 5AD0A 2AV1B 4HWBH 3HR6A 1W72B 1T2XA 2Q20A 1HH6A 3WFEL 4J23A 4K23H 4PJ9A 4KRNA 3CCHA 4AT6A 4PY8J 1FO0A 3BDYL 4R3SB 1G7LA 3D39D 3UJTH 4YIQA 5D6DA 4EUPA 2DKUA 4ORGA 1NBYB 4PRBB 4Y2DC 5ALBH 1AI1H 2P7TA 2XXCB 1HE7A 3WL9A 1NEZG 2ZOKB 3GHEL 2C3VB 3K8MA 3VXRE 1S9XA 4PD4J 2NXZD 4MS8D 3UO1H 4PJGF 4FOMA 1L7TL 2CRYA 3DPBA 3VGEA 1T1WA 3QQ4A 2VLLB 4M1GL 4LCYB 4DKFH 3RGHA 2ZZUT 1E28B 5KJRH 5EIVA 1W8OA 4KRPD 5B38G 1VKXB 3MLZH 1LD9B 3WKMH 1I75A 4NPYB 1C08B 5FYJD 1XR8B 4LSPH 5TQ0H 3MRQB 2YUZA 1S5IL 3V4PL 5K59E 1TPXB 4KDTA 1QSZA 4X4ZA 2CLRA 2Y25A 3L5WA 3MJ8A 3VWJA 4NKOB 4XNYH 1MJUL 1BJMA 3HKFA 2HG5B 5E5UB 3VXMB 4XP5H 2EYSA 4PRHE 3MCKB 3EYUH 1QSEA 5TE4H 3S35L 5CWSB 2XZQH 5HDQH 3UPAA 1BD2D 4YGAB 1AP2B 2OCFD 4HKZA 3UYPA 2J4WH 3C6SA 1R3HB 2DMKA 2R2HA 3RIFK 5D7JB 1ZOXA 3J7HA 4XBPB 2R56L 3LKRB 4O4YL 4BSWA 2IFGA 2AXGA 5GISL 2CO7B 5EU6D 2AQ3A 5D7LA 4TUJA 2WUBH 2YKLH 2XT1B 5ACZA 1AO7B 4F57L 3CLFH 4NFBA 4X6EA 4LLDB 5T5FH 1U3HC 5T1KD 4KC3B 3QPQD 1EEQA 2OZ4H 1QRNB 1KG0B 5EBWB 5B3NA 4OCXL 3ELAT 3AAZA 3LD8B 1B6DA 1AC0A 3MJ6A 4C4KT 1NC4A 3ZT6A 5FUOH 1N0XL 2XFXA 4KPHL 2EIEA 2FX7L 2AKRB 4NWTL 4JFZH 3I3EA 3VCLA 1FIGL 2EIZB 1KCVL 4MQXD 4FQ1L 1NCDH 3PWVA 1WCBB 3HZKA 2QSCL 1R0AH 5EBMB 1H15B 4PJDE 2OXGA 4HUUA 2AJZB 2BNRE 4XCFL 3RDTD 1XF2B 5HGHA 3ULVD 3MRNB 4ZS7L 4C56E 3RJDA 5HHOB 3HTLX 3GZKA 1T83C 5DJXB 2ED8A 3P3YA 3GSRB 3MLVH 1Q1JH 5DT1H 5DD3H 1XGRB 3L6FA 5H2BB 4BKLB 1DQLL 1ITCA 1CFTB 3S36L 4AJ0A 2C1OB 3BKYL 2E9JA 5JNYA 1WFTA 2ARJQ 3ZHKA 25C8L 1XH3B 2DI8A 2EDKA 4OZHB 3VXRA 2HFTA 3PGDB 2P45B 1MJJB 2DYPB 2RCSH 1NCAH 1V3JA 5D2LB 5GJSL 3WLBB 5D7IB 4WDIA 4LMQI 4P2RE 4WHYG 3FO2B 1KIUA 1QVOB 3WSQH 3L5XH 1Q9OB 2P24A 4JZJB 1AY1L 2D9CA 3IS1X 5FA4A 3ZKNC 4HWNA 4PRAA 4JHWH 1VACB 3ULUC 4FTVD 2CK0L 4P57B 4OCWL 1HINH 2ERJB 3SDDA 3FO9A 4MAUH 4F9LA 3PDGA 3CSYB 2AV7A 2JCCF 1S7VB 4LSSH 2DQIL 2YWZA 1ZA3B 1QNZL 4NZRL 5DWUH 3O6LH 1DVFC 5C0DA 2C3WA 3MRCA 2Z91A 4KAQL 3V5KA 3QCUL 4KQ3H 1TQBC 3PV7A 2P43B 5DHVB 4F3FB 4HKBA 4Y4HB 3B5GA 1FORH 1ORQA 1UM4H 2EXYC 4IRJB 4PRHA 1KNOB 3CU7A 4ZAKB 3EIFA 1U8KA 1SYVB 3BAEH 4NGHL 1P69B 1YDPA 3U9PH 4NNYA 4P5KA 4XC1H 3SE4C 5IFHH 3TESA 1RMFH 4FQQA 3KNBA 4LGRB 4UT6H 5BS0E 3MOBH 4IMKA 1C16B 3TNNB 1VFUA 4PY7B 3X3FH 5I1EL 3AM8A 3SO5A 2VERN 5CIPH 1IM9D 2APVA 2AI0H 1MEXH 2F5BH 2KH2B 3CFDB 2BDNH 4M93C 4S1SL 3RAJL 3MBXL 4ONHB 4X7TA 2A38A 3ZTJH 1KTRL 2CKBH 1SY6L 4OD2A 5CBAB 3TBWA 5DRZA 1PSKL 5F7DB 2CDEA 1HWHB 4KHTL 5EUOB 3ARPA 4XTRD 5E95B 1XR9B 1A3LL 1YC7A 3IU3A 4LSTH 4MNQD 3QRGH 4M3KB 3MO1A 4OLZH 1KC5H 4Y2OA 4G9DB 4GXVH 4PJDA 2BNRA 3VFPB 1KEGH 4Y5XB 1R24A 3TBVB 3R1GH 4C56A 1CFVH 3O3BB 4CVZA 5KG9A 2QHLA 3RGVC 2P49B 3QNXB 3KDMA 4UUJA 1ZVYA 4ODVH 5L0QB 2PCPB 3BEWA 1KN2L 2VDLL 4LF3A 5K9KA 3T0DA 2LU3A 2Y5EA 2X1OA 4CVXB 2HJKB 2Z31B 3WJJC 3D85B 4Z7VB 1R5WB 5H37G 2AJVH 1IKFL 2BHZA 2CO6B 1FO0H 1NMAL 5I75B 1V8HA 5I30H 4XAWL 1H8OA 4EUPH 5EZLB 5E8PB 1R3IH 5BOZG 3I6LD 2J8UB 3BPLB 1OAXL 3MRLA 1MPAH 1AJ7H 4LVHB 3ZE2E 5GRXG 4AIXA 3UDWA 2QSQA 4G6AC 3JUZA 3BVNB 4P2RA 3TGXA 2W91A 3LQZB 4W6WB 4BFIB 3P30L 1INQB 2BSTB 4RZCB 3RP1A 3UJTL 4HX1A 4KI1A 5D7SL 1IAMA 2W9EL 5F9AC 1AI1L 3WEXA 3W11D 2KKQA 3W9EA 5MEQA 3KYMA 3HMXH 3SBWA 2NMSA 1ZT4A 1QR4A 4P3CH 5GZND 4ZUWA 2HTKD 3ZKQD 4M5YH 4X99B 2C1PB 3WHXA 3UYRL 5E8OB 3VFSB 4NZJA 3S3PA 2FECL 1G7HB 1IL1A 1S9VA 3BW9B 4Z0BH 3F65A 3L5IA 4IS6A 2C26A 4Y16A 4QXUL 5KJRL 3VW3H 3GMPA 2YD5A 4PREA 1FZOB 1K4CA 2V2TB 3DLQR 3UTSD 5GSVB 3GMLB 3BN9D 3NA4A 5CGTA 3VXUE 3WKML 5BS0A 3QWRD 4JGUA 4OM0H 2WV3A 8FABB 4C4KO 3BIKA 4PJCF 1P4LA 3DX7B 5TQ0L 2DLIA 4WFED 5I15H 4WI5A 2X7LA 2ATPA 5HY9A 5I19L 5JOFA 4WTXA 5BJTB 3E1F1 4XNYL 1T7XA 1RZJH 2DI7A 1HK6A 4XP5L 5DRNB 3EYUL 2DQTL 5TE4L 1TIUA 5HDQL 4YDLC 1NBQA 2BFVH 4WO4A 2VDKH 2J4WL 1ROWA 1F11A 3LKPB 4KVCH 1MWAH 1OP5H 2M8XA 1NGYA 4NZUH 1I8KB 4TULL 2J6EH 1C1EL 5FUZL 3I6GB 4TNWF 1U8MA 4POUB 4TVPH 1WICA 2WIIA 3QO1A 2F54B 4ZYKA 3C8HA 1I7TA 1P4BH 4LAQH 4Z8FH 3Q5YA 4Y4FA 5FHAH 1BQHB 5GRJL 5IG7B 3REVA 1ZGLB 4M62H 2X4OB 2NW3A 5E0QA 5FF6B 4JFPA 4I3RH 5JXAH 5F1NA 3L9RA 3BIBX 2R29H 4NN7B 2QTEA 1NEUA 1DSFH 1NCDL 2BVQA 3QHZL 3E6HA 1ZANH 2DAVA 4NJAH 2YD8A 3CDCA 4JAMA 4PGCA 2CXGA 5INDA 3VGHA 1IGCL 1ZT7B 1A7RL 2HKHH 1WTLA 3ARVA 4L9LC 3TV3H 4S0SD 3K4AA 5D5MF 5MENB 4ODSH 1EHLH 2FJGA 3C5ZB 1K9TA 1VSCA 2OQJB 5I8EA 4P0DA 4I3GA 4PJIB 4HAFA 5HI5D 2YD7A 1Q1JL 3BEVB 2D7PA 5DD3L 4GG6F 3NH7L 4AL8L 3ULUE 1A6WH 4Y0GA 3KG5A 4W81A 3BE1H 2UVEA 2V5MA 4JGMA 2ITCA 4J1UA 4ODWB 4X5WA 2MCPL 2VLJE 2YRLA 4PFEA 1L0YA 3A6BL 3MR9B 5ICYA 2NTSP 5FUCC 3DI3B 2YPLE 5DQJA 3R06A 5GS2H 1UEMA 3AU1A 2GT9A 4WI4A 3WHE1 3OKLB 1CE6B 4LLUA 5KSUB 1Q0YL 3IGAA 3RVTD 5ITBL 3WSQL 3W82A 4ZSOB 3KS0H 4XP1H 3CGTA 1U8HA 4JHWL 1X4YA 1DE4A 5A3IC 3Q3GB 2P5EE 3KPNA 2ZKHH 5SWSE 1TCRA 3VXUA 2CDFA 3KAAA 3RVXD 1MHEB 2AJUH 2FLRT 3GJEB 2MOVA 2HJFB 3S5LB 