4FFWD

Crystal structure of dipeptidyl peptidase iv (dpp4, dpp-iv, cd26) in complex with fab + sitagliptin
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
217
structure length
209
Chain Sequence
EFQLQQSGPELVKPGASVKISCKASGYSFTDYNINWMKQSNGKSLEWIGVVIPKYGTTNYNQKFQGKATLTVDQSSSTAYIQLNSLTSEDSAVYYCTRFRDVFFDVWGTGTTVTVSSAKTTAPSVYPLAPVVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/immune system, inhibitor
molecule keywords Dipeptidyl peptidase 4
publication title An Inhibitory Antibody Against DPP IV Improves Glucose Tolerance in vivo - Validation of Large Molecule Approach for DPP IV Inhibition
rcsb
source organism Rattus norvegicus
total genus 28
structure length 209
sequence length 217
chains with identical sequence H
ec nomenclature
pdb deposition date 2012-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ffwD01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ffwD02
1NBZB 2BVQA 2IPUK 2WUCL 2DI9A 2X4NA 1V3MA 3O3DB 2PO6C 2AQ3A 3HAEG 2DQDL 1I8KB 5GSVB 3DTXB 5J6GA 1WFTA 1U8JA 4NQUA 4Y0GA 1CK0H 1OTSD 2IFFH 1CZ8H 3UJIL 5I8KL 2DD8H 3I9GL 3L3GA 3UXFA 1NGYB 3ARBD 4L8BA 4LQFH 1KIPB 3BT2L 1X5HA 4FXGA 3EO0A 3CSBA 1A9EA 4XBPA 4WHYH 2HN7A 2X41A 1I1FB 4JPWH 1MRFH 2Z8SA 4AG4L 3WJLC 1Y6MR 4I18C 3R1GL 3V8CA 4JFZL 1QRNA 3O0RH 4MDIA 3SO3B 2IQAB 3BIKA 5I8CB 4FZ8L 4JFED 1SYVB 2VXUL 4MWFA 3P4NB 4PJGE 2O5XL 5CBEB 1Q94A 1BLNA 2JK5A 2QJDA 2IMNA 5AD0A 3SE4C 1J10A 3HUJB 4R7DA 2AEPH 3T0DA 1R24B 2OQJB 3LN5A 4Y89A 4G6FB 4HWNA 3W9DB 4A6YA 3U9PH 1C5DA 1X5FA 3GI8L 4XRCA 3PDOA 5E6IC 4Y19E 3QJFA 1IQDB 4JGUA 3LOWA 3F7QA 1A1NB 1WT5C 2IMMA 2MCPH 4IRSB 3NPSC 5DR5H 3PWLA 5GRUL 4EDWL 5I9QB 1RZKH 1G9MH 1I8LA 4D3CH 1AKJD 2JJTA 4CVZB 3DI2B 4LLYA 4NQDA 3VD3A 4D8PB 4P57B 5IB2B 3QA3A 1SM3H 1T3FB 2FX9L 1RUAH 2K1MA 2I9TA 5F1NA 3ULUE 2XTJC 1AXTH 1LDPL 2EDNA 2QV2A 3P73B 4BSVB 3LMJL 4R2GC 4XAKD 4YEEA 4K3GA 1CLOL 4JFPA 1YQVL 1CVRA 3MFGB 3WFHA 4RGOL 4X98A 2WINA 1BZ7A 1W8OA 2P1YA 2R29L 5T5NF 4HUMB 4EUPA 5L8JB 1R5WA 3V52H 5IGXL 3C8HA 4ODBD 4GSDL 2BK8A 3MRMB 4YWGL 1MJJB 2E3VA 2J8HA 3L3OB 5L8KB 1FCGA 2G60L 3EJZD 3MZTA 2P4AB 5BMFL 4XPFH 4MD5B 1A21A 3UTQB 3ZTJG 3RIFK 1P2CB 5DQJB 5J12B 3V6BR 2DM3A 3HPJB 4DN3H 4R4BB 2ZUWA 3WJLA 4B7LA 4J3UA 3SCMD 1M6OA 3GGWA 1VFOA 5AWNH 3WXWL 1EFXA 4K7PX 4KAQH 3T0ED 2XNAA 3OKDB 4KU1A 4Y5XB 5GHWH 1G7LB 2YWYA 4X83A 3RWDA 5IMMA 2PYFB 3DNKA 4KK8C 1CFBA 3RRQA 5EZJA 3D85B 3Q3GB 4LLQA 1N8ZB 5JXED 4NO0D 5IB1A 2W92A 3SE4A 1HWGB 1BGXL 3JVGA 3KPOB 3WNNA 5CEYA 5EUOF 5FUCE 2X7LB 1LK2B 2DWEB 1U0QA 2QQKH 1K5NB 1QHPA 3V0VA 2DIBA 3FQRA 1U92A 3RI5F 1KIUA 1WT5A 4XC1H 1ITCA 3RAJH 1IL1B 1ZHNB 1KJMA 2HKFL 2RIKA 5DD0H 2R9HD 2Q7YB 3OB8A 2IEPA 3WDJA 2R69H 3BKCH 2BNQB 4G3YL 4G6JL 5KSBE 3VFWB 3L6FB 4YDKH 3TPUB 4HLJA 2QADC 4U1NA 1JGLH 4MAYA 1QFOA 1L4IA 4FQLH 3V6OE 3I3BA 2R0KL 2CKBB 4LQ1A 5IVXF 5IHLB 1YDPA 4K3JL 2AQ1A 3I6GB 4LSDA 3ZTNH 3ORJA 2CH8A 3GHBL 4PJAF 4AM0A 4EDXA 2XKUA 4JAMA 5DJ0A 4K9EH 4NNPL 1ZSDB 4PIRF 3KJ4B 5ALCH 4XNXH 1WICA 2IPKA 5JNYA 1MHPH 5CEZL 2VAAA 3HZMB 4PJAB 2WIMA 3DO7B 5KVDL 4U1JB 2IQ9L 4OCSH 2IH1A 4U2ZA 5DRZA 3VFVA 2OJZL 3N1FC 4MA8L 5BS0B 2R1XA 4FRWA 3IS0X 4U0QB 4APQC 4YDIL 4KZEL 3V6ZA 4ZUVB 1OGTA 1G7IB 2HT2D 1A6TA 2F19H 3BHBB 3BPLC 5D9SB 4ODTH 1IAMA 5DJDA 1F90H 3QIUA 3U1SH 2FO1A 1DDHB 4P9HL 1KJVA 1KJ2L 1KTDB 4FS0A 2E8ZA 3MXVL 3NA4A 4GMTH 4IIQA 4NQSB 3FMGH 4OCMC 4XWOC 5EZIH 5T33L 1HXMB 5EO9B 2A6KB 1EXUB 1JPSL 4G6FD 2R0ZH 4G9FB 2YEZB 4JPIA 1FYTA 1SJXA 5CGTA 5JW3L 5D72H 1I8IB 4RFOH 3HMXL 5LGHL 3TFKC 2GJ6B 4OZHA 2H6PB 3RVXD 1PX3A 1AO7D 1JWSA 5GGSB 2IALB 1QFWM 3OKOB 5J1AA 3HFMH 1YY9C 4RBPK 4U3HA 5DFVD 4QXWA 1IGIL 1BIIB 4HWUA 4KRMB 4Q2ZB 5FO7B 4AIOA 1P9MA 3KPRD 4L8DB 3S88L 3T77B 1WWAX 4HWBA 1AD0B 1TETH 5E8DL 1FZJB 4I0PA 3QWOA 5KS9A 1R5VA 2OK0L 4LVNB 4KH2A 1JRHI 4YPJA 4UTAL 4PJ7A 2GHWB 3TZVB 1YPZF 1IZKA 1NAMA 4ONHA 1MQ8A 3RGVB 4POZD 4GKSA 1KSRA 3HZKB 4IOFD 4ODSH 5DA4A 4JGJA 4J3XA 4U3XA 4HG4K 3LQAL 3LQMA 3TLRA 5L0QB 2J88L 4RGMC 1JE6A 1CICA 3WIIH 5IFAL 2X4TB 3U7YL 2AXGB 1ORSB 2Z92A 3TVMC 2X4QA 3BGAA 1CD1A 1JI1A 4DOHB 4PGEA 4OLVH 5F3BA 1TQBC 2W9DL 3D25B 4MA3A 1E28B 3Q6GH 4NM8L 3WIFB 3NA9L 4WFGE 1KENL 3TT1H 5E7BA 1FFNB 1NBVL 1PSKL 3RWEA 4WU5A 2CGRH 4J23A 2H3NB 1TZIA 1HI6A 1AI1L 1QR1B 5I15H 4Y2DB 5D1QD 3N06B 3WO4B 4TNWK 2HVJA 2P8PA 1KCUH 1BFVL 1INEL 4IBLT 4TUKL 4ZD3L 1HCFX 3QQ4A 4GXUM 3LV3B 4KWUA 4WI3A 1ADQL 4XNUH 2XACC 3JWDH 4HF5H 4Y5VA 2ADJA 3OJDB 3FO0L 3LIZL 2BNQD 3ZYZA 2HFEB 3RTQC 4Z5RB 2JTDA 1MY7A 3C09B 4WFHE 1E6OL 4PJDE 3MJ7A 3DIFB 2GY5A 1QO3A 5F6HI 1EZVX 4GRMB 1VACB 2ICWA 3MNWB 1MAML 4MXVF 1BQHG 3O8XD 1MCRA 5EU5A 2V2WB 3KXFD 2Q8AL 1KTRL 5HHMB 1U3ZA 5JHLH 4E5XB 4DN4L 1WLHA 2BVQB 2PXYD 4LDOB 1KN2L 1HSAA 2NZ9C 5F88B 1RIUL 2Z9TA 2GSIB 2HTKC 3KPMA 4L8CB 3C60D 5SWSE 4MS8D 2X05A 3QZWB 1C5BL 1H8NA 1IGFH 3MUY1 5FYLL 5F1IA 4PJ8C 1P7QD 3NCJL 3U9UB 3NGBB 4LP4A 4Q6IA 3VWJD 1YYMH 1KTKE 3LD8C 3JWOH 1YEJH 5C0GA 3JV0A 3RWJA 2JCCE 4FXGB 1A9EB 3BN9C 1YY8A 3GSQA 4XBPB 1NGQL 3G9VA 3NTCH 2VXTH 1RZ8B 4Q0XH 2BSRB 1UM6L 2GKIA 5CCKH 5HI5D 2V5SA 1QRNB 4Y88A 4WNQA 5AZ2L 5HY9B 3BIKB 1F8TH 3WKMH 3CGTA 3TN0D 3QUXA 5JQ6H 1KIRA 