4FFZH

Crystal structure of denv1-e111 fab fragment bound to denv-1 diii (western pacific-74 strain).
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
217
structure length
217
Chain Sequence
QVQLLQPGAELVKPGASMKLSCKASGYTFTNWWMHWVRLRPGRGLEWIGRIDPNSDVNKYNEKFENRASLTVDKHSSTAYMQLSSLTSEDSAIYYCARWFFPWYFDVWGTGTTVTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope protein E
publication title Structural Basis of Differential Neutralization of DENV-1 Genotypes by an Antibody that Recognizes a Cryptic Epitope.
pubmed doi rcsb
source organism Dengue virus 1
molecule tags Immune system/viral protein
total genus 42
structure length 217
sequence length 217
chains with identical sequence Z
ec nomenclature
pdb deposition date 2012-06-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ffzH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ffzH02
1T5WA 4ZOBA 5ID0B 5I1IH 5E6IA 2XN9A 4U1KB 3GJEA 4JM4H 4LKCA 1FSKC 3DGCR 1MJUL 5I71C 4NWUL 4OD1H 5IBUG 4BFIA 4AIZB 1B0RA 5E1AB 3JV5A 4ZFFA 1HNGA 1CLYH 3TT1L 5ID1B 3FFDA 1NAMB 2G5RA 4NT6B 5FHBL 5C0AE 1URLA 3EFDH 4MLIA 1IZJA 2GT9B 5ECJE 5I18L 1MNUH 2IADA 2CUMA 3SGJC 1HHKB 4A2MA 3HUJB 1ZANH 3QQ3B 5E99H 1NANI 4W70A 1KTDB 1CFVL 5DI8B 4P23B 3FAWA 5J1TC 2OL3A 4IS6B 3QHZH 1IGYB 5HVWA 1DLFL 3T1WA 3KPNA 1A7QL 1MCPL 5TDOA 1TZHA 1X4XA 3LPFA 2P5EB 2GEEA 3WKML 4F33A 4LLAA 1JPGA 3C2SA 4QRRB 1OLZA 1YNTB 4A6YH 5SWZD 3LSOA 3OHXA 1JRHH 3TJEL 4ZAKB 2RGSA 4KKLD 4M8QB 4MJ5B 5L0QB 1OSZA 1IC7L 3VG9B 1KELL 2P8MB 3PQYD 5K59F 2R8SL 2XN9E 4K71C 3JSSA 1OPGH 1K8DB 5D96C 4AEHL 5ESAA 4XMPL 1GZQA 1KGCD 1ADQA 4PREA 4MCYB 3PGDB 4JO4H 4OSUH 5EBLB 5IBTL 3O6FB 4I77H 1ONQA 1A47A 2BHZA 3HTLX 5DVOA 2VDPH 4UB0L 1XGYH 1U2CA 4M62H 1L7IL 1KXQE 1Q9LA 4ZSOA 3OX8B 6CGTA 2B7DT 4S11A 1G0YR 1IL1B 4LSSL 4KRPD 3PHOB 3UAJD 1AGCB 5J4MA 4YR6B 4QEGA 1GGIL 3L9RA 5IVNA 4XNZB 5F7LB 3VH8B 3ZKQD 3BN3B 4L3EA 1QFPA 4PJHF 4QHKI 4BKLB 1FGNL 3KXFB 3OQ3B 5C9KA 1WBZA 4WEBL 4NYLB 3RIFF 2AS5M 1RSFA 1XF1A 2ATPA 5KJRL 3AM8C 3E3QE 3HFML 5HGDB 4Z7OF 1AY1L 3C9NA 4YHLL 1NEZG 1AO7B 4WWID 5KW9L 4P46A 3CVHA 2VYRE 1HCFX 5E8DH 1AKJD 5DSCA 1FN4A 4OCYH 4PV9A 5FECB 1KJ3L 1AXSB 3N0PB 3GEWB 4EUPH 4CUCA 1RK0A 5KN5A 4KZDL 