5DWUL 1BBJB 1QBLH 1T04B 3AS0A 1MCQA 3HS0B 4ZUTB 5AYUH 1OGTA 2EDLA 2HTLC 3K2UL 1CL7L 3IFLH 5KS9B 3L3OB 1U8LB 1D5MB 3I2CH 4NQTA 4O51B 2GW5A 3VXPB 1UM4L 1U3HA 4XVUC 4YXKH 1WK0A 4JREB 3PJSA 4LPTA 1OAQH 3S6CA 2X10A 3CXDH 4YLQT 2FNBA 2VQTA 3BKJH 3CPLB 1G6RA 1PD6A 3MRJA 1OAYH 4OFVA 3U82B 5EUKA 3MRRA 2X4SB 4OBSA 4YHNB 4LKXA 4X98B 5IWLA 1UADC 2I24N 4Z5RA 4GBXD 5JW4M 5DK2B 2A9MH 1MQKL 2VXSH 5HHMB 1IFHH 1QRKA 1DANU 5IMLB 3RHWK 2BMKB 3A67H 4MVBC 4UBDD 2ZWLT 5FB8B 1MSPA 4PV8A 4S1DD 1JNHB 5IROC 4P4RB 4M1CD 4JFFD 1RK0B 5JW4N 1LEGA 4CADB 2A9NH 1WZMA 1XIWA 4FZEH 4L29B 5IVZA 5J6HA 1OW0C 4LSTL 4P49A 5BVPH 2NXYC 4HS6B 3DV6B 3IDXL 5EORH 3MJ9L 3K46A 5JPNB 2R4RL 1EUTA 4GXVL 4I9WE 3RVVC 2Z93B 3PL6B 2I60L 5T1LD 4GRLC 3GEWB 4Y1AE 1KEGL 4RFOH 4WWKD 1RIHH 3RZCB 3V4VL 1UWEH 1F2QA 1K8IA 4UIMA 5IKCA 3OAYH 2ZCLL 4XBEL 3HB3D 1CFVL 2F8OA 2H6PA 1VESA 3MNZB 5D2NE 4ODVL 4EI6B 5IBTH 1G7IB 5C0AD 1N2RA 1U36A 4WUUB 4JANA 2VLJA 5B8CC 5TFSL 5IB1B 1UH2A 1U8OB 2AJVL 1NAMA 4P2OD 3GI8H 1CE1H 5C0RH 2COQA 4QHLA 3D18B 2Z4QB 4OUUA 3D25B 2YPLA 5CSZB 1JNNL 3TNMA 5BVJB 1U3ZA 2Y07L 1KBGH 2NY5H 4OZIF 4M8QA 3MV9B 1A6PA 4GMSL 2QEJA 3GBNH 4PGBA 1GXEA 2P5EA 3TYGH 5SWSA 4HLZG 1IMHC 3NFPB 4GRWB 4Z76A 2Y36L 1KXTB 1EZVY 5HI4C 1L9MA 4ZS6D 5FCUH 1ETZB 1K8DA 1V3LA 3L1OH 3BESR 4P9MH 2I5YH 2C7UA 3VXNA 1ULVA 4J4PD 3HC0B 3RVWD 1IRAY 3MGTA 2HT4D 2YA1A 1CQYA 3O6FB 4NO2B 1O5DT 4P2QE 3PGCA 4F7TB 2XQYG 3EGSA 4KY1L 3PV6A 5HBBA 4HF5L 3ZT7A 4LFHD 2B0SH 4LNRA 4M7ZB 1JHLH 4QRRD 1J8HD 1AXIB 4OFDA 3PABB 1LE5B 4I0PA 2J7LA 1JPFA 2IH1A 1OGAE 2WINA 3IXAA 5I15L 1D6EB 3KWWB 4ZO7A 3TBTB 1EXUA 5DFTA 1UA6L 1F3JB 4XPTL 3U0TB 4HIXL 1RZJL 1AHWB 1BZQK 1Z0NA 1EZVX 3OKDB 4H1LH 2X4TB 2BFVL 5IEHA 4MCZB 3ZYJA 1SEQH 1JGVL 2HJLB 1UWGH 2X4UA 3JBG7 5HHQB 3O2WH 5EU3B 3RGVA 4KVCL 3WKNA 4HS3A 4HJ0C 2BC4B 5F72S 3ZKSD 3QPXH 1OTUC 4TVPL 3B83A 1AKJA 5BV7H 1AGDA 1DBMH 3LSOA 4QTHB 5F93C 4CVUA 5EO9A 3BZFA 1ZGLP 3EDDA 4WGWB 2OJZH 1TPXC 1AC6A 1P4BL 4NZTH 5KW9L 4Z8FL 1ZHBB 1JK8A 4NRZB 3OKNB 5FHAL 4MAYD 4Y1AA 3QHFH 2XQBH 4M62L 3TM6A 4JJ5B 2NY3B 2UYLB 5FO8B 4N68A 4MDIA 5D70H 5JXAL 3FB7B 1KPVA 1F3DH 3HZVB 3DMMB 4MHHG 1QSED 4M6AA 5D2NA 2R29L 1BFOB 4HUMB 3UJJH 5D7JC 3H0TB 3WFCH 1U58A 3F12A 3MNVB 5E2TH 2HVKB 4X7FC 1MRCH 4KH2A 2HKHL 4OI8A 1BZ9B 3TV3L 3QUXD 1IAKB 4PYGA 2BX5A 1QLEH 2GY5A 2H3NB 3VXOA 4DJMA 1EJOH 4X6DB 1D5IH 2A6JB 2VDQH 2R2EA 4N90E 4HBQA 2X1QA 3LD8C 3MRPB 4LP5A 2W0FB 5IB2A 3D3VD 5L8LB 1A6WL 3GKZA 4H20L 4TVPD 3IDGB 3P4LA 1YEDA 4UQ3A 3QXVA 4G8EA 4OQTH 2FEEL 2D9QB 1CVRA 5DVOA 3QEQD 3NIFF 3QDJD 5HVFB 3QWOB 2ATKB 3T1FA 4OV5B 2VQ1B 3WIHA 4OUOA 4CL7A 2V5TA 3OG4B 3R0NA 3O3DB 1QFHA 3MRMA 3T0XA 4QRUA 4NM8H 4KI5F 4QWWD 4XNQB 4P2QA 1H3UA 1T0MA 2XZAH 4AM0B 5HHXL 5CGYD 4M8VA 1KLGA 3LPWA 2VXTH 2AJUL 3VFOB 4PJXB 5I18L 1LK2A 2M2DA 1XGUA 3TO4B 5FEBA 1OGAA 1QBLL 2HAZA 2OTWB 1LK3H 3B3IA 2EIDA 5ADOH 3L3HB 1FNEB 2VUOA 3IF1B 3SGKC 4AIOA 5IJKC 2AEWA 4KK5C 3DYPA 3IFLL 2XG5A 5I1DA 2G9HA 4S1RL 5EO0A 2IH3A 1YMMB 2DLFL 4NKDB 4PJAF 4W68A 4YXKL 1A6VH 3NN8B 1IE5A 2MQCA 4F58H 1MJ8H 3MCLH 4RQQB 1CU4H 1LP9E 2Y7QA 5INCA 4JZJC 3BKJL 2GUOB 2ICWJ 2ERJC 4MQSB 2DBJA 4K8RH 4BK5A 4HIEB 1D9KD 2EDFA 3OGCA 5GS2D 2DQCH 1U8JB 4LCWB 3WLWD 4POYA 3SDDD 4FFWD 4ZFGL 1JRHH 4YXLL 1CDYA 3LMJH 3LEVH 1MRDL 5I1IH 1WF5A 1GAFH 4PJ7B 4HEME 4L9LA 1T20A 4M6OH 3C6LB 3C08L 1QOKA 2A9ML 5BZDA 5L88H 5KZCB 1HHJA 2D31B 4Y4HC 1IFHL 4IRJC 1JJUA 5HHPB 3VWKD 3TN0B 4LLQB 3A67L 3K8LA 4ZAKC 4LCUA 3DGGA 4KJPC 3QT2A 3RWEB 2BCKA 1GC1H 2A9NL 1WWBX 3ILQC 5DEFB 5GIRA 1JPSL 4MGXA 1ZHNB 5E8DH 2BJML 2DQUL 1ZLVK 1OPGL 3L3GB 2B20A 4M5ZL 4XCCH 1MCNA 1RIHL 5EPMB 1DQQA 1UWEL 1ZLUH 2KZ1B 3ECBB 1QSFE 4FXGB 3RA7H 3U4BH 1EMTH 4U2YA 4LL9A 1NAMH 3CH1A 3UX9B 1UYWL 3C60B 1FE8H 3D0LB 4K7FA 1J18A 4YO0A 1TMCB 5J56B 1U8IA 2QADB 4LPXA 1FNSL 4ZFOL 3D2UB 4YC2C 1A6AA 3GI8L 4K9EL 2ESVD 3Q1SH 1CE1L 2FX9L 5C0RL 4QY8B 5CP7B 5A2FA 1A7PH 3UC0H 2CRIA 2E6PA 4OLVL 3VXTB 1HKFA 4M61B 4NQCE 1KBGL 2D2OA 4Y5XC 1BWMA 4IBLT 4L8BA 1HQRB 1GPOL 4RA0C 3DO7B 2XTJB 5IFJB 3AGVA 4XXDA 1H5BB 3DRTA 5LXGH 1AGFB 1LDPH 5F8RC 4JDZB 5L0QC 3FO1B 3TYGL 2AXFA 2R0ZH 3C5SB 2Z31C 3IDMB 2Y6SD 4JVPA 3NFNB 2AK4B 3H7BB 4U6XA 1HYRC 3OX8B 2R0LH 5J6GB 1B0RA 1F42A 1OF2A 2UZIH 5I75C 2Z8SA 4LASH 1PZ5A 3H2WA 2EYTA 1G9MC 3QCTH 4NSKA 4OKDA 3BPLC 5BQ7A 3ES6B 4LVHC 3BSZH 4PR5A 3D39B 4U1GC 1Y18B 4YZFE 3KPMB 5LCVL 1F5WA 3ARYA 1J8KA 1LP9A 1JHLL 2FGWH 4YDKL 3FN9A 2GJZA 5E8NA 3QJFA 5IROA 1QFOA 5GS0H 1UJ3B 3F8UB 5F7LB 2P4AB 2J2ZA 4ODUB 2AJYH 5E4IA 3SKNA 2IAMB 4I4WB 1F90H 2NXZB 1R3JB 4LIQH 3RKPA 2UWEB 1NCNA 4OIBA 4GRLA 1OQOA 4FFZH 5D1XA 1X5IA 4QHNB 3MUGA 4BSJA 3VXME 2FJFA 4L3EA 4KRPB 3VRLF 4DK6A 3AS2A 1SEQL 1UWGL 2H32H 2VSDA 5EU4A 3O2WL 4M02A 3GUTB 1EO8H 5HYIA 2WZPD 1I3GL 1L7IH 4FQLL 1UQSB 3MRIA 3T0ED 3U4EB 3V52H 4OZHF 5DEZA 1ZEAH 5BV7L 4FFVC 4KMTL 