3QUYA 2X4UB 1TIUA 4MWFB 4NC2B 5BXFA 5F93C 1J1XL 4WEBH 1MHCA 4HC1H 4R7DB 4PJ9A 3LN5B 1DN0A 4L8SC 3MRRA 4Q6YA 4A6YB 1CS6A 1G6RL 3BEVA 4G9FD 5IK3A 1C5DB 5KVMC 1OW0C 5TE4H 3WNLA 1MLCB 3QCUL 2FZ3A 3KJ6L 3ALXA 3G5VB 4KJPD 3HR5A 2P5WE 5FHAL 1EH9A 2Y06L 5K9OB 2BOBA 3RKPA 4UT9L 3NCYP 5TJWK 4I1NB 4I9WE 4JRYA 3PWLB 5F1KC 3SO5A 2D9CA 3RTQA 1CGYA 1XCTB 3P0YL 3V5KA 4FQIL 4XVJH 5FECA 3QNXB 4H25A 2VQ1A 4NQDB 1GYAA 3THMH 4LBEA 1S78C 3DETC 2XOTA 4LLDA 4XNZC 3ARUA 4OF8A 5A16A 3B3IA 2NLJA 4WW2F 2BNUA 2NXYC 5HPMA 5C0IB 2OZ4H 2DTML 2EZ0D 4LU5H 5DLMH 3LEVL 4KGLA 5JMRA 4HG4J 4BH7A 3MRLA 4JFPB 3QDGE 5HGDA 3BSZL 2GYSA 4X98B 2WINB 3H8NA 2AXFA 3TH2T 1K85A 4JG0L 1R5WB 3EAKA 3RGVD 1FN4B 1PEZA 1PVHA 5C0RH 3ULVC 4Q9QH 3FZUC 4K7PY 4PJ8A 5CGYD 5D6CA 3VXTA 5L2KE 3DX6A 3KLDA 4NKMB 5D4QA 2OTUA 3DXAA 3L7FB 5FYJH 2ORBH 1FGVH 1VESA 4FG6D 5MENE 1EX0A 3P11L 1KGCE 1R3KB 4P2QA 4I18B 5GGUA 5IHUL 4PY7A 4JFFA 3KYNB 1EFXB 1NLDH 1E27A 1XGUA 4M3JA 2J4WH 3DLQR 3RWDB 5IMMB 4J1UB 1DQQB 3BVNA 4JY6A 5GS1C 2YD9A 3EJYD 3W5MA 2Y6SC 1N0XL 5TH2A 5E9DA 5F7DA 4JFXA 3MV8B 4Y16C 3WNKA 3D18B 1MIEL 3PL6A 3GHEL 4GW1A 5E6IB 5L88L 4F7MB 3TNMA 1CU4L 4O4YL 3BRGC 4OV5B 1U92B 1JPST 4OF5A 1QFHA 5TGBA 1A14H 3NPSB 3PF2A 2CDEA 5E2VH 1EEQA 4MA7L 7FABL 3PWUA 2VLJA 1I1RA 4IJ3B 3OF6A 4EI5A 2APTA 4XMKL 5DVNA 4CMHC 3EYSH 3FFDA 4M43L 5FYKL 1YDPB 2XTJB 5C0FA 3QEQA 2QSCH 4R2GB 1I3UA 4JDTL 5C09B 4L5FH 4ZOEA 3OGCA 4NJAL 4AM0B 4ZPVA 1MFDH 4EDXB 4XPHL 1UM5L 4JAMB 3FONA 1OOAA 2VRAA 4YGVA 1OAKH 1CD0A 1SBBA 2VAAB 4LVOC 1I9RL 3GIVB 4KPHL 2YA1A 4R90L 2C7UA 3EO1A 5DRZB 2XI9A 2C5DC 3FO1A 4ZSOE 2R1XB 3HI1A 5J6HB 5E00A 4M7JL 1TNNA 4KJWD 1HXYB 4GBXD 1FSKC 4TOYH 1FFPA 2B7DT 3SGKC 4PLOB 5A2JH 5D2NA 1A6TB 1NGWB 1W0VB 4M6AA 2J8UA 1MELA 5HGGS 4WUUA 3VW3H 1LEKA 2UUDK 5BVJA 1S7UA 5DJDB 3SBWC 3VG9B 4JB9L 1Z9MA 5ISZD 5J13C 3TP4A 1C16A 5I0ZA 1T5WB 5DMJB 3S4SB 3WO3B 1KNOA 3GM0A 3H9SA 2QR0B 4PJHF 2DF3A 4MB3A 4FFVD 1OP5H 4YUEL 3L95A 2A0LD 1N26A 1YA5A 3G5YB 4Y5YA 2HAZA 3ULUC 2Z31D 2YXMA 4K71C 1FYTB 3OAZK 4HSQA 1F2XK 4OM0L 5CHNA 5GRZA 2X5PA 4GXUN 3LN9A 5L6YH 1N64L 4Y1AA 2D7QA 5IP4A 1CE1L 1R3LA 1AFVH 2HJFA 1I9JH 1QACA 5DZLA 3V6FA 3ZLQC 2ITDB 2QADB 1JWMA 2EC9U 1BWMA 4AEIH 3CJJA 2P8LB 3E8UH 5DUPH 4KI1A 4F7CA 2J6EL 1ZLVK 4IDLA 1NCNA 1LK3L 2IAMD 4QRRD 1MCWW 4IMLA 3VGFA 1BD2B 3BAEH 3X3GH 4JCLA 4XCCL 5I8OL 2YUZA 3QWOB 1BWWA 5KS9B 4OF3A 4OZHE 1R5VB 4CADB 3D9AH 3C6SA 2PR4H 4PLJC 4KHTL 4YHKL 2EH8L 2KKQA 2PO6D 3T0VA 4PJEF 4ONHB 1G1YA 3V4VH 3IU4L 2ERJB 4OAWA 4APQB 5FUCC 2A6JA 2IPTL 1S7TA 3MLTA 1CD1B 3SGKA 3H9HB 4ZODA 5HD8C 5ITFA 2PKDA 4LCYA 4YAQA 4MA3B 1VGEL 3BPLB 1EHNA 3MRDA 5I30L 1UWEH 2Z4QA 4G6KL 3V5HB 2FCBA 2VJXA 1J8HA 1UJ3A 4WU5B 1TZIB 4G8EB 4NDMA 2A9ML 2GSGA 1CIUA 3MV8D 2HVJB 2P8PB 2DI8A 2BHYA 3SY0B 4WFED 3PV6B 5HGAA 2QSVA 1MCJA 2HVKB 3D69A 4Z18A 3CLFL 1MWAH 3M1BB 2SEBB 4LCWE 1A3RH 3ARTA 4FQCL 1EZVY 1IGJA 5F9WC 2ADJB 5SWZA 4J6RH 3RL1A 3IF1B 1H5BC 1BP3B 1UWGL 4CVXA 1CXHA 2K7PA 3ARFA 2AJSH 1FE8H 1W72L 5IBLC 3UBXB 3BQUC 4R96B 2OL3A 3T3ME 5CUSH 3TF7C 4OQTL 3VGHA 1RZJL 4OLEA 2ICWB 1J0JA 4R2GD 1DBMH 1ZXQA 5EU5B 2Y07L 3WIHH 5FYJD 5C09D 2D7NA 3MRIB 4WU7B 1DBBL 3CMGA 4G8IB 4U6HA 1QR4A 1G7PA 1M7DA 1T66C 1ZT7A 3QRGH 5E99H 3C6LC 4ODXA 4RGMB 5E4EC 5K59E 4Q6IB 1IFHH 3TVMB 2C3XA 4M7KH 4GKNB 2VDQL 3RWJB 1TQBB 3GSQB 4YXLH 4MB4A 5BRZD 2YD2A 3IT8D 2R23A 1MWAB 5DRNB 2GFBA 2D3VA 3CXHK 4RRPG 5TDOB 4WNQB 4B0MM 4KK8D 2E6PA 2JJSC 4TRPH 3QUXB 5GZOC 4H20L 3CK0H 4FFYL 5HHNA 4ZUUB 4L3ED 3NFPA 3QHZL 1MHCB 3NPZB 2EDLA 1KCSH 4QRPB 3SKJL 4PJ9B 4PJCA 2ATKA 1DN0B 3MRRB 3DX7A 5IK3B 3BEVB 3MRFA 4PV9B 5K9KA 1NL0H 2BP3A 1CXKA 2APVA 2FZ3B 3TEUA 3F7VB 1YJDL 4R7NB 1YEFH 1H5BA 3INUL 3LRGA 4ZQKA 4B5EA 2Q6WA 2VLRE 1L6ZA 3SPVA 3RTQB 5AZEH 4KZDL 1KUMA 1SY6H 2H32H 5JHDE 2QADD 2OR9H 3X12A 2H1PH 1E4JA 1X3DA 4KMLB 2E7LC 3S36H 4XCFH 3V5DB 3P0GB 4I5BB 2W0FA 3CX5K 3QJHA 1BBDL 3O6FC 4LLDB 2AJXH 3EW3B 4P2RE 5DRWA 3B3IB 2NLJB 2BNUB 5DJYA 4HIEA 3RP1A 2YD4A 4RWYH 3LS4H 4FQJH 5MEPB 3VRJA 1KACB 4QHUA 2HTLC 4MAUH 3O3AA 4ZNEA 4NHCL 4JKKA 2AXFB 1JNLH 4JLRA 5TE6L 1VEOA 25C8H 4ERSL 3SOBH 5JIHA 1MCQA 1OAUL 2AV7B 4M3KB 4PJ8B 3RWFA 3MR9A 1OY3B 3VXTB 1K3ZA 3RWIA 5DUBA 1MCHA 1E6JL 4HV8B 4XNYH 1U8LA 5LWYL 1G1CA 1IM3B 1NUNB 4MJ4A 3RY4A 3QB7C 3FQNB 2HWZH 4LSPH 1T6WA 5GGUB 1NMCC 1BZQK 5DMKA 3MCG1 4JFFB 1FNEA 3RX8A 1QBBA 5C2BL 3ULVH 4PS4L 2NXZC 3B83A 1M05B 4LEOA 5ALBH 1ZANH 3IJHB 3PP4H 1T1YA 3B9KC 1LE9B 3BVNB 2NY6D 3P9LA 4JY6B 3VFGL 1TZGL 3ESVF 3MLRL 5TH2B 3VXRE 5F7DB 3VFPB 3MRPA 4KKLC 4DEPC 4L8SB 3IDYC 4HAFA 3S3PA 3PL6B 4XVUD 4XBEH 3O6KL 1UKQA 4LHQB 4DUVA 1JBJA 3EJJX 3N1PC 4F58L 2H9GA 5E8NA 5EA0L 4Z76A 4V1DA 4P2QE 3C08H 5ECJE 1MCCA 2E7HA 3TIDB 2IADA 5D2LF 3W9EB 1IC1A 3O6LL 3QHFL 3NH7L 3B9DA 3QNZA 2E7LA 1CLZH 2X42A 1YY9D 4IEFB 2XA8L 3HNTL 5HYJD 3HZVA 3V7AE 3QG6B 3KLHC 1KCRH 2PTTA 4P59H 4XNZB 1KEGH 3FFDB 2G2RA 5D2LB 5FV1L 2WQ8A 2NXYB 5C0FB 2YBRA 1UFUA 3MBEC 3EOAA 1FL5B 1YECL 3K81A 4Z8FH 3OGCB 1Z0MA 4KDWA 4CN4A 3C8DA 2AK4B 3UP1A 5DT1L 5D8JL 3FONB 2ZSVA 2B2XL 3U7WL 1GC1L 4F8TA 3SKMA 4L1HA 1DUZB 5C0AA 4F8QA 4P4KA 3DBXA 1JYNA 5B38A 1BOGA 1D9KC 4AT6A 32C2B 4K23L 