5D7KD 4EBQL 1HNFA 5FDWA 3CLEH 3HE6B 2NY0B 4PV8B 2M8XA 3DV6A 5ACZA 3BAEH 2ARJB 2DI7A 5C8JA 1EO8H 5HHPA 3HZYA 2ERJC 4HG4J 5IGXH 5GS0C 4S2SA 3ECBA 3WYRA 1SJHA 1TJHH 4ZSOE 5AAMA 3TIDB 5GSRA 3TN0A 1Y6KR 1SY6A 3GGWB 4PJDB 2R0LL 4GBXB 1YYLL 1N59A 2VZTA 4QOKA 5L9DL 5HGBA 1FVDA 4HF5L 3OR6B 5DRNB 3VXPB 2A83B 1F5WA 4QYOA 4L3EE 4KK6C 3VI3E 1S7SA 4K3GA 5D70H 2AV1B 3T04D 2DQCH 4RAVB 2ZG3A 4R4ND 3TVMB 5TPWL 5E95B 3NH7L 3D18B 4P48A 4XPBL 4NQDA 5IF0B 4IRZL 4XVUD 2L7UA 4NO2B 3IJYB 2FO4A 3MCLL 1MF2H 3S4SG 3MXVL 2K9UA 3STLB 1KJ2L 2WWKO 2ZG2A 2Z4QB 2AXFA 3SDDB 1FPTL 2MPAH 3FFCA 3KWWB 1QA9B 4PJIB 3QIBB 3ZTJH 5KSBF 3KG5A 4NQVB 5HHOB 3IS1X 3C09B 5D2LF 3S97C 1DE4B 3I6KA 1TZGL 4PJHB 4M5YH 1UVQB 1AI1L 3SJVA 2BVQA 3BZ4B 2CJUH 1C8PA 1OGAB 2IMNA 2RBLA 3UPAA 4OZGF 4U1HA 5IK3B 4NJAH 5E2VL 5D9SB 1J5OL 5HPMA 3NFPB 1K4DB 1DFBH 3PHSA 1BZ7A 1G9NC 4LDLB 1C1EH 4PJGF 4HHAB 4QOKE 3SDCD 3T2PA 3KPRD 3QWRD 4OZFB 3ZE1F 3QUXB 3UJTL 2VITB 4KQ4L 4M1DH 4XNZC 1LNUA 4NM4H 5DJCB 2GFBB 3O4LE 1NC4B 4IDJL 4D9QD 3BWAA 3H7BA 5EU4B 2UZIH 3F58H 4NQDE 1YN7B 3MO1A 4HUKB 2WBJC 4G6JH 3DRQB 2XKNA 4PPTA 4BQ6A 1FBIL 3NGBC 5I73B 1DQJA 4OGAD 2HKFL 1FJ1A 5D7IE 4G9FB 1DUZB 3FFCE 1ERNA 2Q20A 1U58A 2JELH 5EBMB 4NN7B 1F8TL 3EO0B 1JTOA 1RUAH 1X44A 8CGTA 4FTVD 2FWOB 3EDEA 5CUSH 2EH8H 3SJVE 2DLHA 5BJTA 3D25A 3Q3GB 2QQKL 3VFGH 1UM4H 4N0UB 2Y36H 4QF1A 1WFUA 1MUJB 4L4TB 5D1XC 3ZT7A 4BSJA 4JR9L 2VH5L 5F3HB 5IW6A 4ZPTB 4MHHG 1ZLSH 2OJEB 3VCLA 3BVNA 3CFCL 3C5ZB 3Q1SH 5CKGA 5DGQA 3UC0L 2ADJA 2LVCA 1NSNL 4WFEE 5BOZG 4P2QD 4MJ6B 1HH6A 1BZQK 5D2LB 3VD9A 3FN9A 3KHQA 3UZVB 5IOPA 1KC5L 3QDGA 2C1OB 1F3RB 1OVZA 3FT2B 4ODWA 1DBAL 2GUOB 1DQML 3C6SA 4OI9A 3DTXA 1CBVL 3BGMB 3BISA 3VRJB 5F8RC 3TBVB 1MOEA 3C5JB 3RNQB 1VFAB 5ESQB 2HMID 1D5MA 4XPGL 3TBWB 3W39B 3GIZL 4PJGB 5KG9A 3RKPA 1BJ1J 4LVOB 5ADPH 1WFOA 2MHAA 1KTRL 2IBZX 3K81A 3N85H 3QFDB 4P4RA 2FNBA 1CDUA 3A6OA 5T5FL 2A73B 4TSBH 4JG1H 5C86A 3C09C 4Y89A 1WGOA 5LWYH 3K1KC 2W9EH 3ES6A 3UXFA 3EOBA 3MX0A 1KCLA 1RD6A 3OJVC 2PXYB 3AS0A 3S3SA 2OX5A 4RMQA 1U8OB 3UTZA 4MNQB 5I66B 4N68A 3VXUD 4HV8A 3O11A 7CGTA 1KIPB 3QEGL 1KB5B 1OOAA 4NOFA 4O02L 5KAQG 1BD2B 1DANT 1OM3L 1JN6B 1H3XA 1RV6X 3V0WL 1BVKA 4WI2A 2AJYH 3ARRA 