4RNRB 3ZT5A 4CU6A 3RWCB 2HLAB 2EDYA 3PGFH 3F5WB 4JQIH 5B8CA 4ZOAA 3GK8H 5D7IF 2OJZL 2HVJB 1WZKA 4PGEA 2NY6D 1AO7E 3QHFL 2EKJA 2XQBL 1SEBB 1BD2B 3FQWA 4BYHA 2XWBB 4NUJB 2OL3A 5L2KE 2ICEB 1QSFA 4OAWA 2JJSC 1QRNE 3VH8B 4YDJA 2XWJB 4ETYA 2BSED 4MJ5B 3MLYH 4V1DD 3U4AA 4C83B 5EU6B 4XI5C 5EU7C 1P9MC 1UACL 5E2TL 3T77A 1DN2A 1ACYH 1MRCL 3UPCA 1KB5A 1HHIA 3IJYA 3GGWA 1QYGH 4RIRA 1NL0L 4BQ8A 1YUHB 5T1KB 3THMH 2QKIA 2O5ZL 3X13A 1QLEL 1GZPB 4PJ8D 4KJWC 4F2MB 4NQCA 1EJOL 1F4HA 2AV1A 1JGLH 4A2MA 4NHUB 1W72A 2VDQL 4Y4FD 3QBTB 2I9TB 1MCEA 1KELH 2XXMB 2LQRA 5ESQB 3VD9A 2NW2A 4PIRF 5FGRA 4NQVA 1WCQA 4TUKL 4OQTL 4EZMA 4PRBA 2FBOJ 3OXSB 4O02H 3RDTB 2MQ3A 1WSST 2FEDD 2ZOKA 4OZHE 1KJMB 2C3VA 3BP6A 3KJ4B 4CUCA 4LPUA 2EH8L 5E7FA 5MHSE 2YUWA 1EVTC 5D2LE 3U46B 5EUOF 5HYFA 5D7IE 5ICZB 1D5ZB 2V2WA 5T33H 4LCYA 4JZOA 4PLJC 2Z8VC 4DEPB 3V0VB 1E28A 5KSAA 1GJIA 3VG0H 1I8IB 4KRMB 3PP3H 2BNQD 3EYSH 2VXTL 4PRDA 1LD9A 4WI6A 5EBLA 2EKSB 1C08A 5GGRB 4PB9H 3ARQA 4IIQB 1T1ZB 2CR3A 1XR8A 2APBA 3MRQA 4P46D 1FHGA 1QUNA 1EHAA 1T22B 4UNTA 3FFDB 2W07A 3ZTNH 1RURH 4ZUUB 4NKOA 4LHUD 4WU5B 3ZLQC 5EZJB 3VXMA 3MCKA 3ZDZF 4X7EC 4P3DB 1MCOH 3MCLL 5GXBB 5CWSA 4FTVB 1GYAA 1HOCA 2ORBH 1AP2A 1PYWB 7FABH 3H42H 3P0YH 2F8XC 5M7QA 1R3HA 2H2PD 1NCUA 4XVJH 5D7JA 2GJ6B 4XBPA 3PQYB 1NDMA 4K8RL 3LKRA 4NKMA 2R0WH 4O2EB 1E6OL 1K3ZA 2DQCL 4J6RH 2J8UF 3O3UN 3RY6C 3RWDB 3V0AC 3LMJL 3B5HA 5KSVA 4M48H 2YBRB 4XB8A 1GAFL 4MJIE 1GGIH 1AO7A 4GOSA 3MLSH 5E94B 1J0KA 1ZLWH 3A0OA 1JP5A 4LLDA 5F1IB 3WIFA 5L2KA 4UI2A 1ZA6A 5CAYB 1QRNA 1KG0A 3O6MH 1N8ZA 2ENYA 1JHTA 2W1NA 3QA3B 3STLB 3IJHA 2MMXA 1GGCH 4UOW0 4I18B 1IM9B 4WW2F 3AS1A 5D6CB 2EIZA 5GRUL 2XWTB 4L8SB 2GK2A 2Q8AL 5T1MB 4N5EC 4XCCL 5EBMA 1DQJB 1H15A 3OKMA 3O9WD 4DVBA 2C4FU 2AJZA 5CKGA 4OT1H 1XF2A 3RA7L 2OBGA 3UXFA 3MRNA 1OLZA 3X17A 4WTZG 1CBVH 4FA8A 4NDMB 5DJXA 5SV4A 5ICXB 4U6YB 3GSRA 1ED3B 4K8RD 3FN0H 4MNQB 2OLDA 4BKLA 1WJ3A 4Z7VE 4AEHL 2C1OA 3Q1SL 4AG4L 1A7PL 1XGPB 5E2JA 3PL6C 5IJKA 4KTYA 1MJJA 4U0RB 2DYPA 4BFEA 3RZCC 5D2LA 5EU5B 5LAXB 4FXKB 3EO1A 3SE3A 3WLBA 5D7IA 2EDWA 1NFDB 4QTIL 4JFOA 3OKYA 5J9PB 1Q9OA 3HAEH 2P5WE 5LXGL 4JZJA 4M6NH 3S36X 1QQDB 4P57A 4UT9H 4LLYA 1QA9B 1TZIB 2OTUA 3CSYA 1WT5C 1S7VA 5DLMH 4OZGE 4ZOEA 2AJ3B 2R0LL 5I1KH 4NM4H 3G04B 3DVIA 5DJCB 4LASL 2HKFH 2XYCA 1PG7X 1KJ2H 4DKAA 4HQQL 1CGUA 5F7UA 1INDL 1UENA 5DHVA 5FOBB 4Y4HA 4HUKB 4IRJA 1T21B 3HMWL 4NKQB 5FCSH 4ZAKA 2X4PB 3O41B 3K4ZA 2RR3A 3WNKA 1SYVA 2FGWL 3W2DH 2VL5B 3QFJB 9CGTA 3U0WH 5ENWA 1NCCH 3TNNA 1JZ5A 1MI5D 2AJYL 2B2XH 3WE6A 4JPWH 4PY7A 4YPGB 4LIQL 3FB8B 4DGVH 3HI5H 2NZ9C 1WBXB 3S97C 4PJIF 2XNAB 3GJFK 4JPKH 1WFOA 3DVGA 4NRYB 4M6MH 5KTEL 1IT9H 4FFZL 2R8SL 1S8DA 3CFDA 4MJIA 2V17H 2E27H 5LQBH 2A74B 3O3EA 3O6FC 4ONHA 2VNCA 2XIDA 4FQXD 4DCQB 4UQ2B 4MMXC 4EN3D 4OZFB 1EO8L 3CVHH 4EDWL 1HZHH 4LQFL 5F7DA 4ZUVB 3RY5A 3D1MC 4M7ZC 5ID0B 4I1NB 5EU7E 4MSWB 1R5IA 4Y7MA 1HNGA 5FYLH 4XNMA 4UTAH 4JQIL 4G8IB 3GK8L 4ZO8A 4E41E 2F54E 4RX4D 4LLMB 3WNOA 4I0PD 5TGBA 4U49A 1SJVA 4MXVF 3OJDB 5DJ8B 4P59L 1INEL 3KHQA 1AHWC 2JLLA 4Y5XA 4DAGH 3VGGA 1DQDL 2BZDA 4FQJH 2CRZA 1KOAA 3BX7C 3O3BA 5GS0D 2PYED 3MLYL 3TIEA 4OCSH 3IRPX 3F58L 2MWCA 1GHFH 4PTTB 5IBUB 3DUSA 2PCPA 1VDGA 2FSEB 1CICD 1UZ6F 3P9MB 3ME0A 4NFDA 4WFHE 5C71A 4LCIH 4Z7VA 5E6YA 1R5WA 1D3CA 3FQUB 1S7RB 4OKVA 5JXED 2IG2L 1FZMB 5E8PA 2NY3C 3EYFB 1KELL 4XH2B 4L4VB 4O58H 3BVNA 1J87A 2FDBP 2Y72A 1OTTD 4YQXH 2P5WA 2GAZB 3MUY1 1INQA 2BSTA 4K3EH 4RZCA 1F6AB 5KVEL 3S88H 4LVOB 1WWAX 1Q38A 1T80A 4U1LB 3MV7D 4HK3J 2AJSH 3FOMB 4ESKA 3T08A 1NSNH 1REIA 4OZGA 4DW2H 3O8XD 1TZGL 4BZ2L 1AD0B 4FHBD 1RJZB 4WHTA 2PW2B 1CQKA 1TFHA 3TBSB 4X99A 5FO7B 1V3MA 2C1PA 4JZNB 5D1QD 4ELMB 3VFSA 5T33L 3L3DB 1G7HA 4XP4H 3S37X 4ISVB 5J4MA 1TCMA 4TRPH 3STBA 3VG0L 1P2CA 1X5LA 1SJXA 1BQLH 1FZOA 3EYSL 4RBPH 3M17B 3EYOB 5GSVA 1OM3H 6CGTA 4JRYE 5EA0L 4PRNA 4BQCA 3VU2A 1EGJA 2IMNA 3QZWA 2HYMA 5KOVC 2FD6H 2QBWA 3PNWB 3TT3H 1KENL 3ZTNL 2XRAH 3ZKMC 3FB6B 4MNHB 1IVLA 5C86A 5BJTA 5KS9E 3L3KB 2PXYD 1MCDA 4K94C 4PUBH 2BOBB 5DRNA 4ONFL 5I1AB 3WS3B 2JJSA 1MCOL 4QHUA 1NANH 1S78D 2ORBL 3KPPB 1NUNB 2IPKA 3D0VB 3P0YL 7FABL 4YPJA 4OFYD 1YEJH 3SO3B 1I8KA 2BK8A 3QB7C 5C3TA 5FKPA 4ODHH 3I6GA 2H2SC 1FAKT 1P9MA 1KIQB 2R0WL 3LPGA 3VI3F 1FIEA 3T3MF 3KPSB 3TO4C 3N06B 2AGJH 4E41A 2F54A 1IBGH 4HIIB 5E08H 1NC2D 1UB6B 2XKSA 1BQHA 5D1ZC 3EFDH 3O6ML 4OJFL 3U7WH 2X4OA 1U8NB 5FF6A 1E4XI 3MGOB 3FT2B 2A6IB 4JPIA 4MDJB 4ZTOH 5ERWA 4LSRL 1YYML 4DN3L 4TQEL 3IFNH 3QFDB 3ZMRA 1Q9WB 5CJQH 5CZVH 4GBXB 4PJBB 5I0DA 3RL1B 1J05A 4NKIH 4JDVB 5J13B 3FT4B 1JNLL 1ZT7A 4OT1L 5C0JB 3C6LC 4U3CA 1QEWA 4ZOBA 2GSIB 4XZUA 2NYYD 5F96H 4B53A 1IGML 2OQJA 2BSRB 5C0CD 4F7PB 4LSUH 5C07D 4JFFB 3V8CA 1NGWB 2ZUQB 1JBJA 3BKCH 3BEVA 2N1KA 3FN0L 3ZYOA 4Z7UF 1LE9B 3IU4H 1QZ1A 1S9YB 1YYLL 4G9FB 2ICWI 4WUUE 