3HI5H 3EO1B 2FJFB 4G6AC 1JNNL 1MF2H 1OAZL 4X9GA 4XPGH 4DQOH 4NQVB 2YA2A 1PEWA 3AAZB 3TVMD 3HI1B 3IXTA 5E00B 1KYOJ 3H7BB 1AGBA 1IMHC 4J4PA 1A7QL 1FFPB 1GGYA 4YBLC 3ZDYF 2F53A 1LEKB 1OSZB 1M1SA 1S7UB 5ID0A 1JPFB 1G7MA 1KB5L 4HS8L 1FL6A 5HDBF 4Y4FD 4Z7VE 1C16B 4IOIA 1YUHA 3QWRD 5GS1B 4ELMA 2AJUH 1JN6B 2ENYA 2FSEA 12E8H 2D4FA 1KNOB 4NQCA 4ONFH 1CTOA 2NW2A 3H9SB 5CJOL 3QUMA 3NZHH 2DIJA 4QRPD 2NW3A 4HJJH 2MHAA 5GGTL 2NY7H 4PRIE 3TJEH 3L95B 3PQYD 3U0PA 5T3XE 5HHOA 3BZFA 5DI8B 4N0UE 1JGVL 1H3GA 5CHNB 5T1LA 3UEZA 1FYHB 1J1OH 3VXNB 5HHXH 4KTDL 2EIZB 2CDGB 4DUXA 5J11C 4KK5C 3DOSA 4LNVA 1AXSA 3PP3H 4CN1A 1PQZA 4MLSA 4GG6E 4EOWL 2E27L 3ULUH 5FDWA 2B8OT 4CMHB 1EMTL 1QVOB 2H8PA 3IDJA 4QOKD 3VDAA 4UTBH 4F7CB 4E0RA 1NBYB 3MUJA 1UEYA 1RJYB 4Q58C 3TV3H 4AK1A 4IMLB 1NGPH 4M4RA 4PJFE 1YN7A 4PJGF 2QHRH 3WXVH 2HLFD 5IVOA 5TFSL 4O2EB 4M4PA 3MUZ1 4O9HL 3BIAX 3W0WE 2NZ9D 5I18L 1FDLH 2HTKD 3GMMA 5EBMA 4C55A 3RX5A 5KG9B 1L0YA 1DBKH 1DEEB 5ESAB 4BZ2L 4JY4A 1K6QL 3N0PB 2DTSA 1MCIA 2V2XB 5FGCE 5IMKA 1I9EA 4JKMA 4HW6A 5CSGA 1RZGB 1WZ1H 4GLRI 3ZMRA 3BPCB 4YLQT 5T5FH 4LSRL 3GJFK 3BN9D 3MYZA 3MLTB 3P0VH 2BJMH 5JOPE 5F9AC 5ITFB 3GSWA 1KBGL 4LCYB 4YAQB 1VFMA 5D6DC 2EDBA 1P7KA 3IDMA 4G8GD 1Q9LB 5CD3A 3MRDB 5J13B 4P5MB 3KG5A 2M2DA 3OKMB 3WDHA 5IVZA 3MYJA 1J8HB 3DARA 3UTSA 2NX5A 3QDME 4LDLB 4QTIH 3VGBA 4MQ7A 1CT8B 3MO1A 3FQUA 1NC2D 2GSGB 5CP7B 1J0YA 1IQWL 5GGQH 4P2YA 5K93A 3UJTH 5HGAB 4H5SA 4X6CA 4JHZA 4DGVH 3UJJL 3D69B 3QIBC 3OG4B 3KWWA 4J12A 5F21B 1KCKA 4WO4C 1JRHH 4LKXA 5C9KA 4JREC 3GIZH 1I3RA 1IGJB 2VQUA 3VXUB 1JZ2A 4BKLB 5HTSA 1Q9OA 1WAAE 2F74A 1U3JA 2EEAA 1U8IB 1PD6A 3N9GH 1KEMH 2QQLL 5HYFA 4HFUH 1S78D 2CD0A 3DETD 4AEEA 2OL3B 5IB4B 5E2JA 5K9QI 4ALAL 1VFBB 1ACYH 1MI5E 4QHMA 4UILH 1QSFE 2X4SA 1CDJA 2AK4D 3FT3A 1S9KC 2BNRD 4U6HB 5LQBL 1NFDE 5E2TH 3ULVD 1M7DB 3GRWA 5GZNC 1TNMA 4KQ4H 5SX5H 3UPCA 2VUOA 3CVHH 2G9HA 4W4NA 4DGYL 5DC9B 3C5ZA 1FBIH 2NY5L 3GBML 4NT6A 5I1IH 4L4VD 2FJGA 3LKQA 5KSBF 5E56A 5F7UA 5HVHC 1T1ZA 5IFHL 1X4YA 4NO2B 2A6IA 1A1MA 1SEBA 5H94A 1FZKB 3MRCA 1BFOB 3DUUA 2GFBB 4NUJB 1CTNA 3VRIB 4ZFGH 2G5RA 3T2OA 1Y0LB 1CK0L 1HEZB 1RZIA 1OF2B 1U8HA 1YYLH 2Y6SD 3QO0B 2DD8L 3BUYA 3HCVB 1FJ1B 2D9QB 4LPYA 5I1CL 4Y16D 1K2DB 4LQFL 5FO8B 1F3DH 2AEIT 1I7ZB 4PJCB 2ATKB 3FAWA 4U1SA 4Z77A 4JPWL 1MRFL 3HC3L 2NR6C 4OZ4A 4PR5B 1CFVH 1E4XL 4LLAA 5IF0A 3SJVD 1MFAH 3O0RL 4X9BA 1KLFA 5IESH 5F9WB 1NQBA 2MSPA 1XR9B 1H5BB 4OBRA 4ZQKB 3QP3A 4R4FH 5JZ7C 2GT9B 3P9WB 3FB7A 2WBKA 4CU7A 4JO3H 4LHUB 3BEWA 2AEPL 2R8SH 2W0FB 1ZMYA 1B0RA 2VR9A 3BQUB 3QJHB 3U9PL 2QQNH 4DKFL 3CVHB 5I75C 3T04D 4OCXH 1OT2A 5DJYB 1YNKH 4HIEB 2X1WL 43CAB 1A6UL 2MCPL 2AXJA 4NNYA 4I0CC 1Z6JT 2EIDA 1RZKL 1G9ML 2FBOJ 2IGFH 2A73A 3ES6A 2UZIH 3UMTA 3VDBA 4KKCC 2VZSA 1SM3L 3C6LB 1GZPB 1RUAL 5E4EB 5I76B 3SQBA 3U30C 1AXTL 3RWIB 5E8OA 4X7TB 2N7AA 1ZTXH 3IGAB 2MTPA 5H37H 3L3KA 3L3JA 3EO9H 3ARVA 4Y19D 2ADIA 5KSAA 3PGCB 3G6AA 3REWB 5I74C 4NNXA 4UIKL 3KPSE 3RWHA 5DMKB 1IEBB 1FNEB 1F4WH 4IRZL 1X5JA 3BJ91 3DURB 4LEOB 4LRIC 5SX4H 1DUYA 3SDAD 5DEFB 1PW3A 2AABH 4N5UA 3P9LB 1IGTA 2F8OA 1XIWA 4LPXA 1OT1A 3SKOA 4XPFL 1H3PH 4ZFFA 4F3FA 4HUXB 3OMZA 3ULUD 4X9FA 2OX5A 5F89B 4DN3L 5D1XD 4NQXB 5AWNL 5F7EL 5DMGC 1IGMH 4KAQL 5F7MC 5C07A 5D7KE 5GHWL 2H9GB 5E8NB 3GEWB 4G7VH 4CMMB 4HZAA 1CFQA 5HYSA 3TGXA 1Z9OA 2IADB 4KKBC 5T3ZL 2DJSA 5FEBA 1I7RA 4M9OA 4G42B 4M8VA 3IFLH 1PG7H 2ED9A 2PYEB 1I7TB 4QTHA 3RDTC 3O6FB 2QQKL 3L5WA 5EU6B 1G7QB 2CLVB 3GMLA 3K2UH 1H3TA 2YBRB 1CE6B 4GQPH 3CSYA 3AXLA 5DD0L 4PLJD 4GRLC 5HGBB 5DJ8B 2R69L 3HHRB 5I66B 4JG1H 2ZSVB 2EYRB 5H2BB 1NFIA 2PCPA 4NKIH 2DMKA 1JGLL 5DD5H 2WM0A 5C0AB 3MOAH 4JN1H 4W4OA 4FQLL 3CVIH 4OZFH 3W5NA 2DDQH 3CUPA 2O61A 5IMLA 1GSMA 3S5LA 5FB8B 3EDFA 3ZTNL 4DVRH 3IXTB 1NEZG 2JELH 4I13B 1AGBB 5HD8D 3O4LE 1NMCB 4XB7A 5KW9H 4K9EL 5ALCL 4XNXL 4PJDF 3VCLB 5H8DA 4NRYB 5DDHA 2EE6A 4ZAKC 4M8QA 2NXZB 3MFFB 1JZ6A 5CBAA 1G7MB 4P3DA 3B9KB 1FL6B 5F1SA 3IVKB 2W60B 3SE8H 4C54A 1YUHB 1FCCA 1VPOH 2CRIA 3MRKA 4K2UH 2C3VA 1PZ5B 2FSEB 1QUNA 4U1MA 1WGOA 2ZUQB 4P23C 2AP2A 3MV01 4ZO6A 5D5MA 4DEPB 3IDYB 3NCBB 2MHAB 4M00A 3RY5A 3O2WH 3BMWA 2F19L 5HHOB 3DYMA 4ZO8A 5D7LA 3RVWC 5FO9A 4X7EC 2JLLA 4PJBA 5FM8A 3U83A 5SWSB 1AXSB 3D39E 1GPOH 1KJ2A 2JCCF 1PQZB 5DFTA 1MHEA 1EV2E 4ELME 3MV9A 4BSWB 4F37K 4LHUD 2V2TA 5FDWB 4ONOA 5IHZB 5IBLD 2R0ZL 4WI8A 2H8PB 3BQUD 4HKBB 1IZJA 5D72L 1J8KA 4ZS7L 1ZE3C 2JCCB 3KDMA 3P30H 3M8OH 1CFNA 5GSRA 3MBEB 1PYWA 3VI3E 3VFMB 4MQTB 2YUVA 4JFYA 3GK8H 3HMXA 4ZG1A 3GMOA 3OAYH 4MDJA 5MEOB 1LEGA 1NKRA 1KPVB 5EBMB 5FKPB 3SGJC 3HFML 1NFKA 2WSKA 1T89C 4JY4B 3VXME 1D9KB 1T66D 3C6LD 3VFUA 5DD1H 5JORB 1TENA 5IMKB 1NMAH 3LSOB 3FO2A 4UQ3A 4KUZH 4P9MH 1S8DA 1TETL 5DS8A 1YMMB 4BQBA 2XZZA 4YBLB 4EN3D 4ZAKA 1P7KB 2LTQC 4G80A 5EC1B 5CD3B 4EEEA 5F9DC 5JLZA 4Z0XB 4K7PH 5IVZB 5F3HA 4ODSL 4YFLI 2QTEA 3MYJB 1I3GH 2NX5B 2BY3A 3RHWK 4QHKI 3SDDC 3OJMB 5IQ7H 3L7EB 3WIIL 3TWCH 4MQ7B 2FB4H 3FQUB 1UB6A 3ZE0E 3MOBH 4OLVL 2V17L 3IU3A 1BJ8A 4MJ5B 4LPWA 4OGAC 5C7XL 4H5SB 3Q6GL 4ZPTA 1B88A 1VDGA 3QXWA 3TT1L 4LAQH 3ZKXC 1G9EA 4PRPE 4Z7OE 4PJ5A 5J11B 4KFZC 1I3RB 2JJWA 2CGRL 3G6JA 4LLWA 