3RQ3A 3QDGE 4S0TD 5DD1L 2C7UA 2XZQL 2HTKC 3WN5C 4RFNC 4YHZH 3HPLB 4NJ9H 1S7TB 1EPFA 2R4SL 5SWSB 4PRPD 2D0HA 4OLZH 4FQXD 2ZCKH 1JGVL 2CK2A 3C5SB 5ISZB 4L5FH 4BZ1L 2AV7A 1IAIL 4XNXL 2Q8BH 2N56A 5C71A 2P8PA 2D7OA 4WEUD 3R1GH 4OM1L 5GS1B 4UMGA 2ZCLL 1JHTA 1EZVY 3VW3H 5BO1L 1P4LB 4HK3N 1ZK9A 1JUFA 4JHWH 4D3CH 1RZ7H 4O2CB 4QHMA 3D85D 1RZGB 2EIZA 3P73B 3C5ZC 4LLDB 5DD3L 1EHAA 3D39D 3LEXB 3NCYS 3BRGC 5L8KB 1AR1C 2Q76A 2E9IA 2C4FU 2A0LC 3EYSL 4GT7A 4PUBL 4U6VL 2NX5B 1YEKL 3MUZ1 3UROR 2AGJH 3JZ7A 2BSRB 3PGCB 1EHLH 4NN6B 3HN3A 3T2OA 1MCCA 3CDYA 3NIDE 3QG6A 3VXRB 3FJTA 3ARDD 2XTJC 4HWBH 4LBEA 1D5ZA 4C56A 4P2OA 3MMEA 4X6DA 1KPUA 1I9EA 4N0FB 5T3XD 2EIDA 3FN0H 4KY1H 4Z7QE 3NCCB 4MCZB 4LAJH 4ISVB 4WI6A 2BSED 1LO3L 4NPYA 5JLZA 3GSOB 5J57B 2NY1C 3IJHB 1HHHA 2HJFB 4M93B 5GS3A 2YPLB 5I1AB 4PJFE 4E42B 2IALA 3QUMH 3MROB 1AGFB 3L95A 5KSAB 1MFCL 3KPOB 4U7KA 4UUJB 4H88L 4OCWH 2GJ6D 3LY6A 2DQIL 2DWEB 3ELAT 5HHME 3RAJL 4XI5D 4HUVA 1F3DH 4PGEA 2B8OT 5DDHA 3EOTL 2YZ8A 1MFEL 1FG2A 3DXAA 2IEPA 5K9JL 3CMOH 1V7MH 4QT5B 2O5ZH 2E27H 3HC4H 1MREL 1N5AB 3UO1H 3BZEB 2EXYC 1KLGA 3BZFA 5DMGC 1LEIA 4Q9RH 1DN2A 4C56E 4Y4KB 4G3YH 1VGKB 1IM9A 4Y16C 5BV7C 5EBGA 4X6DE 5ICXA 3HRZA 5GGVH 4DVRL 4R7NB 3B5GA 4Z5RB 1UB5B 5IB5A 2VNCA 1WC7A 2E7MA 2FYYB 5EWIL 2P4AB 4IHOB 1F6AA 4M7JH 3NABH 3SE9L 4DK3A 2VR5A 4QHUA 1U91A 1HKLH 1YPZB 1YEIL 4IIQB 4PR5A 2X05A 4TTDC 1RPQA 3CXDL 5D7JC 1VFBA 1FFNB 2UV3A 1S3KL 3QI9A 4JKMA 2J6EA 1MFDH 4WFFD 3ZL4L 1F4WL 2MNUA 4N9OB 4KJWC 4HMDA 5I1LA 3T3PF 4KUCF 1MCWW 4OF3A 5MEQA 3DXAE 2VQ1A 1ZLVK 1ZHBA 5I75C 4H8WH 4ETQB 2I9LA 1FFQA 3LN5A 1QVOA 4HIJA 5ITBL 4WO4A 4UU9A 2LQRA 4Z7UF 3OSKA 2X6MA 3R0MA 5ALBL 1D5IL 3L3DB 4S1RL 3PGFH 3WDJA 3IU3A 1S9WB 3D9AH 1I3RA 1BIIA 1OCWL 1DBBL 3RPIA 4FQJL 4KTEH 5HYJB 3GJFB 4F57L 1SEBA 5FK9B 1X5GA 1T2JA 4FMFA 2W07A 4N1CA 5F71A 1T7VA 1P7HL 2EC9T 5I1KH 1PY9A 1T89C 2H6PA 2QSVA 4EZMA 1SY6L 1PZ5A 4XT1C 1X5AA 5DLML 4KKAC 5JIIA 1FRGH 2CUHA 4KI1A 5EIQA 3WIIL 3AVEA 2F8XC 4WW2A 5JQ6H 1EEYA 3R4DA 4ETYA 3I2CH 3S3JA 4NO3A 1PKQA 3WJLC 2JJSC 1D9KA 4GAGH 5ESVA 1M05A 1OQOA 3DMMA 4MX7A 3I6LD 2VC2L 3BH9A 3X3GL 3ZYJA 2EDDA 2Z31A 4GKOA 1U8NA 2AI0L 1VCAA 1IJ9A 5B4MC 4YC2C 5FOBA 4PB0H 4Y4FD 5MHSD 