1BVLB 4ODWA 2ID5A 5HHNB 3IT8D 4JFHD 5T1LB 1MNUL 5IW1B 2Z35B 4MA7L 3MR9A 1P84J 4WWKB 2V6HA 4UNUA 4QT5B 4IRSD 4HT1H 5L8KB 4OCRH 5J12B 2HFGL 3OKLA 5DD6B 1FGNH 2LV4A 3TH2T 5J11B 4GW5B 4OB5L 5C0AB 5C0NC 5L6YL 2VDPH 3C60C 3PIQB 5CIPB 4H26A 4L3CA 1RZ7H 3NAAH 1AR1D 2Q86B 2IGFH 4FQCH 3Q3GA 1QFUH 5DSCB 4HPYL 2QADC 1RZIB 1UCTA 4JRYA 1FVDB 4GRWE 5EG6C 3GJEA 5DLML 1XZ0B 3RBSA 2HJFA 5I1KL 4NM4L 3RY6A 2CKBB 1BBJA 4ZPVA 5GZOC 1CLOH 5KVDH 2HKFL 3HS0A 4ZUTA 4TPRL 5BRZD 2MKLC 4YHLH 4G7YH 4IDJH 4TN9A 4QGYA 5KS9A 3L3OA 1U8LA 1D5MA 3SDXB 4O51A 3VXPA 1S7XB 1ZHKB 2N7BA 5I74B 4DVRL 1P1ZB 2XTJC 4GQPH 2VZSA 1H5BC 1ES0B 5MP6L 5LJYH 3CPLA 4HLZH 3RKDD 2IPTH 1QLRB 1MCFA 1I7ZB 4HWZB 2X4SA 1UVQB 2NY2D 3VFGH 4YHNA 3HA0A 2IBGA 4X98A 1IT9L 1YNLH 2E27L 2V17L 3N85H 3RIAK 4XWOD 3VG9B 1GZQB 4RA3A 5AD0B 4KROD 5ADPH 1JNJA 1FV1A 1KCUL 5H94B 1ZS8B 5FKAB 4QRRB 1J8HB 5I71B 1HH6B 4BZYA 5IMLA 2BMKA 3CCHB 5FB8A 1FO0B 5F7KC 4J3SA 1JNHA 3KYKH 4LSQL 4P4RA 3HCVA 1UJ3C 4EUPB 4WY7H 5F9OH 4UTAL 3TJHD 4L29A 3IJSB 2P7TB 3UJIL 4HS6A 2IAMC 4KKNA 4P3WA 3DV6A 3WUWB 2NXZC 4MS8C 3AUVA 4K2UH 1RY7B 2YHGA 3B6SA 3N1FC 5CEXB 2Z93A 2NLJB 4MB3A 3PL6A 4XX1E 4U6HB 5DUMH 4MB5A 4RISH 4KUCF 2FO1A 3VXSD 4DAGL 3RZCA 3A6CH 1G7PA 5CBEB 4GG8B 1T1WB 4KRPC 4NN5B 1C5DA 4PJXF 2Q6WB 5D1XD 2ARJB 1X5GA 3SDAD 5HGBB 1FG9C 2F19L 4L3ED 3JWOC 4HC1H 2UY7A 4EI6A 1G7IA 5C6TL 1KTDB 5KVFL 2V7NB 4HBCH 4WUUA 2HLFD 2DLTA 4LCIL 3E0GA 3HI1B 3EUUA 5IB1A 1LGVA 4JCLA 4OCNC 5D96B 2VUYA 2YZ1A 1F58L 2CLRB 2Z4QA 5IBLC 4CU8A 3L5WB 5CSZA 4A2LA 5BVJA 4X6DE 1C5CH 5C3LD 1B0GB 1QSEB 2AQ1A 5JHLH 1MF2H 1KCLA 1ADQA 4HKZB 3VGDA 2DM7A 2X41A 4M7LT 2P1YA 5DYOB 2KPNA 5FYLD 3ZE1E 4YQXL 2CUIA 4K3EL 4PJFB 1I1AD 2W0LA 3DI2B 1OSPH 3MLWL 2CLVA 3MXVH 2AJSL 3VE0B 3NFPA 2X9WA 4DW2L 5B21A 3WFBH 5D7LB 1ETZA 1B6UA 3TJEH 2ICCA 4TSAH 4ZOCA 1DQML 5ACZB 1MWAB 1YEGL 3HC0A 5EC2A 4YEEA 3QEGL 3BDBA 3O6FA 1YEHH 4NO2A 3D3VB 4ERSH 4AY0A 5CJ5A 3AAZB 1BQLL 3ARWA 4F7TA 3NCMA 1RHHA 3EDEA 1HHGB 2XFXB 3QDJB 4HULB 1T3FB 4PJXE 1LE5A 1ZHLA 3BZDA 2FGZA 3O0RH 5F9DC 4FABL 3RDTC 4G7VH 4OLUL 1KCRH 3QQNA 4HCRA 4D9QD 3ULVC 2O5XH 1D6EA 1S7WB 3KWWA 3Q48A 3KJ4C 3MJ7B 3KLDA 1CLZL 4HMDA 4LQ1A 3TBTA 2AS5M 1F3JA 5HGHB 1MCIA 1QBML 4YBQD 2X4TA 3LS4H 4KHXH 5BMFH 2HJLA 4Q0XL 5HHQA 2DQGH 4DEPC 1KN4H 2O61A 1MCWW 1P5UA 3DX6B 1A4JA 2X4NA 3RY4A 3PP3K 1YNKH 3DHMA 3SE9L 2YRPA 3H9SD 5EULV 4IIQC 4QTHA 4LCWE 4RGNE 5FA3A 1IBGL 3NFSL 4PJ7E 1PEWA 1ZHBA 1S9KC 3OKNA 1WAAE 3ABZA 2B4CH 1FYHB 4ZPTA 5TH2B 2R23B 3F62A 3L7FB 4WV1B 3U7WL 4JJ5A 2UYLA 5FO8A 3V95A 3SY0A 4TSCH 3FB7A 2JK5B 4N0UB 3HZVA 5FA4B 3MUJA 2MQ0A 3VRIB 4HS8H 1D9KB 2GJJA 4NFCA 3GHBL 4Q58C 4DUWA 3H0TA 1TJGH 2EE3A 3SDDB 1NGZB 1OOAA 2AV7B 3IFNL 5CZVL 1Z2KA 5DFVD 4NKIL 2VYRE 2Z91B 4YH6A 4E5XB 1WBZA 4Z7OE 1W2KT 3MMEB 3VWKB 4OFPA 4B5EA 5F96L 1IARB 4YWGL 2GK0B 3KPTA 4LSUL 3QIWD 4X6DA 1N64H 4AH2A 3LQAC 2A6JA 2IAND 3FB5B 1U8KB 3BKCL 1YDPB 4OD1L 3MRPA 1SMOA 1FC2D 3IU4L 2W0FA 3KNBB 3BO8A 2UY6A 4G6JH 2HH0L 3IDGA 3B9VA 4YDVB 5HVHB 1EFXA 3TA3D 2E9WA 2EIBA 2AEQH 3OQ3B 2ATKA 1I9IL 2FIKB 1F13A 5GGTH 1M7DA 5DHXB 3O3DA 4OCRL 4EOWH 5BW7C 5GGSB 4P9HC 3L95B 1B0WA 1FGNL 4UU9B 4NUGH 4JKLA 2VDPL 4EKXA 1FFPA 4Q2ZA 4XNQA 5TE7L 4XTRC 1BQHG 2IGFL 1SM3H 4PGZA 5DZNA 3BD5A 2CDEB 4PV9B 4AM0A 1QFUL 3HC4H 5E2VH 2ESVB 3M07A 5EWIH 3VFOA 4D9RD 4PJXA 5D7KD 3IDJA 3QDAA 5I1GH 4Z0XA 4D3CH 2AK4E 3BQUD 4LEOA 5KBNC 2BRRL 1A22B 1MRFH 1Q72L 2OTWA 5TDNB 1GRWA 5KVDL 3NIGE 5DURD 3CC5B 4G7YL 4IDJL 4PJHB 3NZHH 4H8WC 4JM2D 1QACA 4U0RC 1BEYH 4HPOH 1MFCH 2RAMA 1CGWA 5D1ZA 1R24B 3O4OB 4JG1H 1NCTA 3OZ9H 3NN8A 3D39E 5FM4A 1YECL 3CAFA 4CMMB 3IDIB 5MHSD 3NIDF 3PE9A 1T5XA 3BGAA 4RQQA 4U1MB 1CD0A 2DLEA 4OGZA 4GW4A 4UUJB 3BEWB 3S96B 4LLWB 4K3JH 2PW1A 4O2FB 1GSMA 4OBRA 3WNPA 2A0LD 3OAUH 5AWNH 1U8JA 4LCWA 1E0OB 5KANG 3MFGB 2UWEE 4EI5D 4M7LH 1CDBA 1I4FA 4OLYH 4PJ7A 5F3HB 2EC9U 5ADPL 1WAAA 2D7MA 5IVNA 3L7EB 2D31A 5ILTH 3MRLB 3QQ9D 4JO3H 4Q9QL 5HHPA 1FC1A 1S7UB 1SJHA 4LLQA 4P2RB 5DMGD 1GIGL 3W11C 1AD9A 4R26H 3RWEA 3ULVF 3KYKL 5FYJE 3TC9A 1Q0XL 4WHDA 4WY7L 3ARFD 3TIDA 5I2IB 1F8TL 4S2SB 3WEXB 5GZNC 3W9EB 5MEQB 3KYMB 5DEFA 1JVKA 5HGGS 4DN4L 4WEBL 4L1HA 5F7EL 1H3VA 2EC8A 1T89C 3L3GA 3P9LA 1BD2E 3SDCD 5EPMA 3NBNA 1WZ1L 3S5LG 3VD3A 5LGHH 3ECBA 4Y5VB 3V9FA 4FXGA 2XZCL 2P47B 4KU1A 1S9VB 4PLNC 4MJID 3T0EB 3BN9C 3P11L 4Y16B 2O5YH 1PW3A 4PREB 4HFWB 4HC1L 1UFUA 5EU6E 1TZHA 4WUKL 1QG3A 3OKKA 3UZEA 1DBAL 3B9KD 4WI8A 4X4XB 4O5LH 1A7QH 1E4XH 2RJMA 5CP7A 1I3RB 3BUTA 5HY9B 4AENA 5DTFA 3T2PA 4QCIA 5KVGL 1G0DA 1R3LA 3WN5A 1MREH 4HH9B 1HKLH 1ZLSH 3VXTA 1EEZB 4M61A 3OXRB 5HI3D 3KPRD 2GI7A 2ITDB 3C9NB 1HQRA 4JFQB 1N6QH 3F6LA 1MF2L 5JHLL 3MACL 1HQ4A 4JHBA 3MA9L 1A1NB 1AGFA 1IAOA 1FVEA 3WD5H 5C9KA 4DGIH 4H1LB 5SWZD 3C5SA 3NA9L 2DTML 2WIIB 3QO1B 5IHUL 3CVIH 3TJEL 2AK4A 3H7BA 3VFUB 4CJ1A 3ULVE 