5I15L 4JPVH 4P48A 1Q9OB 3ZDZE 1H15A 2PYED 3TO4C 1KCUL 4RAVA 3C9NA 4HWZA 3O6FD 1TCRB 4Q7DA 5FCSH 1CXFA 1WBYB 1BIHA 3GSVB 5MENB 1Q1JH 2AV1A 4XNUL 4QHMB 3JWDL 2Z8RA 4WFGD 1ADQA 3VXOA 3PWPA 5C3TA 2X4SB 4NN6C 4OGXH 4MQXD 1DP0A 3T4YB 1S9YB 2M8XA 2YUXA 3RFZC 3FT3B 5IJVA 2PN5A 3J7HA 4PB0H 1HILB 5EPMA 2DJ4A 1D5ZB 4JZJC 4F7EB 4OQ1A 4PRHA 2DLGA 3EFFB 5CAYB 4UI2A 4OZFG 5IBTH 1K4CA 2PUQT 3C5ZB 5I1JL 5B39B 4WWKA 2FJGB 5JHLL 3VMOA 3KPPA 4K8RC 2A6IB 1PY9A 1NAKH 4LNRA 3T1FA 2ITCA 3TBSA 5H94B 4P0DA 3MRCB 5B8CA 1JK8B 3D3VA 2NXZD 5EOCH 4WEUD 1S5HA 1IGFL 1KIQB 3SDDA 1RZIB 4HPYH 1UZ6E 4HUNB 4DUWA 4R26H 4CRPA 3BUYB 1FLTX 4WFHD 1V7NL 1YYML 4KKLD 3JWOL 2MQ3A 5DHXB 3KYMB 4P4RB 2CIIB 1JFQH 3FB8A 5EIIB 1LE5A 5KVFH 1FIGH 2R2HA 3NTCL 1ZHBA 2VXTL 3FCTB 3T4AB 4Q0XL 1EIBA 1MCPH 4GW5A 4OZ4B 3E6HA 3NCMA 3QIBB 5CCKL 2X2YA 2YA0A 1UH2A 1J12A 4FN0A 4PY8I 1DVFC 4JREB 3Q2CA 3K0WA 1CGUA 2AKRA 3WKML 2VMFA 5JQ6L 4OSUL 5SWSD 1T83A 3QT2A 4WEBL 4HC1L 4W81A 3TO4A 4GW4A 3BEWB 1QRKA 1YEDB 2BRRH 4FHBD 3DX9A 1B0RB 5TE4L 4AH2A 4HUVA 1G6RA 5I1GH 2OSLA 2Q86A 2QL1A 1QKZH 3MBED 5ICXB 5CILH 3HB3D 4RSVA 1T21B 1MOEA 1TJIH 4ISVA 4XVJL 1N6QL 5D7JC 5F71A 4JZJA 1DLFL 4URTB 3QFJA 3TBWA 5IR1A 4OUUB 3THML 4XXDA 1D9KD 4O02H 3IDXH 4G6AD 4X8JB 3CFDB 3NFNA 4HWBH 8FABA 3TNNA 4EQ2A 4OZIA 5KOVC 3MV7E 4LU5L 3TCXA 5HVHB 5HDQH 5FXCH 2ADIB 1CR9L 4ELKA 2ZZUT 5KSAB 2HA1A 1NAMH 2UVFA 1EK3A 2P5WD 3RWCA 5I1KH 3BDBA 3FRUB 3DRQA 4EUPG 4I9WD 5C0RL 1DUYB 2X89D 35C8H 1BVLA 1MFNA 5IT2H 2HMIC 4Q9QL 3F7YA 1J1PH 3KPLB 2FIKA 1IGTB 3O6MH 5CP3A 3QUZC 1BQLH 1XIWB 4EKXA 2Y5TB 5FYJL 2ORBL 4OZHF 1I1YA 3FB6B 1BOYA 1FGVL 4PG9A 3BP6A 1RZ7H 4ZFFB 4NC1C 3BD3A 3TA3A 4WW1A 1FH5L 5C07B 2C3GA 1JWUA 2D0HA 3QDGD 2J4WL 4YHZL 1CFQB 1LO5B 5HYSB 4KK5D 5E5UB 4BFBD 4KHXH 4XNQA 1LEIB 1QSVA 5I71C 1N5AA 4PTTA 5L2KD 3DHJA 3VFRA 5C0BB 2XRAH 2G5BB 1URLA 5I75B 5DZNA 1OM3H 1NC4D 5D93C 3S98A 1QLRA 3NN8A 3CXDH 1JVKA 1OP5K 3GMLB 5MEND 3ET9F 1KGCD 3QRFM 2DQGH 3D1MC 1S7XA 3QQ3B 3CSYB 3O3UN 4UNUA 3IJYA 5E2VL 3AXLB 2W0KA 1MRDH 2WIIA 4FQXC 1HHJB 2GITA 4HFWA 1CIDA 4WY7L 5JPNB 1N5YH 3UROR 2W9LA 3MLSL 2PCPB 2K3TA 2APWA 4YXHH 1BJ1H 5JR1L 4OCYH 4OTXH 3V9FA 1T1WB 3EYSL 1T2XA 3K8KA 3P9MA 3U30B 1MFEH 2HFFA 2F54E 1P1ZA 2ATPA 2QSCL 5A40E 4OZGE 4JJ5A 5EUKB 1CF8H 1MFDL 4LSTH 1GIGL 3LKRB 4HCRH 5I74B 2E7MA 2YD8A 5DGQA 3BKYL 2DBJA 4JM2A 4LCWB 1P5UA 4D94A 3OKKB 5GS0C 1OAKL 1CL7I 1QEWB 4HIJB 5CBAB 4AJ0A 4IDJH 3T3MF 4P3DB 3PGFH 4X6FA 2ZCLH 2WUBH 4RFNC 3MJ8A 1KJ3H 3MRKB 2C3VB 3G04B 1ERNA 1PFCA 3SGDI 4U1MB 1U3YA 1LP9E 4Q9BA 4Y4HD 1W8NA 1I8MB 4POYA 4TOYL 1N2RA 2FD6H 4CUCA 4ZUTB 1CGSH 1W0YT 4UDTA 2IPUG 4XPBH 1Q0YH 5EU3B 1P69B 1IAIH 4X6DA 3QIBD 4LF3A 4Q74A 1U36A 4AY0A 4WO4D 2EICA 3QEGH 3VI4E 4N0RA 2GTWA 5CS7A 3S37X 1R3HA 2I60H 4QLRA 5K59F 3IRPX 2QEJA 4QWWC 1KT2A 1LGVA 5I19H 2VLME 2XFXB 1IC7H 3MV9B 3P3YA 3OG6B 3BPNC 4NWUH 3RDTB 2DL9A 5D5ME 5FM5M 2X70A 1FFOA 1VA9A 4N8PA 3EOTH 3ROOA 1CFNB 5E1AA 5GSRB 1PX4A 1XH3B 3CPLA 5L6YL 4RAUA 3GM8A 1CDYA 3GSNH 4JFYB 1EAJA 3GJEA 1X44A 5D7LE 1D6EA 2FX7H 4G9DB 1AFVL 4J8RB 4PJIA 1I9JL 1LEGB 4UNVA 4OF7A 3LPFA 3AREC 1ROWA 3QEHA 4GO6B 4AEIL 1FLRH 3E8UL 2PTUA 3PHSA 4NN7C 1N4XL 2YPLA 2ICCA 2A6DA 3X17A 4UQ3B 3K7UA 3CFEA 4PRDA 2J6EA 3BAEL 3F58H 5DS8B 3X3GL 3MLXL 4BQ6A 3D9AL 4CJ1A 3SN6N 4ZAKB 5D7IE 3NACH 3OB0K 2VWEE 4RBPH 5GXBB 1JV5B 3QIUD 3MPCA 5BQ7A 2IC2A 4JFOA 5JHDB 5J7CC 5T1MA 2WBJA 3RUGE 4GUPB 3TCLA 5BJTA 2EDQA 1FNSH 1AXIB 1RUMH 1UB6B 5EOTA 2A77L 4P2RB 4CGTA 3VXQA 1AE6H 3IU3B 3L5HA 1T7ZA 2OR8A 4NWTH 5ENWB 4PGDA 2DQJH 2EKJA 5CIPH 1UWEL 4RZCB 4HKJA 1UB5A 1EJOH 4PJ5B 4R0LC 3GSNB 5T1KB 5JZ7D 2NY2C 3UTZA 4LLWB 5CJBA 1ZT1A 4L4TB 3BDXA 2IBGA 5C0JA 5IG7A 4RAVB 4GLRH 5C0BD 3DJ9A 3B6SB 4UQ2A 5TPWH 3ZO0A 1MWAL 3ABZA 2VXVL 2DWDA 2XG4A 3WBDA 1A3RL 1ES0A 2W07A 4J6RL 1TVHB 5F7YC 4ZXBC 3SDXA 5IV2A 3VXOB 1F11B 5IJVB 2J12B 2AJSL 4NZJA 1FE8L 1DANT 4ZTPH 4KKCD 2GJJA 4DAGH 2HFGH 4JY5H 3I2CH 4EI6A 4KRPC 1W72A 3SDCD 2Y7QA 1CICD 2X4RA 1XGTA 1GGCH 4YPGB 1DBML 2VISB 3L5XH 3WIHL 4OQTA 1UKSA 1YC7A 2KQMA 4YC2C 4XMPH 3WLWC 1WFNA 3QCVH 3T1FB 4MNQE 2ITCB 3TBSB 4LCWD 3PWPE 1II4E 3D3VB 1GGIL 5KTEH 1S5HB 4DFIA 2I26N 1M7IA 3QRGL 4EIGB 4V2BA 3SDDB 1HWHB 3DX8A 2CDFA 3QG7H 4K3DH 4PTUB 1IFHL 4M6OH 5T3XH 3IFOA 4MYWB 3FB8B 4K8RH 2B5IC 3EYQC 2KDGA 4YXLL 2R2HB 5C08A 1KLGB 1QZ1A 5DMGD 1D5BB 5I6XC 1RFDH 4Z7WE 4WTWA 3ZKXB 2APFA 4WI5A 1AIFA 4WDIA 2AKRB 4LGPB 2KUTA 4TRPL 1I4FA 4EVNB 5JUEL 3CK0L 1EEZB 2R2BB 4NKOA 3VXSA 2I9LA 1U93A 3TO4B 4GW4B 2DLIA 1RI8A 3LHPH 1QBLH 4MZ3A 1K4DA 3RDTD 4U6VL 5FYLE 5KOMC 3DX9B 5A2KH 2DM2A 1BMGA 1NL0L 3NOIA 3C5JB 4Z7VF 3KNBA 1T6VN 4HUVB 4GKOA 1AGCA 2OSLB 2Q86B 1MFCH 4UU9B 1MCEA 4ZXBA 1HNGA 1TTGA 4UNTA 4GRLD 3AFLA 4NN6B 1AQDA 2VC2L 3H0TA 1MQKH 4JFDA 3UYOD 3HNSH 4ISVB 2FGZA 3GUTB 5C6TH 2OR9L 4JZJB 2H1PL 4XCFL 4X80L 5F8QC 4C56E 2J8UF 5FM5O 2AJXL 3RZCC 3NFNB 3QDJE 5EORH 2C4FT 1SYSA 4HXAH 2DQHL 4PJXA 5LKNA 4OZIB 3FFCA 4RWYL 5I17A 3QO1B 4X5XA 4N0UB 4FQJL 1JHTB 4ZFOB 4ELKB 4RMVA 1WISA 4MAUL 3NAAL 3WFZA 1JNLL 25C8L 4M6NH 3SOBL 1GZQA 2VLRD 4YHMH 5JW5A 4V2CB 8CGTA 2W9EH 4GG6B 3F7YB 4QYOA 5JHDD 3FT4A 3RY6A 2FIKB 3MUGA 4PJFF 