4FNLL 2MCPL 1UA6H 1KN4H 5TE7L 3RVWC 4Z6AT 2J88L 4KUZH 4JY6A 4ELMA 4L9LB 2CRZA 5JW4N 1KXVC 3SDAC 1KFAL 5B39G 4I18A 5F9JA 1VPOH 1MVUA 5DF0A 4NUGH 3CLFL 4N5EC 1UGNA 1JPTL 4I2XA 5HVHB 1P2CA 5ETUA 2XRAH 3TLRA 4A6YB 3MA9H 3UTTD 4U1IA 1IC1A 2UWEB 1NMCC 3BP5B 2H8PA 3WSQL 2R29H 1PKQE 3VWJC 3DX6A 3Q5TA 5TF1L 3O8XD 2NY2B 2FX7L 1NMAH 4GMSH 3GMLB 4U1GB 3IRPX 1B9ZA 4WIQA 5J6HB 3VGFA 3LRGA 3SE8L 3QCUL 1QG3A 3B2UD 2H2PD 2FATH 4UQ2B 1KYOJ 1MH5B 5IMMB 4QXUL 3G5ZB 1TZIB 2NY6D 5GRWA 1BMGA 4G6FB 5T1KD 4UILH 3SE4C 4Q0XL 1F11B 1QRNA 3DO3A 3HI1A 1JV5B 4ELME 4ZD3L 1ZGLA 1XF5B 5IM7B 2AJSH 1TJGH 4U2YA 2Z91A 4KRMB 3LHPH 1B4RA 3LKNA 3QISA 4Z8FL 4I2XE 4CN6A 4CAGA 1A14H 3SY0B 1G1CA 3WXVH 1RMFH 1P5UA 2WLYA 3QUZB 4HXBL 2X4OB 3HG1B 3PWPA 3A67H 3ULUF 3MRGA 1QLFB 3WFCL 1I4FA 1J8HA 1OGTB 1EFXD 2R4RL 1U8KB 1HSAA 1MJ8H 4XVTL 3VFVA 2HT3D 5H94A 5JPMA 3LQZA 3G04B 5BQ7B 1GH7A 1H0DA 2IPTL 3ARVA 3QXDA 3QZWA 2ICEA 3WL9B 1ZGLP 2V7NB 4P5TD 5GGSB 5E9DB 3V6OC 3KYMB 4JG0L 4Y2DB 4EUPB 3FZUC 4I9WE 1TCRA 2ICCA 1NGQL 4JN1H 1RUKH 5FYJU 1HH9A 5EUOA 1ZXQA 4OD3L 3S35H 2NXYD 5CEZD 2IFFL 4UV7H 3G5VA 1RFDH 3P4OB 4JO2H 5T1LA 1QRNE 1I1AC 4K07A 5CJXA 2O61B 1M71B 4JZNB 4FXKB 5L7XL 4JPWH 2OK0H 1X4ZA 4GH7B 4F7CB 4AIOA 1A3RL 4HLZG 1GIGL 4YXKH 1ES0B 1Q8MA 3PP3H 5IQ9A 4BJLA 1J1PL 5F9OL 4YXHH 3PWPE 1ZA3B 5E2JA 3OF6A 2B2XH 1J8HE 5A3ID 1DVFC 2C3GA 2UVEA 4OCNC 2BVTA 5CJ8A 1P9MC 2EYRB 1MWAB 1KNOA 1NCCH 4JKPL 5KSVB 5FGBA 4EEEA 1FNSH 4JZOB 4H20L 4L29B 5DD5L 4P2RA 4EDWH 3KS0J 4XX1E 4HCRH 3TNNB 4IMLB 5EUOE 1M7DB 4ZPVA 1I8LA 2A6IB 3BUTA 2B5IC 4XCCL 3V79C 1DQLH 2W91A 4ZUVA 3ARED 4HKBB 4QY8A 5FYKU 1HEZB 3RVTD 1JWSA 4WV1B 5C07D 1ZT1B 3GHBL 2V5MA 3IDIB 3HKFA 1H8NA 4NWUH 5A16A 1C12A 4GW4A 3B3IB 5E7FA 4JPVL 3TT1H 2FHBA 1UH3A 5D5MB 2XOTA 2ITDB 1UG9A 3K2MC 5FHBH 4JGMA 3TGXA 1ZT4B 1BOGB 1KENH 2NYYC 4K7PY 1ZLUK 2CLZA 1GPOL 3S34H 1T21B 3ARSA 4LPWA 3EYFB 5DGRA 1UXSA 3VXNA 1Z5LB 1CFVH 3VI4F 2E7BA 4X80L 3L6FA 4HPOL 1NBYB 4OGYL 2JKXA 4G6AC 5HI3C 3MLVH 2Y5TB 5D1QD 1IAII 1DLFH 4P2RE 2FJGB 2XXCB 2XFXA 4Y2DC 1MAMH 4MD5B 3WKMH 4U2ZA 5AG8A 4LU5H 5IHUL 3KPQA 4GRMA 4GRWE 3L3OB 5EULV 5JO5B 3ILQD 1KELH 5CJBA 3CFIC 4RGNB 4U1NA 2R8SH 3OPZL 5KVFL 4FRWA 5CGMA 4AEHH 1SHMA 4IOIB 