4ZYKB 1R3KA 1N6VA 4XVSH 4NZDA 3OX8A 2R4SH 3SGEI 6FABH 4Y4FB 1AGCB 1CFBA 3ROOB 1SQ2N 1YEHL 1ZK9A 2P8MB 3TFKD 1A6UL 3FO0H 1MLCB 3ES6A 3GM8A 4JFPB 1MHCB 3D39A 1Y18A 5C09E 3LKNB 3KPMA 5F1NB 5FYKU 2G60H 2H41A 4LVOC 1K2DA 1UJ3A 3BISA 3O2VH 4YR6A 5ALCL 2C5DC 4ODUA 4G7VL 5HDBE 4I4WA 1R3JA 4PGCB 1C5BL 3P2TA 2UWEA 4F7MA 3IXTA 3E6FA 2ZUYA 2VO5A 2ADFH 5HI5C 3LS5H 3ZDYE 3I02B 3MUZ1 4M4PA 4KHXL 2BNQB 5BMFL 4G43B 4KGJA 4FTVE 2DQGL 1KN4L 2NY7H 2OMNA 3RIAF 4N0YL 2V7HA 1VERA 3QP3A 1A47A 1UQSA 1JYWA 2R2CA 3VFRB 5A2IH 3IDUA 4OF5A 1HN1A 3UMTA 3QG6B 3RWCA 2HLAA 3TEUA 4EIGB 5ICYB 4LP4A 2HVJA 4X6BB 4G8GD 4LRNL 5DJDB 1DBJL 1JZ7A 4LHUB 3K74B 2B4CL 3RVTC 5EIQA 4K3DH 2VH5L 1SEBA 1BD2A 2GT9B 3MCG1 4DGYH 4Z7QE 1FL5A 5C8JB 5CD3B 3IYLW 2ICEA 3HPLB 3LIZH 3FOLB 3VH8A 4TSCL 2XWJA 4CN6A 1U42A 3RVXC 4MJ5A 4HKJB 1DE4B 4DWHA 4C83A 3KPNB 1AQKL 5EU6A 1TCRB 3PDOA 1U91A 3OKOB 3E8UH 5HGAB 1G9EA 5T3XH 1CD8A 3WXWH 1F4AA 1YUHA 5T1KA 3DETD 4XAKD 5F89A 4XBGB 5C0IB 4QRSB 4LVEA 1GZPA 2VC2L 4FP8L 4F2MA 2AVGA 4NHUA 1FRGL 3IFPA 5F9WB 3TBYB 5HD8D 4IJ3B 5ESQA 2VKXA 3GSNH 4MNQE 1QHOA 3LRHA 2N4IA 3DYOA 3RU8L 4S10A 4Y2DD 5EUKB 4HUNB 3VMPA 1G9NC 3MRRB 3O9WB 4DFIA 4ELKB 3OXSA 1DEDA 3RDTA 3E3QC 3GRWH 1YPZE 4GBXC 2PNDA 3P4MB 5J13C 1KJMA 3RNQB 1A3RH 2H9GA 4Y19D 4NC0B 4EOWL 5HYQB 1IEBB 5SX5K 1RJLB 4FZ8L 4UBDC 1IC1A 4GT7A 1TNMA 3DECA 4S1DC 1JYXA 1JN6A 1NFDE 4XX1G 3CSBA 4O00A 3I3DA 3V0VA 3GMNB 4RAHA 4WHCA 5C09A 4PV8B 3HC4L 1EO7A 5EWIL 3IVKB 3JXAA 4UINH 1XIWB 5IVZB 2ZPKH 1G6RL 1CFQA 3TCXA 4D3CL 5DFWH 1T1ZA 5I16B 3OGOE 4WWKC 3MXWH 1FL3A 2EDDA 5C0BD 3I6LE 3EOAB 4X9BA 4XPGH 4WNQA 3FFDA 4XMPL 1UKTA 1BEYL 4HPOL 5J12C 4ZUUA 5CFHA 1NDGB 2HFFA 4UIMB 4LNVA 3O45B 5C92A 2W9DH 4RGMB 5J11C 4MX7A 4P3DA 2H6PB 4FTVA 2F58H 5CSBA 3AROA 4UTBH 4NCC1 1RZKH 1X5YA 4O2EA 5L9DL 1MCPL 3CMGA 1NAMB 1TJIH 4NQDA 3RWDA 4M7LL 5HGDB 5IT2H 4PBXA 4OSUH 5DJ6B 4KK9D 5KVMC 2YBRA 4AEIH 3MLRH 4GW1A 4A6YH 2CUHA 2W0PA 5CP3H 3TNMB 1WISA 3NVQA 4Y4KD 3LEYH 2CRMA 3UTSE 2UVFA 5F1IA 2G75B 3CSPA 5I74C 5TJWK 3SJVD 1QPPA 1U6AH 1MI5B 3LB6D 1AXSB 3HR5B 2VOTA 4QRPA 5JZ7D 4ZS6C 2P5EB 1NMBL 5SWSB 1FJ1A 4JFDE 1IM9A 4WFEE 5IMMA 5D6CA 4ELMF 3HN3A 5E99H 2P44B 3N50A 2FO4B 2N56A 2K3TA 1NUFA 4FQXB 4AQOA 4GFTB 2YRZA 3VDCA 3V0WL 1DQJA 3T0WA 4EN3B 4M93B 3B2VH 1F4XH 3VG9C 4NNPL 3O4LD 2Z8RA 5BW7A 4EQ2A 2UZYB 1NLDH 3CDFA 3GNML 4NDMA 5I8CB 4KXZI 5I71C 2XQYK 3PV6B 5ICXA 1KFAH 3BGMB 3V7AG 4LNRB 4FS0A 1K4DA 4MNQA 1FP5A 1VEPA 4I0PB 1JPFB 1RZFH 4Q7DA 1PG7W 4O5LL 1SYSB 4R4FH 2WINB 3IXAB 1E4XL 1YPZA 1BM3H 1GGBH 1XGPA 4ZFZB 4XPFL 3ARGD 2W9LA 2PYEB 3LDBB 2MHAA 5EU5A 5LAXA 4FXKA 1N6QL 1I9RH 4NN5C 1NEZB 2X4UB 5EIIB 1NFDA 5J9PA 4BSVB 1QQDA 4NT6A 1QPXA 4DGIL 4RMSA 4XC3H 1UG9A 3VA2C 2H32B 2XA8H 5D96C 5HYSB 1NBZA 3MLUH 4MAYC 4CJ0A 3BZFB 4XVSL 2DQFB 1HDMA 2DWEA 1LO2H 2AJ3A 1UB5A 4I0CC 6FABL 2NZIA 1SY6A 4KDTC 5JIPA 2W60B 5DJCA 5GHWH 2HMID 2HA1A 4PLKD 4P48A 1AQDA 3RX8A 1XF5B 3NPSB 2EXYD 4MDIB 3TWCH 3FFCD 3CNKA 2K1MA 1KPVB 5J3HC 1KF9B 4JR9H 3MV7B 3RWIA 4PJBF 2G60L 5D2NB 4GKZB 4J3UA 2Z8WC 4XPAH 5DJZA 1KSRA 3O2VL 3O8XB 1RZJC 5JOPD 3RFZC 4Z7WB 3AB0B 2V5SA 1CFNA 3FB8A 2C9AA 1WBXA 4C57C 2VITB 2XNAA 4QF1B 4NRYA 1RULH 4HD9A 1T89A 1BZ7B 1EIBA 4XCNA 2ADFL 4EIZC 3MGAA 3MC0A 3LS5L 3SGJC 2EE9A 4XP6L 4DCQA 5KANI 2I26N 4X9GA 3QXWA 3UTSA 4RCAA 1AR2A 2VZVA 1WFUA 4RMUA 3WFEH 3ZDXF 5IB2B 1YQVL 5IEKB 4ZUVA 1YEDB 1VGEL 3ALXA 5ETUB 4M7JH 1U8QB 4JFDA 1YJDH 3KPOA 1CDUA 2PXYB 1CXLA 3KVQA 1YY8B 3WBDA 3GHEH 1DDHA 2WWKT 3OJDA 1G7JB 4DGYL 1D7FA 4QWWC 3ZL4L 5IB4B 3MRMB 3LIZL 1L7TH 1MFBH 4F7EB 4QRUB 5CGYC 1TITA 4NWUL 2J3SA 1P5VA 2WWMD 4XWGH 3FT3B 2CLZA 4FQIL 4PTTA 4QOKD 5F7NC 2FSEA 3E8UL 5DQDH 3P9MA 5LGJA 5T3XL 3QXDB 3K80A 1NC2B 1DQTA 3E3QE 3SDXF 1S3KH 1E4WH 1OGAB 2CPCA 3ISWA 5C70A 2IQ9H 3G6JB 1FL6B 1Q94B 1S5IH 3V4PH 4PPTA 3WIHL 2IC2A 5I1DB 2G9HB 2JJUA 2IH3B 4WV1C 3GIVA 4JFFE 5INCB 2DDQL 4X4ME 2OR8A 5JHDD 4TVSa 1J5OH 2GAZA 1D9KC 3WLWC 2EZ0D 1F6AA 3SDDC 4FFWC 3V4UL 4U1LA 1CXFA 2R56H 1PDKA 1T7YA 4DZ8B 3GI9H 5GISH 4PGDB 4B50A 1AD0A 1RJZA 1LNUB 2PW2A 1A5FH 3TBSA 5FO7A 4L9LB 1T20B 5C0CB 3VWKC 2BVOB 5C07B 4F57H 3JWDC 3LKSA 4ISVA 5C0AE 2JELH 5M95B 4GXUN 4N5UA 3DGGB 4PRPE 2BCKB 3M17A 5T3XD 4GMTL 1N0XH 4NWTH 4IRSB 3RBGA 4I8DA 3KLAB 5IOPB 5HVHC 1PJ9A 1FIGH 1KCVH 5DJ0B 5DF0A 2OZ4A 2VLKD 2OM5A 5EBGA 1LO3L 1EFXD 4OD3H 1DQQB 3BD3A 4MNHA 3SOBL 3L3KA 2W9DL 4Y5YB 1EO5A 1HHHB 1CS6A 4KDWA 5I1AA 3WS3A 4ZS7H 3RL2B 2F58L 5KSBE 3D0VA 1UM5H 4UTBL 1CGXA 3SCMD 4F33A 2VISA 3SGEH 4KVNL 4LCCA 1GOHA 4HDIA 1NGXA 1UWXH 1KIQA 5CLWA 1II4E 3T65A 2YEZA 5BRZB 3BHBB 4BELD 5GS3A 3S36H 1HNFA 4OSUL 2YPKB 3BKYH 5DHYA 3TT1H 5DK0B 4HIIA 4CRPA 2AP2A 25C8H 4MA3A 2X89D 3RRQA 1U95A 4RFNB 1UB6A 3VFTB 2IWGA 1CG9B 4CDHA 1IKNC 3HE7D 4L8BB 5GJSH 3O4OC 4FFYH 4QRRE 2FLBT 1J8HE 4NQUA 2O26U 1U8NA 3DUHA 1A7OL 4LDEB 