4UDUA 2EEBA 1CQYA 3U0TB 2D0FA 4L29B 4HS3A 4P23D 2X6MA 4P5KA 2DJUA 1I1YB 3CLEH 4PG9B 2JIXB 2IF7A 3MGOA 4P2RD 2VERN 5C0DA 2R1YB 1WFOA 2HWZL 4LSPL 2WMPA 4QF1B 4WW1B 5DO2C 4BFEA 2GI7A 1DVFB 1WZLA 1EJ6A 1XT5A 3ULVL 4YBHA 3BKML 2ZKHH 3RVWD 3W0WB 1ZANL 1IGCH 4IHOA 1J05A 1WJ3A 2IG2H 5I8EA 3UTPE 1JPGB 5T1KD 4XNQB 1UH4A 5BV7C 1A5FH 1I3VA 2NYYD 1N5AB 1U8PA 5FGBA 3OXSA 3O81A 4L4TD 1E4WH 1K8IB 4PTTB 5FGCB 5C0CA 3VFRB 3C5SA 4K07A 4NFDA 5INDB 4XBEL 1A0QH 4X5WA 1L7IH 3JSSA 1E4KC 2AGJH 5LBSL 4KQ3H 3C08L 1F6FB 3IJYB 4HUUA 3F12B 4MJIE 4U6XA 1UH3A 1TQCC 2GITB 5HVFB 4KKNA 5D7JB 1NUGA 1F4XH 4XHQA 4HX1A 3QDMB 1XF2A 1DLHA 4KJYA 1P6FA 1F4YH 3ARBA 4HS6A 1KCRL 3EJZC 2GCYB 3I6KA 4P59L 4XNMB 1KEGL 5GGVY 1T04A 4OIIH 3VXRD 1XGPA 2IANE 3IDGB 4UUJB 1P1ZB 1EO7A 1EAPA 1HKLL 2BC4B 2ATPB 4W6XB 1SHMA 3KYOB 2EDXA 4Z8FL 5B3NA 4MD0B 5I16B 1CFTA 4P2QD 4JFEA 4JM2B 3K80A 4S0SD 3IKKA 1M71A 5GRVL 2HG5A 3BP4B 3PGDA 2BY1A 1T0MA 1HE7A 5FF6B 4NO5A 3EGSB 3QUZB 3HI5L 4CU8A 1MF2L 4DQOL 3FO9A 1TXKA 1OAQH 4PYGA 4A2MA 4P5TC 4R4NC 1N2RB 4OGAD 5K9QG 1L6XA 1NFDF 3EFDH 4H1LA 4X6DB 4LF3B 2R9HC 4YHPB 1UT9A 1QSFB 1ZT4A 2Y9RT 3BO8B 4Z7QE 1MH5B 3G5XA 2GTWB 1C12A 1AKJA 1R3HB 3I02A 4PD4J 2VXSH 1KB5A 3ZT7A 1G7JA 1C8PA 2AJUL 1BZ9A 5I71B 3UC0H 2AJVH 4TUJA 1D5MA 3MRJA 4XCEA 4ONFL 5BZWA 3FQWB 5FGSA 1FO0H 3NZHL 5EBLA 3VH8A 5GJSH 1GVIA 4HJJL 1F3JA 1Z9LA 1B0GB 1VEMA 1ZA6A 5BZDA 5T1DH 1V5JA 1J1OL 3DGCR 5HHXL 3CZFA 3RX7A 4FQXB 3QDAA 5GGRA 1ETZA 1ODAA 3VD5A 1U9KA 3PABA 1IM9D 3H3PH 4LFHG 4F9LA 2ED8A 4NYLA 2CRYA 1WBXB 3KLSA 3ULUL 3D0VA 3WEXB 1FL3A 2J7LA 1HQRB 2VR4A 4UTBL 3OAZH 4LSVL 3TIEA 4M9PA 2FJHB 2YPLB 1JTTA 3IXAA 4HEME 1S7RA 2CSPA 2VN4A 3SCMA 2VE6A 4PRID 5DJCB 3CFEB 2FHCA 4PRDB 3T0EA 1FV1B 5T3XD 2QHRL 1XGYH 4KC3B 3ARSA 3HE7C 3WXVL 1U41A 4K8RD 4QHNB 3UYRH 3OKNB 1QFUH 1FDLL 3EOYG 4PGBA 2EXYC 5JXEA 3QI9C 4NO0A 3H2WA 3BX7C 5HDOA 3RWGA 3VWKC 1WEJL 4NFCA 5BQ7B 2OL3L 1MVUA 4JFOB 1ZLVH 1T2QH 2WBJB 5C0ND 3UTOA 1B6UA 1JGEB 3TM6A 1FO0B 1HIMH 3OX8A 3P0VL 4NCC1 2BJML 5EOTB 1UZ8A 2JIXD 3VXQB 2Q87A 4M61B 1QLEH 1JPTL 3RVXC 3TBTB 5CZXD 3T08A 3EYVA 4PGDB 1QOKA 4HIXH 1DVFD 4PBWD 1UG9A 3REVB 3IB4A 3W0WD 1CLCA 1T20A 4TYUA 3LKSA 3UTZB 4QTIL 4NUGL 2EYTB 2ARJA 3A6CH 3GSUA 3TBYB 3KPNA 1ZT1B 3BPNB 4MCYB 4ODUA 2OLDA 1MRCH 5GGQL 4JHBA 1FZOA 1XF5B 4W68A 4JCMA 4DGVL 4GAGH 4KDTA 3MRNA 3ESUF 1NBZA 3IDIB 5JOPD 1A64A 1I7UB 2DWDB 2XN9E 3O3DA 4N1EA 1JRHL 4WHDA 3T2NL 1I8KA 4RX4D 3SDXB 5IV2B 3ARGC 2VZ1A 4JQXC 5D7JD 4DZBA 4Z7UE 3AREB 3R4DA 1KG0B 3RKDD 3QDMD 1F4HA 1X7QA 3N9GL 1NGYA 1RK1A 3OAUH 4D9QE 4YZFE 4NN7B 3CMOH 2APXA 4O2FB 1JL8A 2YRZA 2H45A 1A4KA 1F97A 1ACYL 2X4RB 3B8YA 3IYLW 1A1OA 3HG1E 4YEFA 1FNLA 2EDOA 3WFBL 2VDNH 1EHLH 2MQ0A 4UILL 4GG8B 2IQAA 2V7NB 5I8CA 2NY3D 1SYVA 3EZ8A 3GDBA 3P4NA 1OGAB 2P48B 5HVWA 3K3QA 3IFNH 4UIMB 5D1QC 4KQ4L 4BQ9A 5A3ID 2HMID 3CVHL 2ESVE 1M7IB 3HUJA 2OYPA 3VG0H 5DEGB 1R24A 3QUZD 3DVGB 1IJ9A 4GAFB 2CDFB 2P7TA 3LS5H 4OM1H 5BW7A 1FBIL 3X13B 3NABH 3ARQA 3IFOB 5I1IL 4JO4H 5JA9A 1GCFA 1MI5D 5EOQH 2YD5A 1O5DT 4JRXB 3BKJH 3MRHB 3TT3H 1RHFA 4YFLF 1X9QA 1QSFD 4XMLL 1AIFB 5C9JB 4R0LB 4CVZA 5DJZB 2P44B 2LVCA 1V8HA 4OLUH 4P57A 5IB2A 2C1OB 4XCYB 5EO0A 5HYQA 3KPRA 1IKFH 1U93B 3A6OA 3P73A 2V9QA 1VFUA 1EBPA 1AQKL 4B7IA 2C3HA 2YS4A 1QSEB 5C08E 1MFAL 1U8KB 4MXQC 1KN4H 1HSBA 4KI5E 2P43B 3LN4B 2UVEA 2W38A 4ZXBB 4ZO7A 3C60C 4FQXD 2VWEC 2BDNH 5CSZB 4JFDB 4U7SA 1I1AD 4Z95L 3L3OA 4JO3L 1NCAH 2R8SL 3D2UD 4NSKB 3VWJC 5K9JH 3RPIA 4PGCA 2QQNL 4KRPB 4Z0BH 5EH1A 4BUHA 1LO3H 1KOAA 3HPJA 4ZYKA 3WFDL 5IBUG 3WS6A 4GH7B 3EYOB 5I17B 2VDPH 3OKDA 4YC2B 5LCVH 4ELMF 2EO9A 1WIOA 3Q0HA 3Q3GA 5B4MC 5D1QA 2UZIL 4MXWL 5GRJH 4M5ZH 3BDYH 3D39B 4XHJC 5JW5B 4NO3B 4TN9A 3VI3F 4ONGH 4QYOB 4FFWC 4M62H 3MUGB 1ZAGA 2X7LA 4UDUB 2DWEA 2P5EE 4RGNE 4P5KB 4N0YH 3NBNA 2B5IB 3EO9L 1CFSB 5MP6L 4PJXE 3ZKMC 5C0DB 1ZHNA 1CGVA 4OLWH 4NQEE 5I1EH 4RNRA 4S2SB 5I6XB 3S3SA 2Q7YA 1U2HA 1F4WL 5IIEB 3BYTA 1IEHA 2BNQA 3SE3C 2R2CA 2XZAH 5IEKB 3MZGB 3NCCB 3VFWA 3L6FA 1XCQB 1CQKA 3TPUA 1C5CH 5F6HJ 4ZOAA 2PW2B 5I8EB 1F3DJ 4Z7NF 4QWWD 3RIAF 1KPUA 1VERA 4OD1H 3VXMB 1DL7L 1U8PB 3I6GA 3TESA 1H3PL 3UZEA 1JGUH 2A1WL 2FH6A 3O8XA 4OGZA 3WL9B 1F00I 5ELIA 2DQUH 2DRUA 5EU7E 1IGML 4X5WB 3VGDA 2PXYA 5IVXA 5FUOH 1ZSDA 3QULB 5DD6B 3HAEH 1OTUD 3C60A 4TTGA 3KPSD 4PJAA 3HZMA 5BV7H 4B41A 1NSNH 4XPAH 4HGWA 4CU6A 5IJKA 4HD9A 3DO7A 1NGXA 2JB6A 4U1JA 4LCCC 2I27N 3ZE0F 3P4MA 4S1RH 4HT1H 1PG7L 1P7QA 3ARED 5CGYC 3UYPA 3W81A 2VXQH 1XF2B 4H8WH 5DRXB 1DLHB 3VWJA 4KJYB 5HHPA 5C71A 2Q8BL 3ARBB 4HS6B 3I6KB 1EDQA 3RZCB 2A83B 1FPTH 4FG6C 1G7IA 4Z7OF 3K2UL 3DROB 3BHBA 1HYSC 3MJ9H 1XR8B 2RQ8A 2YRPA 2XPGB 1RURH 3MJ6A 3ZDZF 5ICZA 5D7KD 1KTDA 4PP1C 3TN0A 4JFEB 2O5YH 4JG1L 5E2UH 4HGKC 2R15A 5C3LD 1I75A 1RIHH 2HG5B 3GRWH 4NKIL 5DD5L 5HYIA 4NQSA 3MOAL 4JN1L 4YHLH 3L1OH 3W11C 3CVIL 4BH8A 4OCWH 1T0NA 3D87B 5B38G 5EO9A 4HULB 3LZFL 1FNGB 4X7SH 2DYPD 4G9FA 4LDEB 4Y8DC 2YEZA 2F8VA 3FO9B 1GL4B 3K4AA 4DVRL 4OT1H 1BQHA 1I8IA 4NGHH 2JELL 5GISH 5DWUL 2GJ6A 4HIIB 2H6PA 3MLVH 5KW9L 5GGSA 4JRXD 1H8OA 4ORGA 2IALA 4YBQC 1ZT4B 1SJEA 2DQIH 3L9RB 3STZB 5DEZA 3G5XB 4ZMAT 1C12B 3SE8L 2D03H 