4XMPH 5SWZA 1LGVA 4XP5H 3EDDA 1GZPB 4Z77B 4Q2ZB 2VLRB 4F7PB 3V5DB 3PQYA 2BRQA 3EYUL 3OAZH 5C1MB 5CWSA 2R1XB 3BGFC 4YUEL 2VOTA 4S1SH 2VXSL 3MYJA 1D6VL 1XGTA 1T1YA 3L3KB 3RZCD 3S88L 3F8UB 4L1HA 2YEZA 3C87A 3L3HA 3LKSA 3D3VB 4MMXC 1NDMA 5DUBA 2Z8RA 5GRJH 2QKIA 3V95A 1QHOA 1D6EA 4PYGA 3DPBA 4MDJB 1GGIH 4N8VB 5L2KB 3FT4A 3IDGB 1YY8B 5JTWA 3RTQB 2YRPA 1FGNH 1IQWH 4PRIB 2YMXL 4Z7WF 3LN4A 4YGVB 3ZKMC 4WEBH 4JFZH 5I19L 4HXAL 1H15A 4WUKL 2JB5L 3UTSB 3WE6A 3KDMA 2NW2A 5KW9H 2NY3D 4HUMB 3OKDB 2CXKA 4XCYB 1TETH 4WV1C 1BQHG 4XGZB 4PG9A 3OKNB 5SWZE 3T4YB 1KJ3H 3JV4A 4YDIH 3S36H 5D6CB 3U7WL 1DQDH 1TNMA 4EBQH 3ILPB 3PQYE 3EJYC 3OXSB 3MRIB 4KI5C 4JFOB 1AKJA 2VLKB 3D69B 2CXGA 4H0IA 1GVIA 1KGCE 5E03A 3SKOB 1RU9H 4WTWA 4X0KA 4HD9A 4NCC2 3FO1B 3C60C 3IFLL 4U05A 1D7FA 3MLUL 3ARBB 2EIBA 3OJ2C 4BYHA 2ZSVA 4NQSA 2R0LH 5CEYA 4X6EB 1YYLH 3PIQB 1RUPH 1TVBA 1U3HB 5L9DH 2X4TA 1JZ8A 4HF5H 5DK0B 2MKWA 2J6EL 1QD0A 2BXZA 2YUZA 4YXLL 2YD3A 3SGEI 5SX4I 3NH7H 2Y4SA 3HA0A 5DK2A 3RKDC 3VE0A 2NY4C 4YX2H 4ZFOA 4M6OH 1LP9A 4XP9H 3C6LD 3OXRB 1HDMA 3MXVH 4LLWA 1KJ2H 2OR9L 2BNUA 4MDIA 1XIWA 5HDLA 5C0IB 1H5BA 4O5LL 1TPXC 1ZHLA 3U9PL 1B3JA 2DIBA 4AEEA 1UZ6E 3ROOB 1KIQA 3VGBA 4MQ7A 3VMNA 4X8XA 4ERSH 4J4PD 2FL5B 4F58H 5D7KE 4JJHA 5E2VH 5C70A 3ZYOA 3HZVA 5E8EA 1J5OH 2DQHH 3GSNA 1P84K 5J12C 3U46B 4NC0B 5IP4A 3WFEL 4JQXC 3X12B 1AD0A 3SKUD 3WDHA 3R06B 3VXOB 4AK1A 5FUCE 2NW3B 1YEDA 2HVJB 1QSVA 4KQ4H 3Q6FB 3ARGB 2EDFA 4JM2B 3DETD 5JW4M 2VXVL 3SDCA 1YY9D 3D0VB 3KPRA 3QWRA 3H3PH 1AIFA 5KTEL 3DX7B 2A6JA 1LP9E 3T0VA 1NKOA 4LLMA 3MV11 2IJ0C 1RZIA 3EFFB 3V4UL 2GI7A 5DRWA 3EO9L 3EOAA 5E70A 2AJXL 2W0KA 3LKRB 3ARPA 4TNVK 3QUMB 4F80A 3S5LG 2FLBT 2FCBA 3WCYA 1UM5L 3TCLA 1F90L 4ZUSA 4HS3A 4UDTA 3STZA 2Z35B 4M7KH 1A7NL 5F3BB 4Y19D 1FAIH 3MSPA 3V5KB 5JA8B 2VH5H 4FTVA 2I60L 5EO0B 4DKAA 3VFUA 3CFCH 2G75A 5B38A 8FABA 2D7QA 3AFLA 3GBLA 3LRHA 4HK0B 5KANG 2BOCA 2NZ9D 4TPRL 1MAJA 3BMVA 3N50A 3BUYA 2IQ9L 3MNZB 15C8L 4PRDA 1KC5H 4XZUA 3PWVA 3KPRE 4JB9L 1ODAA 1DBAH 1N6VA 3KYNA 4GUPA 4E5XB 4KAQH 4PJ8B 3PWLA 4WHTA 4ENEC 1NUGA 4K94L 4P2QA 5DMJB 3K4ZA 4D9QE 1NFDB 1VACA 4YPGA 3IGAB 4BFEA 1LD9B 3GIZH 4K8RL 1KOAA 3S35X 1T20A 3STBA 1N6QL 2F8OA 4GG6B 