4WU7A 4W70A 1AY1H 5IR1B 2Y6SC 2NY2B 2A6IA 2BP3A 4MDJA 4OCWH 2K9UA 5E99L 4MJ4A 1DUYB 1J86A 1VPOH 2VQUA 3QFDA 5SX4I 1Q9WA 1I3UA 1FGVH 4GBXA 3RL1A 2IF7A 4JDVA 3HAEB 3FT4A 1PZ5B 5C0JA 1NLDL 2EYTB 2GCYB 4WEUD 3QCUH 2GITB 2X70B 5GQBA 2Y9RT 1VHPA 1RK1B 3OB8A 3TVMD 1QLFB 4LPYA 1NQBA 4PR5B 4F7PA 4JFFA 4CDGC 2YXFA 4K3HA 4G80B 4NGHH 1LP9B 4X4MA 1LE9A 5F7WC 1JHKH 1KJ2B 3U7YL 2FHCA 1RZFL 3EOBA 5HHNA 4R4FL 5T1LA 2ZP0T 4NIKB 4UDTB 4PRID 2NY5C 5IW1A 5I1EH 2Z35A 3QDGD 3QXTA 4WWKA 3VXSB 1KYOK 1CT8A 4KJQC 4KJYA 5D1XB 1PEZA 1FZJB 3U30B 2I27N 3LEXA 4I3SL 2C3HA 3BJ91 4Y5VC 4D9LH 1G0XA 1I9RL 1L0XA 2FJFB 4L3EB 2WBJD 3SE8L 4M00A 1QSEE 5DD6A 4TNWK 3T0EC 1E6JL 4GW5A 1RSFA 5EU4B 1N59B 5C0AA 4NRXB 5CIPA 1F2XK 2OJEB 3WDJA 4RMWA 1PSKH 4PJFE 4ZQKB 5A3ID 4PRPA 4TOYL 1MHPH 3MRIB 3DXAD 1RZIA 5LG1A 4KHTH 4P2OA 3IETA 3TF7C 4XNZB 1A3LH 2HRPL 1XZ0A 2EDOA 3KXFD 2CKBA 4OM1H 3CVHB 5GHWL 3SGDH 3DTXA 4PGEB 1IC5H 4G6ML 5A2KH 4U7MA 2HTLD 3FQWB 5BO1L 3DOSA 3OJMB 1FLRH 3D3VE 4TVPE 4OLWH 3TWCL 4L1DA 1ZHKA 3F7QA 4OFIA 1I1AB 4YDJB 1V3KA 2WWKO 1KCSH 5KSBA 4JR9L 3DX9A 3WNLA 3DROB 1ES0A 2X9XA 2FBJH 1RUPH 4XPAL 3QEQE 4JPVL 3U1SL 3QDJE 5JUEL 4N8VA 5IVXB 2GQHA 1KIPB 3QNZB 1KN2H 2VDLH 1QLRA 1Z6JT 5L2JB 5DMYA 1VFMA 5D9SB 1I7ZA 3B43A 4J4PA 4YHZH 1JE6A 1UVQA 3IJYB 1HHIB 3GGWB 1HH9B 1RULL 4X5XB 1KV3A 2QKIB 1WUNT 3BJLA 4N8PA 4Y4FC 3X13B 5C2UB 2D4FA 4XB7A 1JF1B 4NQCB 4WCYH 4UILL 5H94A 1ZS8A 5HYEA 2OL3L 5FKAA 1OAXH 4QRRA 1J8HA 4YNYA 1PY4A 3HRZA 3PF2A 4AMKH 2ADIA 4C59B 3FCTA 2NW2B 4X0KA 4NQVB 3S37H 4M7JL 3P30H 5IMOB 4JDTL 2FEDC 5D7SH 1YJDL 3Q5TA 2W9EH 5EN2B 3IJSA 5B22A 1P4IL 1OHQA 3WUWA 1HI6B 3CLEH 3SPVA 5HHVL 3BP6B 5CEXA 1KB5L 2NLJA 1NGPL 1PVHA 4HG4J 4U6HA 3UYRH 3MFFB 3QCVL 1MFBL 4RGOH 5I1HH 2V2WB 4GG8A 5CBEA 3M45A 2Q6WA 4JZOB 3HMXA 1G9MH 3QUMH 4N0UE 2ARJA 2PR4L 4XWGL 5KSAB 2NY1D 1W72L 5HGBA 4QXUH 3H9SB 2QL1A 3QDHA 2VAAB 3K81A 3OPZH 4JG0H 5FGBC 1EAPA 2ZOLA 1H9VA 4PRDB 5DQDL 3JZ7A 4NQSB 4J3OC 4PJDF 1KTDA 4KI5D 5EBLB 4PGJA 1S5HA 2V7NA 4CVWA 1IAII 3G5VA 1S3KL 1E4WL 4HKXB 2IQ9L 3HI1A 4KKBD 2VN7A 4MAYA 2JTDA 4X7DC 4C54A 3W81A 2OR9H 1UGNA 2VL4A 4XXCC 4RAVB 5I19H 1BFVH 4QKXB 2H2PC 1B0GA 2DQTH 1HOCB 2DRUA 5DYOA 1J5OL 1FFNB 4PJFA 4IOIB 4OZFG 4TULH 3QDME 1C1EH 1NDMB 5FUZH 4E42B 4NKMB 3VE0A 4OCMC 3GI9L 4OI9A 3QUXA 2EDHA 3UZQA 1YEIL 5C0FA 2LE9A 4KXZH 5KSVB 1A5FL 4XHJD 1NPUA 1MWAA 5ESAB 3QIWB 3X3GL 2UUDK 2GHWB 5CKAA 5DR5H 2J6EA 4XRCB 3SGJA 4AIZB 5IK3A 5GRJH 3WIFB 5L2KB 2JELL 3D3VA 1A9EB 3H9HA 4NYLB 1ZA6B 5F9WC 2NCMA 1N8ZB 1JHTB 4XGZB 5F97E 4UNVA 1VFAB 1BMGA 4IJ3C 1KJVB 2AK1H 2VIRB 4K3GA 3TA3B 3IJHB 1HHGA 5TDOA 3QEQA 2ESVE 3QDJA 1T3FA 4PJ5D 2MTPA 5D93B 5FAAA 1CCZA 3O9WC 5IBUG 3QHZH 1U41A 5IWLC 5DVMA 1S7WA 4OD3L 4PJHE 1DTUA 3OKMB 5AG8A 3MJ7A 4DVBB 2EDXA 2XZZA 1IGCH 1EAJA 1A7RH 5HPOA 4WI7A 4X80L 1UM5L 3OMZA 2BSSB 2APWA 3X12B 3HRPA 1DJSA 1J1OL 3PWUB 1JGEA 3DX6A 4KK8D 4TTDD 5F88B 3LZFH 3N0PB 3NH7H 4AL8H 5TPWH 5GRVK 1XIWC 5C09D 2MCPH 2DLHA 5ACMA 3A6BH 3TT1L 3ARBA 2F9BT 1GGUA 5IFAL 5DEGB 2QQKH 1GC1C 3C09B 4ACPA 5CILL 1S7QA 3C87A 5TH2A 2R23A 4GSDL 4FFYL 3L7FA 3EO1B 1A0QL 4RGMC 3IAQA 4WV1A 4RSVA 1DFBH 4X9FA 1PG7L 1Q0YH 4JFOB 1B88A 4FMKA 5AAMA 5ITBH 2JK5A 1CGSL 4N0UA 3QUYD 2UV3A 3VRIA 2ILLA 1JF6A 1D9KA 2J88H 3FQRB 1T4KB 1ZSDB 4LLYB 3RQ3A 5HSFA 2BVYA 4EI5B 3KR3L 1VPOL 4UB0H 2OTUB 1NGZA 1RZGB 3HC3H 1F97A 1FGVL 3STZB 3V5HB 3REWA 2HRLA 4Z7NE 4AK1A 2YUXA 4E5XA 4LPWA 3UBXG 5JR1H 3MMEA 3VWKA 4NQDD 3K2UH 4YJZL 1CL7H 2GK0A 3T0EE 2DD8L 3ARFB 1LMKA 3FB5A 5JLZB 3Q2CA 2DTSA 1U3YA 2CQVA 4U05A 5IB3B 3GFUA 5F7MC 1JHKL 3P73B 5ENWB 4N0CD 3QDMA 4YGVB 3WE6B 4KKAC 4YDVA 3CFKB 4QRPD 1ZLVH 2PO6D 1CYGA 3ZE2F 3RJQB 4FQXC 3DVGB 3R0MA 1Z9MA 1S8DB 2FIKA 3MV8D 4MJIB 4EN3C 3VD5A 3MLTA 3O3EB 4D9LL 1N4XL 5GGSA 3L95A 3LRSA 4V1DE 1X7QA 2ZCHH 4FQ2L 4QHMB 1CIUA 5HHOD 5E1HB 3O6KH 4UU9A 3BRGC 1FPTL 3TP4A 1MQKH 3M1BB 4WFFD 4YAQB 4JE4B 2PTTB 4LMQE 3LHPH 1U93A 3N1MC 1MHPL 4PV9A 3ESUF 3B9KB 1R5IB 2EDNA 2ESVA 4I0PC 3DWTA 4XNMB 2VJXA 2W38A 4YC2B 1DZBA 5JO5A 5FXCH 4OM1L 2FYYB 3HLAB 4BM7A 3IDXH 3MJ9H 1IC5L 5TGBB 5TDNA 4JQVC 2R4RH 3FAXA 1JUFA 1UCBH 3RWGB 5I17B 3LV3B 3CC5A 4MWFA 5CZKA 4PJHA 2I60H 1URLA 5GS0C 1FLRL 3LDBC 1IKNA 3V4VH 4OLWL 1G7MA 1KCSL 2ZCLH 3EZ8A 4XBEH 4CMMA 3IDIA 3TIEB 5FM5O 4MJ6B 5ANMB 4NC1C 2FBJL 1RUPL 5SWZB 4U1MA 4LKCA 4R4BA 3DUSB 1CLCA 3NCFB 3S96A 4LLWA 1OWWA 1A7BA 1MFEL 1I1FA 1UH3A 4O2FA 4JO2L 2XICA 4YHZL 5JXEC 1FNLA 2PYFB 5TFSH 4B7IA 5C9JB 5I8KH 1I1CA 4HFUL 4L5FL 2WLZA 4OKVB 1ZXQA 5J89A 5F3HA 1WC7B 1CK0L 4WCYL 1JNNH 3B8SA 3L7EA 1TVHB 2BNQE 1OTTC 3NPSC 2Y07H 1BJ8A 5FECB 4AMKL 1A4KA 1S7UA 4U1GB 1IZJA 2R1WB 4KTDL 3S37L 2P5WB 4GMSH 5D2NC 3HHRB 3W5NA 4AQ1B 3O8XC 1YNTA 5I2IA 4S2SA 1OT2A 2Y36H 1PLGH 3AB0C 2NTFB 3CLEL 3OHXB 5D1QC 4OZGB 4DKEL 4WHTB 3G5ZB 5F1KC 1X5KA 3UROR 5IESL 5CJBA 2I07A 1IQWL 