1VPOL 5BV7B 2NY2D 4K2UL 1G7JB 1BIIA 1D5MB 3MRJB 4Q2ZA 4TUJB 4XCEB 1WTGT 5FO7A 5BZWB 4QXUH 2ZCHH 5LGJA 1G9NC 3I9GH 4L8DA 5EBLB 3T77A 5INCB 1F3JB 1ZS8B 1ZA6B 3O2WL 2QSTA 1A7PH 2CIKB 1QSED 3O4LD 4WUKL 1UZ6F 3CZFB 3RGVA 4XP6H 2XWBA 1CL7H 2BFVH 4NHUA 1TQCB 4LCCA 3HZKA 3O9WC 5GGRY 2CK0H 1GPOL 1UGNA 1WVZA 3HS0B 4UB0H 4NYLB 2O5XH 4WTXA 4U1HB 2V6HA 3VD4A 3D0VB 1YPZA 1FL3B 2AXGA 3SGDH 4O5LL 1NCTA 1MAJA 4KRPD 1U8NA 4GBXC 3IXAB 4KUCF 5AAMA 1E28A 3WIFA 1TPXC 1HQ4B 3GK8L 3WLWD 4MNGB 1RUQL 4PRAA 1PDKA 3JWDC 2UV3A 1Q9WA 4LPUA 5F96L 5HVGB 4PGBB 3T0WA 3W39B 3F7PC 2XZQH 4NO0B 4Y2DA 4U0RB 3RWGB 3D39D 1X6LA 1F45A 3O2DH 2ARWA 5DD1L 1JHKH 4N5ED 2A0LC 1NMAL 3L3DA 4DJMA 2BHUA 4KUZL 4P9ML 4P5TB 1C7TA 1EO8L 1LHZA 1UZ8B 2A74A 4ZOCA 4LCUB 1AP2A 2OXHA 1JYXA 4OIAA 3UDWA 3IS1X 3ARYA 1FVEA 4TUOB 1YEIL 4Z5RA 1ZLUK 1OAXH 3LKSB 3D0LA 1HHGA 15C8H 3DIFA 5IQ7L 1YMHB 2BCKA 1OQXA 4X6BB 3VXMD 2FB4L 3D6GA 2DQEH 3GJFH 3KPNB 4GRMA 1T5XB 3MNWA 1MIML 3MOBL 1MCOL 2V2WA 4HK3J 4XXCA 4PV8B 2XQBH 2OJEB 3ZL4H 3FTGA 4JO2H 1HN1A 4E42A 5F88A 2GSIA 2PETA 4WW2C 4JR9H 4L8CA 2UWEE 2PNDA 4KVCH 1G0DA 3OWEA 3QZWA 2ZUSA 2J1KA 4JPVL 4DZBB 3U9UA 2VLKE 2ZOLB 1X7QB 1BGXH 1KXQE 1RK1B 4U7KA 1PKOA 4GBXA 2B0SH 1IVLA 3RZCD 1A6ZB 2F58H 4NRZB 3BD5A 1A4KB 1TFHA 1RZ8A 1Q1JL 4PP2B 2BSRA 4X4MA 1U91A 1A1OB 3U6RB 4EZMA 3HE7B 5ISZA 4G6MH 2OMNA 5HY9A 3CDGA 3DI3B 1A6VH 4PRPD 1D3CA 1I9IH 4UOW0 3QI9B 2X4UA 4PB0L 3VWKB 3AY4C 3PDGA 1YEEL 2E7CA 5IBTL 2R0KH 2Z31A 2P7TB 1DQTA 3P4LA 2EKSA 3PG2A 1MLCA 5E03A 3GJFB 1BPVA 3G5VA 4D0BA 2HKHL 1NAKL 5K9OA 1IAKA 1AO7B 5DO2D 3WLBB 5EOCL 1Z3GH 1XCTA 1MY5A 3QNXA 4G43B 2GAZB 4S1DC 2VAJA 4R26L 2FHFA 5EO0B 4OZGF 3HUJE 5HYQB 2OJZH 3KPRB 2IAMA 3OZ9H 3K74B 1JFQL 5C0IA 3QPXH 2F54B 1CDUA 1FC1A 2FEDD 4KZEH 1SMAA 3DECA 2Y5EA 1F6AA 5A2LH 1H3XA 1MHHA 2WNGA 1DR9A 2PO6A 1HSBB 4E41E 1U3HD 1LP9F 1FN4A 2VIRB 3ARGB 5B3JE 1WQVT 4NKMA 4DVBA 4WHTB 1D7FA 3L7FA 2BRRL 4HC1A 4J3VA 3RPIB 4PGCB 1TJGH 2ZCKH 4YO0B 4HKZB 5DGRA 4U1GC 3VI4F 1C08B 1MAKA 4ZYKB 4U6TA 3MX0A 1R3KA 1NUDA 2DM4A 4L3CB 1MJUL 1NCDL 4I18A 4LLMB 5MHSE 1AR1C 3KYNA 4UOW1 3QDHA 5CILL 3HMXH 3VFOA 1LWRA 3DMMC 4GFTB 3ILPA 4J1UA 4G8FA 1TJIL 1DQQA 4KUCD 5D5MF 1X5YA 2R0LH 2BVPA 5D1QB 3JV4A 5L7XH 2RGSA 3MV8A 2MFNA 3CFBB 4O02L 1F2QA 3IDXL 3D18A 1H0DB 2VZUA 5E6IA 4F7MA 3QEUB 5IROC 4I2XA 2L0DA 1DBJH 2X9YA 4P5TD 3KPTA 5FOBB 3JTSB 4OV5A 5C1MB 5L2JA 4R4ND 2OZ4A 5EOCJ 1XZ0A 4RNRB 5CINH 5EUOB 3SQOL 3J8F7 5I1KL 3BZDA 1XFPA 2N1KA 2MPAL 4IM8A 1OB1A 5DTFA 1B0WA 1M7XA 1R5IA 35C8L 4LIQE 1J1PL 5CKGA 3O6ML 1BQLL 1KPUB 3UO1H 4TSBH 3LQAH 2DB8A 2J88H 1PGRB 3U7YH 1RZ7L 3O8XB 5IM7A 5D7IF 3KXFB 5C09A 3RPKA 1V3LA 3MV7D 1GJIA 2COQA 2PXYB 5IVXB 5AEAA 4XTRD 4KRNA 3DUHA 3RUGF 3C60B 5FKAB 1H3VA 4OFIA 3G08B 4LASL 1J86A 1SVCP 1PSKH 4HGWB 3GIVA 5FA4B 1KB9K 1NGXB 2JB6B 1MCFA 4ZOBA 3MC0A 3P4MB 1AI1H 1S5IL 1P7QB 4WI4A 4XBGB 3VWJB 2EDEA 5HHPB 5J6HA 4RMSA 1Q0XH 3TYFA 1OM3L 3TO2B 1BFVH 1HXYA 4TUKH 5J56B 1V7MH 1Z9SA 4U1KB 4KVNL 3CXDL 1FVCA 1NGWA 3HC4L 1NMBL 1W0VA 1WWWX 5BRZA 5DJAA 5E70A 2DQGL 3WN5C 1JUFA 5A2FA 3HE7D 4DKAA 4LCIL 4LL9A 1MRDL 5A2IH 5ICZB 2RHEA 1T5WA 3FO0H 3V0AC 3TN0B 3LIZH 3S4SA 2EXYD 1P4IH 2BVOB 4HH8A 2A38A 2NY6C 3QI9D 4YHNA 4F9PC 1XMWA 1N5YL 4YXHL 3VMPA 3VWKD 2R1WB 5T3ZE 2QR0A 4OCYL 4OTXL 2H2SD 4BH8B 1T0NB 4LPVA 1MFEL 4MJ6B 5BS0E 3LRSB 3G5YA 3S5LG 4XVUC 2D31A 1BQHB 3KR3H 3VGEA 1SEQH 1BREA 4PJHA 2YD3A 4LSTL 5F9OH 5EDXA 4HCRL 3ARRA 1E4XI 1IGYB 3OGOE 4WV1C 3DO3A 4ORGB 1G7HA 5D1ZC 1KN2H 4GXVH 1SJEB 3MLUH 2ITDA 3PGFL 3O4OC 1HOCB 1NANI 5F6IC 2ZPKH 1KJ3L 1C5BH 2P8LA 5IW1B 2OBGA 5FYLH 3NCJH 4HPOH 4QXGH 3PWJA 5LGJB 3R8BB 3K4DA 1BD2A 2F54D 1IT9H 2FD6L 1CGSL 4KRLB 4XPBL 1IAIL 2GJ6E 4HK0A 4CADA 1MCWM 5DK0B 2CRMA 3BE1H 3QEGL 4RRPA 4I3GA 4P3WA 4MNQB 2AK1H 4LGSB 3HN3A 3X14A 3WD5H 3FT2B 2XWBB 4NHUB 4LCCB 4JZNB 3ARGD 2I5YL 5I19L 3SKNB 4Q9CA 3QIWC 1G9NH 1IC7L 4JDVB 2P8MA 3JXAA 3UZQA 1FAIH 4NWUL 1YPZB 4APQA 5CD5D 2CUMA 4Z7WF 2EH7H 3PHQB 4RGNC 3EOBA 1U8NB 3H9HA 1IKNC 1ULVA 3EOTL 3FN0H 3DV4B 5C0EA 3QR2A 3LY6A 4HAGA 2FR4A 3GSNL 2FX7L 4JKPL 3V5HA 3JTTB 1BJ1J 4HWEL 4EBQH 4Y4FC 4YX2H 4PRAB 4OFDA 4UT9H 1Q9WB 1BBJA 1K3IA 1PKQA 4G8EA 4QCIB 3P0YH 4JGMA 1RAMA 4JQVC 1FLRL 3RNQA 2VLMD 3SY0A 3PV6A 3L3DB 2HVKA 4DOHE 1AJ7H 4XH2B 3F58L 2GIYA 3M1BA 4H0IA 2SEBA 2FBJH 5EIVA 2A74B 1TZHA 2DL2A 1AP2B 3IF1A 3HE6C 1ZA3A 5JW4M 3QXVA 5D7LD 1FVEB 4JG0H 5HYJA 5DJ2A 3OJVC 3D0LB 1HHGB 4P2CG 3UBXA 3MACL 3B43A 2BCKB 4R96A 3OHXA 1RJCA 1RUML 4C56B 2H41A 3U2SB 2HYMA 3BN3B 4PGJA 2FIRT 1KB9J 3FTGB 3C2SA 2DQJL 3MRIA 2HLFC 3FB5B 4CVWA 4WU7A 4XC3H 4F37F 5IHUH 2OM5A 1EBAA 4MXQD 4E42B 1A7RH 3B9AA 1EJOL 4OFYD 4G8IA 1LO0H 2LE9A 5ANMB 3ARDC 3O9WB 3GSXA 1EA9C 4RMUA 5EULV 4FFZH 2NCMA 2IBBA 4HJ0C 5HI3D 1C1EH 2HT3D 3TVMA 4F7TB 2KH2B 3UTTE 2HJLA 2OTWB 1IKNA 4GKNA 4GBXB 4M48L 5TPWL 1GGBL 5L88H 5DVKA 2J2ZA 1QLFA 5HHME 1TPXB 1U91B 4O4YH 1Y6NR 1MWAA 5DRNA 5ISZB 5TDOA 4CNIA 1BM3H 2X40A 3QWRA 3CDGB 3UCRA 4M1GH 5DJ6B 4AENA 3BRFA 5B4MD 2D2OA 4M7LL 1BQSA 3V4PH 4MX7A 4ZTPL 4ZUUA 4CBPA 3C87A 4JQVA 4XHJD 5GGVH 3V7MA 4DAGL 4JY5L 4QRPA 2F15A 1FRGH 2XY1A 4FFWD 3WS3B 3H42H 4FQQA 2F9BT 4PREB 