3ROLA 5HYIA 1CICB 3RUGA 1GSMA 1OHQA 4NNPL 1HWGB 1T0MB 5LXGL 1UCBL 3WV0A 2QV2A 3S8WA 1WUNT 4RMUA 3VD5A 2RCSL 3MNWA 3QO0A 4MQSB 2ICWJ 4FTVE 3CFBA 1MCOL 1XGRB 5IHBA 4NGHL 2PETA 2AABL 3BIAX 5DJ8B 4G9DB 4O02H 3PABA 3CX5J 4PLKD 4EI6B 1OD7A 5D1ZD 5H2BB 5EZLB 3N1GC 3V2AR 2WWKT 3VXUA 5I1DA 1NCUA 2MQCA 3T0WA 4JPKH 4NN5B 3K4DA 5FAAA 5DD1H 4P2QE 4C4KO 4DAGH 4W6WB 3SCMB 1M7IA 4KXZH 2NR6C 4QTIL 1IGML 3WS6A 1EUTA 4CVUA 2OP4L 1J0YA 5MERA 4BZ1H 5A2JH 2VXQL 2IF7A 2YC1A 3KYOA 2BK8A 2EDOA 3RUGE 3UPRA 4PRPA 3HNTL 3GBML 4G8FA 4OM1H 5AUMB 4FQXA 4JZJB 2ZCLH 5F9WC 1YEFL 3EO1A 3DO7A 4JRXA 3TO4B 5HDBE 5BO1H 4LF3B 5FCUH 1U8IB 5JIPA 5HHQB 1S5HB 1GGCH 2W60B 2VLLB 2R2HB 2UZYB 2ZPKL 4Q97A 2DQJH 5LGHL 1ZHKA 2DDQH 4M7LL 3RIAK 4DZBA 3WFHA 1KCSL 5DD3H 1UADC 4TULH 3WFDL 1DJSA 4HSQA 2DB8A 4L4JA 2PTTB 3VXUE 3QEHA 1LE9A 3LPGA 3EYSH 2V2TB 4ZXBB 5L88L 5EO9A 3D85A 4PUBH 4NIKB 1X3DA 4Q6YA 3H7LA 5BXFB 1YEKH 5C0FA 3D39A 4EKXA 5DJZB 1JTPA 3MRRA 2APVA 1YNKH 5KVEL 1QEWB 5IQ7H 2KZWA 5L8LB 4KJPC 2EO9A 4APQD 1E0OB 1FO0A 3KPTA 4Y5VA 2ITCA 4HS6A 1BM3L 2CRMA 1CICC 1X5KA 1ORSA 2FEDD 1MCLA 3MV9A 4PRPE 3WXWL 1P84J 5JHLL 1IGTA 3ARDA 1LO3H 2DLTA 2QQLH 4E9LA 4IRJA 4JRXE 3HRPA 3M1BA 1OP3H 4Z7VF 3UBXG 3B9KB 1EJOL 3RPKA 4TSCL 5KSUB 3E8UL 5JR1H 3KLHC 5B3JE 2QL1A 1NCWH 5J3HD 5E94A 1R3JA 4ZDHB 1A2YA 1M6OB 1XGQB 5GS0D 3BMWA 4X5WB 4HQQL 1HYSD 1J1XH 4NKIL 7FABH 4H8WC 4LEOA 5ITFA 1WCQA 4HMEA 2X4QB 2DQIH 4DGYL 4MVBC 2AJZA 3DROA 3DSFL 2EDKA 5GPRA 4P23D 5E6ZA 2DRUA 4DKDC 1CK0H 2V5SA 2EZ0C 4NN5C 4HKZA 5H35A 4MA3A 3D39E 5K9JH 2GJ6A 5HYSB 5CLTA 1BZ9A 4G6MH 2P5ED 1MREH 2ZUSA 4QRRD 5IMKB 1CXEA 1WCBB 5IR1B 5J89A 3IDJA 2B1AL 1KJMB 4ZAKD 4P5KA 5GGUB 4P2OC 2X09A 3MRLB 5I76B 4DVRH 5MEPB 1MJ7L 2VL4A 1YUHB 5SX4H 5EWIH 1UQSB 4O58L 3VFOB 3ZSSA 3SE9H 1FIEA 1XGUA 2HG5B 4MD0A 5TDPB 3GI8L 2A9NL 3S36X 3SOBH 4OCLC 3R8BB 2L0DA 1T6VN 4WI5A 3DVGA 3BW9B 5T3XE 2BY3A 4GSDL 2CMRH 5IBLD 3O3BA 1GXEA 1NJ9B 5DHVH 4UNUA 1UYWL 3ZL4H 1FL5B 2ENYA 1ZWIA 4F37F 4R0LB 5JIHA 3HZMA 4F8TA 3FRPG 2GJ6E 2OI9B 1OWRM 5CP3A 3U2SB 1U8QA 5HHXH 1JWMA 1XFPA 3KXFD 1GC1L 2UUDK 2VUOA 2WBJD 1FE8L 4LLUA 3WHE1 3DRTB 4NQCB 4TUJA 3EYOB 1AO7D 4ZS7H 5JUEL 1G7IB 1D5IH 1BQLH 4S1RH 4R2GB 1RZJL 1IARB 2VZOA 