2E7HA 4RGOL 3S7GA 5I1HL 4Y5VA 2VZUA 4MD4B 2EXWD 4ALAL 1G9ML 3QUML 3T0EA 5E5RB 1JPST 1P2CB 5B3JF 1T1XA 4HFWA 4KY1H 3OPZL 4JG0L 3PXHA 4KK6D 4HF5H 1KTLA 4OI7A 3I9GH 4PRNB 1EUUA 4G8GB 2YSSB 3QZWB 2YA0A 5J0BA 3FL7A 3VGAB 1T7VA 4X4XA 5GJTH 3UTTD 2OR9L 2PXYC 4JFDD 1C12B 4X7SH 1NKOA 1I3RA 4QXGH 1BFVL 1S78C 3P9WB 1D5BB 1MFDL 1UA6H 3QIUA 4MMZC 4HH9A 4XPTH 1EEZA 4HIXH 1KJ3H 3ULUF 2CUMA 3OXRA 1I9JL 4V1DA 2ITDA 3C9NA 4QHUB 1T6VN 3VRJA 2E7CA 4JFQA 2IPKB 3EHBC 1JGVH 2QJDA 3P0VH 1A1NA 5SX4H 4UOW1 3L5JA 5KAQF 1RVFL 2C3GA 3MRKA 1DEEA 3MREA 4XP9H 1CZ8L 5FKPB 5HVGB 5JQ6L 4H1LA 4LOUD 5T3ZH 2Z31D 3Q5OA 1EGJL 1OB1B 3TZVD 4E41B 4WRLA 3MZTA 2X4QB 3VFUA 4EUPG 1H3PL 4PJ8A 2VR4A 1W8NA 2KBGA 5KW9H 5DR5L 5IB5A 4TSBL 4DOHE 1AGCA 3ROOA 1H3WM 4W6XB 3WUWG 2P8MA 5J1SC 1I7UB 4MYWB 1MLCA 1IC7H 4YBHA 1MHCA 4HGWA 2WUCL 2AK1L 3LKNA 1XEDA 1A1OB 4JPIB 2L4OA 8CGTA 4X8XA 5ERWB 4HWEH 4Y19B 5B3JE 1MAMH 4NQXB 4MXWH 4R2GD 3UPRB 1J05B 1LQSR 1FH5L 2NYYC 1H0DA 1K85A 3QULB 4GAYA 3KPLA 2CDGA 4D2NA 5CCKL 1QEWB 4XZUB 1Y0LA 2JB6A 3I02A 1JPTH 2BNQA 2GTWB 4G43A 3WNMA 3LZFL 4KKLC 1QR1A 3O11B 5JTWA 1EEYB 5TPWL 5FGBA 3OJ2C 4H20H 3VFRA 4R8WL 3Q0HA 4P46A 4IRSC 3CFJA 3QG6A 4G6KH 3LQMA 1QHPA 1XFPA 2GSGA 4L4TE 4X6BA 3QUZD 5DJDA 4XXCA 4LHUA 2BY1A 2QQKL 5C8JA 5CD3A 4Y5YC 1DFBL 3HPLA 4OQTA 1C8PA 3FOLA 2MNUA 4H26B 4L3CB 5TQ2L 1MI5E 2DQHH 3WFDH 1WFNA 3BT2L 4HKJA 2J88L 5HHXH 1TVBA 5C1MB 4JRYB 4LARH 4UB0L 3OKOA 3WO3B 5I76B 1UWXK 5HGAA 3HC3L 5I18H 2WSKA 2WAHA 3UTOA 4Y4KB 3PHOB 4ZPVB 3WDIA 4JVUA 5JR1L 4D94A 4I0KA 4RFNC 4XBGA 3SJVB 5C0IA 4QRSA 1BVKB 2LU4A 3MRFB 4S1RH 4EJ1C 5MEOB 2DLFH 3VFVA 3TBYA 4K94H 3BPNB 5DK3A 5D72H 5I1LB 2BNUB 12E8L 2DBLL 3N1PC 5FM8A 1EPFA 4JEGB 4RWYL 2NY2C 3CK0L 1HXYA 1CN4A 1KUMA 3O9WA 4XWOC 4ELKA 2IADB 1NAKL 3DSFL 4YHYC 4ZFGH 3P4MA 4YXLH 3RNQA 4ZUSA 4NP4H 1MRDH 5HYQA 1IEBA 2ZSVB 2PYEE 2ZCHL 1RJLA 3C08H 3WFHB 3O6KL 1AFVH 1FV1B 3C5ZD 4PLJD 1IAIH 1GGTA 1R5VB 4NC1E 3LHPL 4LIQE 4GS7B 1JZ3A 3GMNA 2FCBA 4FMFA 1LO4H 5C08E 3TJHC 4N0FA 4U6VH 1YEKH 4OF6A 3HCVB 1JTPA 5B39A 4HWUA 3IVKA 3SDYL 3BXNB 3KLHD 3RTQD 5DD1L 2Q76B 5JW5B 4NNXA 5I16A 1JPSH 3ARGB 2BJMH 2DQUH 4MQTB 3B6SB 1UCBL 3EOAA 5CUSL 1OPGH 5D1XC 2D03L 2NPLX 3AFLA 4M5ZH 3U30C 2HT3D 4KRLB 1NDGA 3S98A 1G7PB 1F4YL 3O45A 2OS7A 1C5DB 5EZOL 1AIFB 3G9VA 1RD6A 4Y88A 1ERNA 4GJTB 1EFQA 1UYWH 3MV7E 2HLFC 4K7PL 4KZDH 2DS4A 1BOGA 4Z7WE 4CGTA 1FNSH 5D8JL 4PRPD 4WEMB 4XNZC 5JOEA 5TE6H 5I8KL 4JN2B 3P77B 4JQXC 5AG9A 4K9EH 5HGDA 5DJ6A 4L4TA 2FX9H 1LO5B 5E6ID 3FFCB 1V5JA 3TPUA 4OLVH 5AZ2L 2G75A 1I1AC 1GPOH 1NCBL 4OGAD 2IPUG 1MI5A 4KGLA 1AXSA 4N1EA 4HAGA 1MIML 1MVUA 3W0WD 3HR5A 1CVSC 2KUTA 3VJ6B 2CLVB 2L7UA 1PLGL 1L0QA 4DFHA 3GJFH 2FO4A 1NUDA 5CZXD 1XGYL 4FQXA 4NJ9L 3DYMA 1TNNA 5EC2B 4EN3A 5F21B 2RB8A 3EFFB 4LSVH 2BY0A 3WJLC 5HHMD 1AGEA 3CXHK 3PHQA 5I8CA 4JJHA 3SQOH 4M43L 1Q9LB 3UBXI 5DGQA 3EDJA 4PG9B 5LCVH 1RHHB 1ADQL 3BGMA 3I9GL 4X4YB 4YDKH 2XN9D 4K55A 4OGXL 4PP1D 2HFEA 2AEPH 2H1PH 4NBZB 3RNKB 4RX4A 4GG6B 1ZHLB 2VXUL 4JO4L 5GJTL 3P4NB 1LHZA 1SYSA 3G6JE 1RUML 2DM4A 3O3AB 4X7SL 4YBQC 5IF0B 4JQVA 4QXGL 4XCEB 3QUKA 4ZFZA 1W0WB 3HNVL 1J0YA 1KJ3L 1KLUB 1ZTXH 2PYEA 3VI4E 5K9QG 1NEZA 5IJVB 4QOKB 5EIIA 3CFBB 3P0VL 1CICA 4Q9BA 5KSAC 2O61B 1OTSD 4N1HB 4U7SA 1A4JB 5ECJE 3OKEB 3RUGE 2X4NB 4FG6D 1I3GH 5C08A 4XP9L 4BSVA 1P84K 4FQLH 2DL9A 1BAFL 5T3ZL 1FCGA 3HNTL 3WFZA 4KMTH 3NZ8A 2BVPB 5FA3B 2H32A 5HYSA 4P5TA 5JXEA 5MEPA 2DQFA 4YHKL 4HJGB 5B38A 2KQMA 3GSWB 4HCRL 2W60A 5T1DH 5C0CE 1NJ9A 5C07E 4I77L 4X83A 3NACL 4ZPTB 1NLBL 1V7NL 5JHDB 1XF5A 4KWUA 3FQXB 1IC7L 3KLSA 3SY0B 1A1MA 3MV9D 1EERB 4JFHE 3MV7A 4GKZA 2AABH 4EXKA 4HWEL 3O8XA 1B2WL 3SKJH 2R39A 1JI2A 1MAML 4Z7WA 4MXWL 1T03L 5FHBL 1X44A 3VFWA 1UACH 4MQ7B 5D1QA 4R90L 2AXHA 3L3IA 3MOAH 2VITA 5DJAA 4QF1A 1WBZB 1NL0H 3QIWC 4I48B 1BZ7A 1LP9F 4ZDHB 2O5ZH 4YHML 3BYYA 2E7LC 5I8OL 1KYOJ 1JPTL 2LFGA 5CD5D 4RMRA 5GGVL 2AXJA 4AH2B 1A9BA 1T1YB 3BO8B 5T3ZD 1XGQB 3TA3C 5IEKA 3UTPD 3FZUD 3H3PL 5ETUA 3F6IA 4TUKH 4UT7L 3HI6L 1U8QA 4YFLI 5D93C 5BRZE 4G6KL 1EFXB 5JIHA 3QIBD 5ACLA 2PXYA 4TYUA 1YY8A 4H1LG 3EYQC 1M7DB 4KKCD 5IM7B 2EH7H 1CWVA 3GSNB 1G7JA 1M1SA 2EH8H 4MD5B 3B2UD 5IB4A 1FVCA 4OFYA 3SCMB 4F7EA 3DO3A 4P23D 1FFPB 1IQDB 1UM6L 3WFDL 2DQHL 3QJHB 4Q2ZB 1AXTL 2FB4L 3MRGB 3QEHA 2CMRH 2ZUTA 3FT3A 4APQA 4LARL 4JY5H 4YHIB 4P99A 4HUVA 2Z92B 3IDJB 3D9AL 3QXDA 4Z0XB 5DD5L 1NC2A 4LEOB 32C2B 4JM2C 3G6JA 2CGRH 3HE7B 1FL6A 4B41A 1Q94A 3NCYP 2DQDL 2DWDB 2XV6B 3C09C 1LWRA 3TH3T 3ARBD 3RVUD 5D1ZB 4BJLA 1I8MA 3SE3C 2JJTC 3IDNB 1FFOB 3QRFM 4K94L 4X6CE 3U83A 5B4MD 5HYJD 5D72L 1T5XB 4LPCA 4EDXB 3DMMD 4GW4B 5F6HJ 3RUGA 2D7TH 2PW1B 1PAMA 4EI5C 5L8JB 4Q9CA 4DZ8A 4KZEL 1E6OH 4RGNB 3VXSE 1ND0B 4RMVA 4PGDA 3QHTC 3D6GA 1I4FB 3TVMB 1LNUA 4NP4L 4RMQA 2YK1H 3BZ4B 3QQ9C 4HHAA 1M7XA 5C0CA 2BVOA 5C07A 1AFVL 4L3EE 