3PQYA 4XB8A 2YN3A 4E9LA 4PV9A 1GGCL 2Z31B 3VFTA 3CU7A 2EKSB 3MMEA 3OSKA 1MCBA 4NZRH 3ZKMD 4D0BB 1RHHA 3F7VA 3RHWF 2Q76A 4R7NA 5JO5B 2E8YA 3WIHA 3QCVL 4NJAH 1IAKB 1LD9B 1QRNE 5IUSA 3OR6A 2FLBT 4FXKA 1DEDA 4BQCA 3CNKA 1JTOA 1I9RH 3S37H 5DD3H 3V5DA 4I5BA 4QOKA 4I48B 3MLWH 4K3DL 2IAMB 2YK1L 2IANB 3M17B 4K8RL 4QRRB 4ZFOL 2HH0H 3BZEB 1DQLL 1RUPL 5MEPA 2B20A 1F6AB 1MHHB 5IW3A 3W2DH 2PO6B 4ZTOH 4WW2B 4IOSD 4MNQD 3PWPD 2AEWA 2AV7A 1KV3A 3BW9A 5I1AB 4NQDE 5SV3A 1J87A 2EDDA 4DVBB 3LHPL 1QBLL 3S35X 2APBA 4N8VG 3K2MC 2EIEA 4HV8A 2CKNA 3IAGC 4Z7QF 1IM3A 2FDBP 3FQNA 5HI4C 1BFSA 1HYSD 4YDJA 4G8GA 4RDQF 1MFCL 2BVUA 4NOBA 1TJHL 1P4BH 4N90E 3CFKA 3VFOB 3LDBC 1KELH 4MNHB 3ILPB 1M05A 3IJHA 4PP1D 4WVRA 1MQKL 4G8FB 1LE9A 43C9A 3HNSL 4BFIA 1R3IH 4MZ2A 5C6TL 2YRLA 1OL0A 5E08L 3W11D 2BVPB 3JV4B 5KSVB 1NC2A 3VFPA 2H32A 1S7WA 4L8SA 1UQSB 4RQQA 1OPGH 1OW0A 4HXAL 2EDFA 5FYLD 4I2XB 4YE4H 3P4OB 3U79A 4RMRA 4L3AA 5L2JB 1EGJL 4LLVA 4X6EB 3TIDA 1XZ0B 4CN6A 3U4EB 5E2WL 3W9EA 4YBQD 4YFDB 3WNMA 5KANI 4M6NL 1OB1B 1HDMA 5DTFB 1EVUA 4JQIH 1AGFA 4WFFE 1R5IB 4D0CA 1OD7A 3QG6A 3MV8E 5F72S 2Z0BA 5EN2B 1TTFA 5D2LA 4N0CC 4OLZH 3IU4H 3CLEL 4C56D 1AY1H 1BAFL 5IM7B 1FL5A 3QDJD 2IPTH 3BWAA 2X4OB 5IMOB 1J88A 4HDIB 3DV6B 5KVEL 2AK4A 1U6AH 1UA6H 3UPAA 2QQQA 3SKUD 2ZKHL 2BNRA 1ZWIB 4KTEH 4ZDHB 1IGCL 1DUZA 1KTLA 4OI9A 2IG2L 3GBLA 3JWNC 3O9WD 3KAAA 2C1PB 1A5FL 4KMTL 1CG9B 3CDYA 32C2A 3LKPA 3DWTA 2FJFA 1E4WL 4N0FB 4NQVA 3AAZA 2XTJE 4OGYH 1VGKB 4L4VA 3H7BA 3TYFB 4U1GB 5TE7H 1QYGH 1A0QL 1FVCB 2AGJL 4KQ3L 3CLFH 5BRZB 5TF1H 5DJAB 3DUSB 3DMMB 2LU3A 1JUFB 1OSZA 5JTWA 1JPFA 1OQOA 3AM8C 1MEXH 2ICEB 3QISA 1INDH 3MJGX 3SDAC 5GS1A 3MV11 3S3JA 1F4XL 4ACPA 4YHNB 1JN6A 3UTPD 5HSFA 4L3EB 1F4YL 2VABB 4Y16A 5DQ9B 3U4BH 4OIIL 2BY0A 4HJGB 2BVEA 4JDZB 4U1IA 3KS0H 5D1XC 2D31B 3A6BH 5DI8A 4OQTH 1RZJH 2XZCH 3N1QC 3DVNA 3SJVA 3MGTA 4PJHB 4Z7UF 3VXNA 5ESQA 5BVPH 2XN9B 1ZHLB 2EIZA 2CJUH 1HKFA 2CDGA 2FEEI 2R56H 3OR7A 1T03H 4YZFF 1G7HB 1MFBL 1X5LA 4MJID 5I9QC 4RDQG 3U36B 1XGRA 5JW4N 1D6VH 1QVOA 3ZDXE 2NNAA 5AAWA 1NBYA 4YHYC 3PWJB 1RJYA 2IAND 1FYTE 4Y4KC 1A3LL 3NZ8A 4HKXB 5GS0L 3EFDL 4K3HA 4HK0B 4O2EA 5KG9A 2D7MA 1DEEA 5ESAA 3X14B 2VXSL 4PJGA 3UC0L 2AJVL 1QFPA 3NFSH 4H20H 3AGVA 3T8XA 2V2XA 1FO0L 2RCSL 4MMXC 4PB9L 5GJSL 1RZGA 2P8MB 4PPTA 4P46C 3BPCA 3QHZH 4PJEB 1UM4H 3L3IA 5T1DL 4Y19A 3EOBB 5DMIH 4YR6A 1BD2E 5C0EB 4QHLB 3WN5B 5KS9E 3SBWA 1Q9LA 3K1DA 1IRAY 4P5MA 4Y5XC 2FR4B 3S8WA 1G0YR 4PJ7E 3OKMA 1JTPA 1F6LL 3VFNA 1MCLA 2J5LC 3E6FA 3H3PL 2NY6B 5I1DB 1BBJB 3QCTH 1PKQB 3DPBA 5CZVH 1CT8A 1NPUA 4FMFA 4MD4B 1WWBX 3V6OC 4FXLA 3ZHLA 3RNQB 5CP7A 4M7LT 5D1XA 4AQOA 1P84K 2FL5B 4KI5F 3B5TA 1XGYL 1ZLSH 2ZUVA 2P24B 3O45A 1Q38A 4ORZC 3UYRL 1RU9H 3B2VH 4WV1B 1TZHB 3VXUA 1ZA3B 5D1ZB 4BKLA 2MMXA 3O4OB 3ZYOA 4S1DD 5F6IB 1U8IA 2RFXB 5HYJB 5FAAA 1S7SA 5DJ2B 2Z91B 1INQA 2AJZB 3FAXA 4FQ1H 3OHXB 5IB4A 1UVQB 5EC2B 1HIML 1VFBA 1IILE 3KLAB 4KROC 4JANA 1FZMA 5KN5B 3ZKSD 3L5IA 3OB0H 4HIXL 1L0QA 5ACMA 5EBWA 5E6ZA 4D9RE 4F7PA 3EDJA 3OKYA 5HYEA 1LILA 3FHQA 3A6CL 4ODHH 3QIWB 5GS2H 3NIFE 3GSXB 4PJXF 4Y7MA 4XZUA 1MRCL 3T2QA 3X11A 1YN6B 2HJLB 2OCFD 3IKCB 3IETB 1VFAB 1JYVA 4NO2A 1QLFB 4NJ9H 4EN3C 1AR1D 1FZKA 2DQCH 1BFOA 3DMMD 4NUJA 4XP5H 4L9LC 5JIKA 3VRIA 5JDSA 2QHLA 4CNIB 4HH9B 4Y4FB 5KSBA 1Y0LA 3EKCA 1HEZA 4MQSB 4AENB 1OF2A 5JOFA 3CH1A 1R0AH 3QO0A 4XAWH 3QHFH 1R3JB 3HCVA 4MX7B 1FJ1A 3M07A 3V6OA 3MODH 2R4SH 1K2DA 4ZNCD 4NBZB 3CMOL 5FO8A 1I7ZA 3GSOB 4FQQB 3ALPA 1AHWC 3PQYB 3VFTB 3HC0B 2EEDA 4PR5A 4O00A 3RIAK 3MMEB 2VDNL 4F33B 1I1CA 1RHHB 2Q76B 2Q1EA 1XR9A 1Z0NA 2XN9D 5ACZA 4O51B 3B2UC 1LO2H 5DT1H 3MRGA 3PJSA 2GT9A 3OR6B 4X0KA 4RMTA 1JF5A 4FXKB 4JHWH 3MXWH 4LHUA 3VG0L 3QQNA 1ZVYA 1FORH 4QOKB 3BQUA 4MCZA 3CVHA 4K23H 5DUMH 4D9QD 1OLZA 4C4KT 3NABL 4EXKA 1UENA 1NEZA 1UCBL 2YMXL 43CAA 1TMCB 3CDFA 3JBG7 5SV4A 5EOQL 2FNBA 3HG1D 4H1LH 5F7WC 1JNHB 3IFPA 1LNUB 3BKJL 3FL7A 2WBWB 2W0PA 4X4YB 4MQXC 3TZVC 4JRYE 3ARDB 4QGTA 3ALWA 4HS8H 4OLUL 4M6MH 3RNKA 3C6LA 1N3NB 1GZPA 3GMPB 4JZOB 1HHHB 3BW9B 5I76A 1BEYH 1K9TA 1A47A 1RZFH 2ESVD 3GMRA 3LD8B 4X7TA 3IGAA 5ILTL 1DQDL 2GTZA 2VKXA 5GGTH 3CDCA 4QT5B 4ODWB 3FN3A 4EN3A 5I1LB 1XF3A 3PGCA 3REWA 5LXGL 1NCCL 3N85H 2ZJSH 4G8GB 4YDJB 1EFQA 1UEMA 1IEBA 2CLRB 5I0DA 3CFKB 3DURA 4QHKJ 2JJSA 4WIQA 2BDNL 4DWHA 3I84A 5DEFA 3VJ6B 4AQ1B 2E9BA 3RBSA 43C9B 4BFIB 3UBXI 1NCAL 1KPRB 1NC2B 4EOWH 2XKNA 2H32B 1UXSB 1S7WB 2E9JA 4Z0BL 4HZLA 1LO3L 2ICWI 4HUXA 4RQQB 3DXAE 3FOLB 5F89A 1J0HA 4NQXA 1WTLA 2VDPL 4FTVB 1QD0A 4WEMB 4CMMA 4XPTL 4LLVB 4JFFE 1A2YB 4U3CA 2DQTH 4O9HH 4KI5D 2DAVA 4P2OC 5D1ZD 1OARL 3AS1A 4G42A 3D5OF 3ZYJA 5GRJL 1HDMB 4M5ZL 3BDYL 4M1DL 3MA9H 1AGFB 2PYEA 3LQZB 3V2AR 2VZVA 4D0CB 1I7TA 4ONGL 2AJYL 4M62L 3KYKH 5E9DE 1ZV5A 3O6FA 4BK4A 3B4NA 4DTGH 5EU6A 2ZUTA 1G7QA 4CDHA 2R0WH 2CLVA 4MGXA 2LU4A 1IBGH 3NCFB 5FV2A 3KPQA 1VSCA 3BWAB 1CE6A 3H9YA 4OLWL 5I1EL 4QRUA 3HB3C 1KBGH 4ETYA 5TDPB 5HGBA 3NVQA 5DJ8A 4OI8A 5I66A 1PAMA 2WK2A 2EYRA 2BNRB 5H2BA 1C5CL 1KTLB 1B4RA 3ROLA 2VLJE 1A4JA 3QIWD 4OD1L 1IC5H 3LKPB 2D4DA 5FB8A 3CXHJ 5I1HH 2DQUL 4L4VB 2P5ED 1XEDA 4RGND 3QEQE 3EYFA 2N7BA 4H88L 