3IDNB 1QPXA 3MJ8A 4I48A 4UT9L 2VAAA 5DRXA 4M8VA 3ZYZA 1DBBH 4YHPA 4LCCB 3PV6A 3B9VA 2LU3A 4I5BB 3FQRB 1AD9A 3CXHJ 4Y4HC 4K3HA 4F57H 3CFDB 4QRTA 2NY0D 2CSPA 3MUY1 3I3EA 1R5VB 5EA0L 4Y5XA 4I8DA 2O5XH 3WLBB 1CT8B 5AEAA 2GTZA 3IETA 3L3IB 3M8OL 1TVHB 1A9EB 3U0PA 3CD4A 3RIAF 4HUUA 2XQYK 4Z76A 3IFOA 1CDGA 1CN4A 4GBXD 4EJ1C 3HC3L 4S0SD 3GJFK 1YA5A 5DLMH 3ARUA 5F9DC 5HY9B 3WIIH 2LV4A 3MLXL 3TVMD 3VFMB 3VRIA 4WFFE 4GLRI 1Z0NA 1YC7A 1H3WM 4E41B 3MRCB 1Q38A 1RZKH 2V2XA 3TYGH 2ESVA 2VC2H 1EVTC 4D0DA 4ZFOL 3SDDD 1IAKA 2FSEB 5IVXF 1XF4A 3BEVB 1G9ML 5EU7C 2MCPH 3QIBD 4J8RB 1VESA 5TE7H 5HHOD 3FL7A 2J88H 3TT3L 1QFUL 4RIRB 2JCCF 1CFNA 1AGEB 4KTDH 1CD8A 3FQNA 1KFAH 4WHDA 4Y4FA 1IBGH 1OP5H 2BHYA 5EN2A 1OGAD 1P5VA 1PSKH 1I9RH 3B5TA 1JPTH 1FYTB 4IEFB 1D5BB 4X6CF 2DTML 4OV5A 3T0BA 3GSNL 3OKEB 4ZMAT 3P9LB 3ZE2E 3QUXD 2VDQH 2KH2B 3QCTL 3QNZA 3CU1A 1LO5A 3MCKB 4ODXA 1NCAL 2APTA 1NC4D 1WIOA 2AJVH 1NCDL 1YEEL 1D9KC 4YWGL 5TF1H 2FX7H 3DHMA 4OZ4B 3LRSA 1R5WA 5DYOA 3UTTA 4UIMA 2PYEA 3P4MA 1I85C 3MRQB 2P8LB 5EU3A 2XT1B 2Z8VC 3LKOB 4RNRA 2Z31C 4WI3A 3BHBB 3CPLB 4YHIA 2R1WA 4C59B 4QXUH 43CAA 2BRRL 4G9FD 3I6GB 5I8CA 3MV01 3O8XA 1FCCA 5I2IB 5JPNA 4PJBF 1NEZB 4Q0XH 1T5XB 3G6AA 1NH6A 3I6LE 4M7ZB 1XCTB 5JOFB 1H3PL 3IU4L 4ZD3H 5C9JB 4P9HC 3VXTA 4KDTA 4MGXA 2OTPA 3RGHA 5MHSE 3X13B 3QDJB 4P2CG 3P9MB 2D31B 4WWKB 4Y5YA 1RK1A 5FKAA 1K2DA 1TQBB 4EXPX 5EOCJ 3F7YB 4L4TD 1A6VL 3KPPA 4X83A 3HR5A 4HXBH 1CVRA 2FEEL 3WFCH 3VGAB 4K7FB 1T1XA 3C5ZD 4YDLC 4I3SL 4WJ5A 1CGSL 2HAZA 2G2RA 2ADFH 2R4RH 5E8PA 4XVTH 1GJIA 3BKJL 1MLCB 4OLEA 2YBRA 4POZC 5KANI 1HI6B 4C58B 4HLZH 2APXA 4TVPD 3B2VL 3VH8G 3P0VL 1VHPA 4FMKA 1EFXA 3UTTE 4OCMC 3IDYB 4G42A 1IC5L 4QRUA 3U4EA 3V0AC 3MRHA 2IFFH 4P5TA 2GCYB 1ZVSB 1I7ZA 5I6XC 1WBYB 4ODBD 2FB4H 3S4SB 4WGVB 4G5ZL 5C08B 1TQCC 4PJ9C 1S9XA 1KLUB 1LEGB 3V0VA 1B4JL 1I1YB 2XKSA 1HHJA 4LHQB 2VRAA 1BPVA 4ZYKA 4X5XB 2X1QA 3QHTC 5FB8B 3WS3B 4IMKA 1JHLL 3E6FB 4Z95L 3TIEB 4N1HB 4MNQD 3BP6B 2X7LA 2YS4A 1KEGH 1UKQA 5F9OH 3W9DA 3JWDC 1F58L 4R7DA 4JY5L 1BD2D 1U3ZA 4XMLL 2HJLB 4ZUUA 4X6FB 3BDYL 1I75A 1KJ2B 1IC4L 4CNIB 3ZHLA 1L0QA 2NZIA 4W4NA 4JKPH 5JDSB 4AENA 1NC2A 5K9OA 3QPQD 4XB7A 3ZKND 3UJJL 1BBJB 1FVEA 4H20H 5DD5H 