2IEPA 3UEZA 4XNUL 4ZTPH 5F6IB 1HHKB 4PB0L 4MA8L 1G1YA 1EEUA 1IAIL 1NBVL 2BOCA 5FK9B 1SJHB 3ARFC 1LO4L 1AD9B 1A6ZB 4U6VL 1YEKL 1V7ML 4O9HH 4A6YB 4PRIB 2F53E 3QDGB 3TIDB 1FBIL 4MZ3A 4IRSA 4HK0B 4U1JA 3KLAA 4HGKC 5IOPA 1TJHH 5GRUH 5DJ0A 3SDCC 1I9EA 2VLMD 2DMBA 3QDMD 2Q8AH 2WBJB 2ADJB 1WGOA 4YZFF 3P9LB 5E2WH 1MFNA 1IEAA 1RIUH 1PY9A 2X2YA 4H88L 1YY9D 5FYLE 3U36A 5D4QA 1A21A 4Y5YA 1HHHA 5EOCL 1CR9L 3RL2A 5AUMB 3ZE0E 5E4EB 1CXKA 3N9GL 1Z9LA 4KUCD 4KZDL 1TZHB 1SVZA 5IVXE 3B9KC 5IIEA 2CK2A 1MCWM 3KXFB 2MPAL 4QNPE 4HXAH 3OKKB 3MROB 3TO4D 5BRZA 2NY4D 3BHBA 2AERT 5TE6L 5C6WH 3GMMA 4AEHH 5H35B 4AG4H 2YPKA 5EOQH 4LDLB 5HI3C 5DK0A 5DTFB 4AENB 4QCIB 3ETBF 1R3LB 3WN5B 2KL6A 2J1KA 3VFTA 3AMLA 4Q74A 1CG9A 5E24E 1YMMD 2DL2A 2EC9T 4P9HH 4BZ1H 1HQ4B 4R96B 3MX0A 4U6TA 4QTIH 2B1AL 1I1YA 1JFQL 2D0FA 5CHNA 5IR1A 1M6OA 1HEZA 4QRTB 2APFA 5DA4A 1IAOB 1FVEB 4OZ4B 4D9QE 4ZXBD 4UV7L 3DNKA 1DUYA 2X1WL 3GDBA 4KUZL 1M7IA 4HJJH 3MRHA 3T4AB 1R3KB 2OYPA 3TFKC 2R0KL 5C2BL 5ESVB 4E0RA 1OT1A 2OSLB 1QFWI 3HAEA 3C6LD 4LSVL 1G1CA 5E00B 2GCYA 3WNNA 2GITA 2X70A 4HQQH 3MLPA 1RK1A 1INDH 1QLFA 3TN0D 4R7NA 3SQOL 3HMWH 4X6CA 3H9SE 3TH4T 5HXMA 1UXSB 4G80A 2AEPL 2H1PL 1K5NA 1K2DB 1KJ2A 3H8NA 3QH3A 4YR6B 1WIUA 3PWPD 1WWWX 4UDTA 4NC2B 5FV1L 3WIIL 3VXSA 1F4WL 1G7QA 1ZT1B 2DKSA 5KTEH 4F7MB 3IXTB 4HUWB 5ID1B 2R8SH 2KQNA 3E6FB 1ZTXL 1FZJA 3SDAA 5KAQG 2NY1B 3ARDA 1MCKA 3S4SB 3KYOA 4M4RA 5HPMB 4QRQA 3C60D 1N59A 2OXHA 2V7HB 4NRXA 3C2AL 2OJEA 4EDWH 4LQFH 3KPQB 4ZQKA 1FG2B 2F53A 5IGXH 3CZFB 3D2UD 2Y4SA 3VGAC 3FRUB 3NCYS 3FONB 1LILA 5D2LF 3C8KA 2KZWA 3TPKA 1N5YH 1HYSC 4JQXA 3CVHA 1FSKB 4G3YH 5T1DL 2NR6D 3IS0X 4BH7A 3O2DH 2IANE 3V7MA 4P59H 4X7CC 1INEH 2DIBA 1A6TA 1FL5B 1CIDA 2B1HL 2Z0BA 1I1AA 1S9WB 1OAUL 3QIUD 2XTJD 1DQDH 4CKVX 4JO1L 1B4RA 1CDIA 1S7TA 2G2RB 3DROA 4OZFH 3LCYA 1DUZB 2Q87A 2OP4L 3F58H 2AABL 3PDOB 1U91B 5IVXA 1KIPA 3QNZA 3SKJL 4LBEB 3AC0A 3A6OA 5L2JA 1K6QH 5D9SA 3AY4C 3DETC 4FQHA 4WGVB 1CGTA 2P8LB 3JSSA 1IGFH 3MOAL 2R1XB 1JWUA 1HH9A 3DARA 2WW8A 4X5XA 3KGRA 3ARED 1A2YA 5F89B 1T66D 1JF1A 2IG2H 1T2JA 5HD8C 4OIIL 2KDGA 3WJLA 3IFPB 4M9PA 3HE6D 4D9RE 4JHAL 5D7KE 4PJ5B 4XPHL 4ODBD 4G42B 4OGYL 2E6QA 5J1TC 3RWFB 5IMOA 5KVEH 2B4CC 1N0LA 3G6DL 5EN2A 2IAMD 2VLRD 3NABL 4YE4H 1HI6A 3ZKXB 4CNIB 4S0TD 1TZGH 2EH7L 2H9GB 4BZ2H 1E4JA 1KLFA 2EO9A 2X5PA 5HYSG 4GKOA 5L7XL 2GIYA 3MFFA 5I0ZA 4W4NA 1EX0A 1Y6MR 4DZBA 1JN6B 2E9BA 1DN0A 2JB5L 2CMRL 4NQED 2VAJA 2HT2C 4LAJH 2XY1A 5C09B 3H9SA 3HG1D 2VAAA 3HZMB 4QYOB 1JMXA 4JY5L 4ODXB 3UP1A 5CEZH 1KXQE 4NQSA 5EA0H 2ZG2A 1CFQB 2QQNH 1MLBB 4MNGB 4HKXA 1NFIB 2CGRL 2XOTA 1FL3B 1BIIB 4Z9KB 1KENH 4D0DB 1FCCA 4WNQB 1R6VA 4RAVA 5IBLD 3U2SB 3ULVL 2LU7A 43C9B 2RQ8A 1FFQA 2HFFB 1X5HA 1NGQH 3QUYB 3V6FB 4CBPA 4WHYH 4ONFH 4MX7B 4WENB 2Y5TB 1CD9B 4Z7VF 3S34H 1FFNA 2D7TL 2FZ3B 1CLYL 4IOIA 1G84A 5K9QI 5SWQA 3BYTA 3NPZB 4KK9C 1I1RA 4E42A 1KXVC 4HLJA 2FH8A 4LEXH 3SEPA 4NQDB 4IMLB 4Y4KC 4K71B 2LTQB 2YK1L 4GW1B 4YXHL 5ESAA 3QIWA 1FZKB 2IANA 4ZTPL 3U7AA 3X11B 4XRCA 2E7LA 4AIZA 3LB6C 3UZVB 4PJGE 1A9EA 1Q9KA 4NYLA 1PQZB 5GSRA 5JZ7C 4OJFH 4GQ9H 4XGZA 3QG7L 3BPNC 1VFAA 4OZGF 4RMTA 3OB0K 4O9HL 1KJVA 2VIRA 3MNWA 3TA3A 4QRPB 3BPCB 1X5FA 4JKMA 1FJ1B 2PO6B 5IMMB 3MV11 1OQXA 4HXBH 3HFMH 1TJHL 3MV8B 4LSRH 1YYMH 2ED7A 4DN3H 4Q9RH 4MHHI 4TQEH 2DQEL 3KPRE 5E2WL 5E9DD 3ZSSA 1RIUL 4PS4H 1JNLH 2CSPA 1TTGA 4L4JA 1E27A 2MCG1 1NUGA 1IGMH 2MSPA 5ANME 4AZ8A 2R1YB 4GS7C 2BSSA 5SWZE 3X12A 3PWUA 5KN5B 3LQAL 1TQCB 5F88A 5HTSA 1K4DB 2WMPA 3BQUA 3MRBB 1D6VL 1YYLH 1ZWIB 4HXAL 1PX4A 1JTTA 1MNUH 4JM2A 1L4IA 3ARGC 2OK0H 4MA7H 5EOQL 1YPZB 3V6BR 1G9NH 1UKSA 5K93A 2FX8H 4PTUB 4YX2L 1TTFA 4WFGD 3V6ZA 5DEGA 1D5XB 1T5WA 5J57B 3QXAB 3KYNB 4ENED 1RUQL 4OCYH 2MHAB 4WTWA 2HFGH 4P9HL 3MPCA 4BZ1L 2JJTA 4OB5H 1A8JH 5L6YH 3VMOA 3DURA 3KJ6H 1JGDB 4R4NC 4NT6B 4MLIA 1DLFL 2GJ6D 5E70A 3FQRA 1T4KA 1ZSDA 3PQYD 4HPYH 4HSQA 4J2XA 4EI5A 3U6RA 4PLKC 4HJJL 1RZGA 5H37H 2HMIC 1NBZB 4NO0D 1HDMB 2DWEB 5I73B 1UB5B 3STZA 3ULSB 3V5HA 1MIEH 1J1XL 3DRQA 1AQDB 1JPGB 4TPRH 1HIML 5FYKH 4JLRB 4L4TD 4H8WL 4ZODA 5DDHA 3BD4A 2JIXD 3ARFA 3UTZA 1Z5LA 4DVRH 2BY3A 5JLZA 3RWIB 1Z3GL 1B3JA 5IB3A 5DVLA 5MP6H 5DJZB 2NX5D 1HWGB 4J7RA 3P73A 4X8JB 4G8GE 4YGVA 1J9CT 1ITBB 5C7XL 5F70A 3MODH 2DJ4A 3CFKA 1CFNB 1Z0MA 4H25B 4HZAA 3SDCA 1X6LA 4Y8AA 4Z6AT 2ZSWA 4R7DB 2GFBA 4XCNB 4U3HA 2DLGA 4JFYB 1BFTA 4QHMA 3SKOB 4PJGA 3UTSB 1KCUH 3S9DB 3M1BA 4XMKL 4YHOH 4YAQA 2F74B 2PTTA 4L8DA 1VEMA 5C0GB 1C7SA 1F02I 5ISZD 5ABDE 2V9TA 4NCDA 1RPQA 3B9KA 3UTTB 4BFBD 5IGXL 4LSQH 4JFDB 1YN6A 3KPOB 1N5YL 3L5HA 4XAKE 1ZAGA 4N9GA 3WMSA 3UJIH 2JCCE 2FYYA 5DRXA 4G3YL 3HLAA 3KPRA 1DDHB 3O2DL 3RWGA 5I17A 3LV3A 4LRIA 2WWMC 2J5LB 4R0LB 3T09A 2F5AL 3HAEG 4U7KA 2DF3A 4JGJA 5F71A 1FYTD 4MJ6A 5ANMA 1F45A 5SWZA 2CLZB 2F19H 1JZ4A 1HILB 1J11A 1VGKB 1RIVH