3VCLA 4U1LA 4NRYA 3LDBB 5TQ0L 4NQED 3MFFA 2Z8WC 1UWXK 5BV7L 3HLAB 2OMBA 3IVKA 1NSNL 1V3JA 3B9KA 2W60A 1Y6KR 3F6IA 3R8QA 4S1RL 4HT1L 2O5ZH 1PZ5A 4PJDA 5L9DL 2XT1B 2VQTA 4JJHA 4Y16B 1ONQB 2QQLH 1FPTL 2IH3A 3RU8L 4U1IB 4PY8J 5ERWA 2UWEF 1JNJA 1RJLB 3MJ9L 3DVNB 3SJVB 5D2NE 3MGTB 3DRTB 2J8UE 1GAFL 1RURL 1PG7W 5ESQB 3CX5J 4WUUE 2O5YL 3HE6D 5E2UL 3OR7B 4K94C 5A1AA 1RIHL 3PHOB 5SWSA 4HBCH 3WUWG 4YHLL 1MREH 3L1OL 4BSWA 1I8LC 5LQBH 1XGRB 2XV6B 3H9SE 4X7SL 5IHZA 1TTUA 2VLKB 2NNAB 4HKBA 2YD6A 4OZFA 2GJZB 4DGYH 5GS2D 3OPZH 4RIRB 1ZKAA 2JCCA 3WE6B 4NGHL 3MBEA 5GISL 4HUWA 2NY5H 3VFMA 5HHQB 5ETUB 1RMFL 5KSUB 1JHLH 1FG2B 5DJXB 3NZ8B 1X5ZA 2IJ0C 1HH6A 5IOPA 1B3JA 4H1LG 5MEOA 4Y1AE 3EUUA 2DQIL 2JKXA 1KPVA 5FKPA 3CFCH 3EBAA 2D03L 4LVOB 2D7TH 3ARDD 4S1QL 4PJGB 4M7ZC 1D9KA 5DVOA 2H26A 5JORA 4QXUL 1T4KB 3T8XB 2ZCHL 4HJ0D 1BJMA 2AVGA 3LSOA 3VH8G 5I1CH 4LSUH 3ARPA 3HNVH 5GJTH 4KY1L 5AYUH 3L3IB 1FSKB 1YMMA 4Y19B 4YR6B 1A7PL 3ILQC 2BVTA 3HC3H 2BSTB 2P5WA 1E4XH 2JE8A 5EC1A 4CL7A 1A7OH 4XP6L 1E0OB 4WGVB 3HUJF 4Z0XA 1CL7L 2BFVL 2AQ2A 2X89A 3SDAB 3VFNB 3E6FB 2CK0L 1A7BA 5JQHC 3HZYB 4JPKH 3JV6B 4UB0L 3TJHC 1HHKA 3WFCH 1NANH 4KGJA 5LVEA 1KLUB 4BFGA 3L7EA 1WWCA 4UAOC 4Y4HC 3JVGC 3BH9A 3R0NA 5D1XB 4DKFH 1IAIM 4K71B 2FATH 4MJ5A 1PLGH 1U8OA 4OLXL 3HI6H 5B3JF 3FQTA 4N8CH 4FTVD 3O45B 3QDGA 1A6UH 4IRJD 3T0AA 3CX2A 3X3FH 3IDNB 4LIQH 4E41B 3Q5TA 2RR3A 4P99A 2VDLL 2XZQL 1J8HE 3GMQB 4M5YH 4X7FC 5F9JB 1ZGLM 4IJ3C 5L2KA 3O2DL 5D70H 1MCKA 1S7SB 1EHXA 4MAYC 4W70A 1JHKL 1NC4A 1TCRA 4OB5H 1INQB 2C9AA 1WBYA 4YHYB 2YN5A 4FOMA 3GSVA 1SJHB 3RQ3A 2VDRH 5MENA 3BH8A 2CK2A 4Y4KB 1JP5A 5FDYA 4JANB 1FZMB 3RA7L 4YXKH 3QXTA 4BQ8A 1C7SA 3P77B 1X5KA 1GH7A 3T4YA 1WBZA 1S9YA 4UIKH 5SWZE 3VXUE 5EBWB 4IRZH 1U42A 1HILA 4F7PB 1OAXL 1D5ZA 2EE2A 2Y1VA 4WHCA 4F7EA 1YNTA 1QHOA 15C8L 2CKBH 3OBAA 3EFFA 2EXWC 1QFWI 3BP7A 3QYCA 2DQEL 5C6WH 4XZUB 1H9VA 4P46B 4I3SH 5ITBH 4QEGA 1VADB 5DVMA 5IW6B 2BRQA 1BX2A 2J8OA 3DYOA 5B39A 3X11B 4LGRB 2XQBL 4KV5E 3MREB 3ZL4L 1PZUB 4NZDA 1CLYH 4JO2L 5E8PA 2YKLH 5D6DA 5HI4D 5F7EH 1S7QB 1JK8A 4JR9L 4N1CA 3VG9C 3QIUC 5JDSB 2Q20A 2J5LB 4KVCL 5KSBB 1T1XA 5T3ZH 1H3UA 1KIQA 3Q6FA 2M1KA 3ZSSA 2IFFL 1CZ8L 5JOFB 3CH1B 4X7DC 2VZTA 2LU7A 3VFSB 1MSPA 4IIQC 3BXNB 5C6PB 1F42A 4PRNB 5DC0A 1BF2A 4Y4HA 2NY1C 3KYMA 2GUOB 4P4RA 2CIIA 2B0SL 5EIIA 5I73C 2F58L 1OCWH 2MOVA 3FCTA 3T4AA 3QIBA 2DLTA 4C83B 4WO4A 3NIGE 4G6ML 1A6VL 5CJ5A 5ACZB 1I9IL 1A3QA 4UV7H 3WFEH 3MRGB 3RVVD 3PJSB 2WP3T 4X0KB 1DQMH 1XF4A 1T22A 2P42B 4S11A 4TSCH 5J9PB 4ZSOA 1YEDA 5M94B 2VLKD 4N0CD 4MCZB 4FP8H 2JB5H 4PJCE 1P9MC 4LLUB 2NY4C 4KROB 5ICXA 1NEZB 2P47B 1L7TH 5FOJA 5ADOH 1OAYH 3RL2B 4I0PC 3K8MA 4TVPE 2Z35A 1T21A 2ZP0T 3IFPB 4F2MA 5DR5L 3CAFA 4WWID 1Z3GL 2LQRA 4D3CL 1ZEAH 3ELAT 4OUUA 3RJQB 2EDWA 3RNKB 3WUZA 2AI0H 4X8JA 4UOJA 4Y8AA 3CFDA 3SDCC 3OZ9L 3GMRB 1NDMB 4WGWB 2ERJC 1CICC 3QPXL 1P53A 1YEKH 1WZMA 4YDVA 2GTZB 1CGWA 3VRLF 3ZE1F 1WF5A 4BA8A 4GQ9H 2CRZA 1K8DB 5FCUH 4EN3B 2X4PB 1XF3B 4WHYG 1TCMA 5IKCB 2YSSA 1TVBA 1CVSC 1NCWH 4L9LB 4C59B 3FJTA 3FRUA 3F65A 3GKWH 3V52L 3MNVA 4ZNEE 3PNWB 4LAJH 1F58H 4B50A 3KPLA 2Y5TA 3LKNB 3FB6A 5T5NG 2XKNB 1TJGL 2ZCKL 4R8WH 1Z5LA 4HZLB 1AHWB 2F5AH 3R06A 2YPVH 2YXFA 4ZS7H 4EIZC 5DHVH 3L5JA 1CDCA 4DKDC 2J3SA 4IRSD 1ZOXA 4ENEC 1LO5A 4Y5VC 1GGUA 4Q9RH 4E41D 5A43C 1LEIA 3EYUH 5DA0B 1DZBA 2R0LL 4I3RH 4QRTA 5L7XL 5I2IA 5J1TC 3ARZA 3BP5A 2GY7B 3MLYH 5C0BA 1CWVA 3O2VH 2G5BA 2E5EA 1UKTA 1DBJL 4I0KA 3AU1B 4QNPE 4Y4KD 4XC1L 3KPQB 1Q9KB 2EE3A 3RAJL 4LARH 3QQ3A 5CINL 5MHSD 4QRUB 4V1DE 1ZK9A 4NCDA 4S0TD 2HLAB 1HHJA 2MWCA 3BKCL 4OCNC 2Q7NA 2X09A 5JPNA 4YDKL 4YIQA 1YEHH 3ROLB 1CI5A 2F5BH 1T1WA 3UO1L 2UYLB 1A4JB 2PYEE 4TSBL 4MMZC 3SDCA 3E3QE 3ZKQD 4P46D 3ZHDA 4Q6IC 4JEGB 4P3CH 2JJVA 2ILLA 5EU6E 1SMOA 3FN9A 2V17H 5EUKA 3ZT5A 3LKRA 4N9GB 5C7XH 3EYFB 2ARJQ 3V4UH 1FG9C 2ZNXA 3U82B 4LCWA 3OKKA 4KMQA 1MHPL 3JUZA 4U1LB 5DHVB 1G84A 4JFQB 2R4RH 1QEWA 4HIJA 4LRIA 1X5GA 4GS7C 3MQIA 3D85D 4X9IA 5C0AE 3QUXC 4G7YH 4OCSL 4UBDD 4UT7H 3G04A 3QUYC 4PJDB 3WV0A 4WI7A 2L7JA 1Q0XL 1P4LB 1I8MA 5KZCB 1V7ML 5SWQB 6FABH 2XIDA 4PJ9C 1JMZA 2IH3B 4ZUTA 4F57H 2YC1B 5ERWB 5EU3A 1QNZH 3AS2A 4TQEH 3PWVA 4ODTL 1F90L 3U1SL 4LHJB 1NBQA 2F53E 2L7UA 2ADGB 2OP4H 3R0MA 4P2OB 2B39A 1P4IL 1JF1B 1MJ7H 4GMTL 4KXZI 1DSFH 1N59B 3OKLB 1KC5H 2ZG1A 4K55A 5EZLB 5EZIL 3FMGL 2NYYC 4FABH 2XFXA 4DW2H 3RDTA 4NQCE 4A6YH 5EU4B 1A7NH 4OZFB 4UZGA 3UTTB 5GRYA 3KR3L 1SEQL 5I1JH 4RFOL 1XH3A 4HUWB 4RMWA 4KROD 5HHOE 3U0WH 5F9OL 3QPQC 4K94H 2Z93B 1HH6B 4GRLA 2B1AH 5IOPB 4G9DA 1U95A 2X4NB 4HCRA 4J8RA 4XVTH 3N1MC 4GXVL 1DQJA 5JDJA 3MLUL 1JIBA 1WV7T 4J7RA 3LKOA 5J6GB 2ZPKL 1U8JB 5GS3A 1RK0A 5T3ZD 2H26B 4HPOL 4QXGL 1V7NH 3L3GB 5BS0D 4L8BB 4Z7NE 1IT9L 5IHBA 3EO0B 2DOCA 3BD4A 2HN7B 5BO1H 3TYGH 3BE1L 2V5TA 5GIRA 2P5WB 4EUPH 4JE4B 1JV5A 2AK1L 3BYYA 3WD5L 2VLRA 4MDIB 5CJXC 3H9ZA 1G9NL 5IB3A 4OSUH 5JHDA 1HHKB 4D9LH 3MCLH 1TITA 5AUMA 3WSQH 1FAIL 4GUPA 4P23A 2BSED 1Q94B 1BLNB 2JK5B 5AD0B 3NIDE 2EH7L 3Q1SH 4P2RA 1ZGLA 3BH9B 2DS4A 1KCVH 3FN0L 3PL6C 4XRCB 1U8OB 3MOQA 3PDOB 4AIZA 1YMME 5ENWA 1WUNT 3QJFB 4RZCA 3FQTB 2GJ6D 3QDGB 3GBNH