3MJ6A 4JRYA 1HILB 3FMGL 1E4JA 3ME0A 2VJXA 4O9HL 1UXWB 2DQUL 1F4YH 4KKCD 3QA3A 2EXYD 3D2UB 5SWSD 1QLEL 3I50H 4XCCH 1FQ9C 3NFNB 4WCYH 3SKNA 4DEPB 5ISZD 4MQTB 5T1MA 1HHGB 3GHBH 3BXNA 5CEZE 4K23H 4XBPA 1BBDH 2D9QB 1DBML 1T0NA 4XCEB 3UZQA 3AREA 4RMTA 4OT1L 3HNSL 5D71L 2GY5A 5IFJA 2J2ZA 3GRWA 3CAFA 4FQLL 4J1UA 3ULVD 1TTUA 2V2WB 2WZPD 4LDEB 5I17A 5I15H 4CVZA 4NQXA 1GPOH 4HJJH 1G6RA 3SDXA 4HIIB 4M00A 3KJ6L 5JZ7D 2P5WB 3KNBA 4HWEL 4X80H 2YPVH 3GSQB 1WIUA 4NHUA 4F7EB 2VE6A 1DCLA 2IBBA 4OGYH 4X98A 1F13A 4DOHE 4XCFL 3L3GB 5IKCB 3T4AB 4DZ8A 1CGYA 2NX5D 5CD5D 4NOBA 2XWBA 4Y2OA 3HI6H 4XCNA 1SJEA 4JFPB 5IHUH 3QQ4A 4XC1L 1NEUA 5F1OB 3IDXL 3TBSB 3ZTNL 3VXRD 2BVOA 1T83C 1N26A 4KROB 4TOYL 3VFPA 4EOWH 5HI4D 1WTLA 4JFYB 4FABH 4OD2A 1MQ8A 2I07B 5C07E 1B0GB 2RIKA 4FXGA 5HJ3B 4NFBA 1CD1B 4P2YA 5EU6A 2YPLD 5IEHB 3ZMRA 2EKSA 2VR4A 4YUEH 1E4XH 2VXSH 3EUUA 3DV4B 3MJ7B 1KUMA 3S88H 3BP7B 5TDNB 4HWZA 3SDXE 1JVKA 1I9JH 1YEGL 4D9RD 3OKOB 1DTUA 2LU4A 3F65A 4Q9BA 5I1HL 5CBAB 3RZCA 4XXDA 4OM0H 2YMXH 2X4PA 4UOW1 4HH9B 1OAUL 4ODUA 4K3DL 3GMPA 1J05A 5GSVB 1FNLA 4HXAH 4WUKH 3GUTB 1UJTA 3MGAA 4Y4KD 2NQCA 1QR1B 3C08H 4L8SA 5DJ0A 4R26H 5FA3B 3OR7A 2UVFA 1KEMH 2OTUA 1M7XA 1YMHA 4JFFB 4MA1B 1J11A 3U7WH 4H26A 1HXMA 1T1ZB 3K4AA 1GGBL 4LNRA 1T03L 4JDZB 1U8MB 1H8SA 4R8WL 3SDAD 2RR3A 5GJSL 2V6HA 1A7OL 1I8IB 4Z9KB 4KDVA 2JJWA 3AXLA 1YMMB 1W72L 2YD7A 1CDYA 1OAKL 4PGBB 4BQ8A 1B2WL 4TYUA 4CKVX 2FO1A 4H5SA 1CQYA 2NTFA 5F7DB 5GGTL 1LDSA 1C16B 3V7AG 1ZSDB 2F74A 2CKBA 1P53A 5EFIA 4OIIH 4YDVA 3QULA 4KRPC 1NGPH 4KZEL 3BKCL 4HIEB 1DDHB 3UX9B 5JW4R 3HB3D 3MV7D 4WW1B 4G80B 1A6ZB 5LAXB 4XRCA 5EBWA 4JE4B 1FZKB 3R8QA 3OJDA 2R0WL 2BSSB 4O5LH 3BSZL 1J7VR 5LCVL 3GNML 1CCZA 3U9PH 4B7LA 1IQDA 3Q0HA 3C6LA 3MRFA 3QEUB 4P3DA 1CZ8H 5HYJD 2K1MA 5GISH 4FQ1L 4FFYH 5IT2H 1YEHH 3PDOB 4ZNEA 5IFHL 2F5BL 3CJJA 5BW7C 3WFEH 4J4PA 4EQ2A 5F89A 2WMPA 3FB7B 4CU6A 2VL5A 5J6GB 4KVNH 5FUCC 3TP4A 5CJOL 4N0RA 3WIHA 3MJ9A 2ZSWB 4AG4L 2Y7QA 5BVPL 3H9SD 2HWZH 1CXHA 4E0RB 1JPFA 5I8KH 3O4OC 5F93C 1G7HB 1X4YA 2IH3A 4FQCL 4K2UH 1T5WB 4UV4H 5E6IB 3X14B 2GY7B 4HZLA 1F6LL 4YK4B 4R4NC 3GSUA 4LKCB 4XWGL 3EO9H 3CCHA 3VI3F 3H9YA 4XVUC 4DUXA 4I3GA 3D48R 3J8F7 4MMZC 4WTZG 1JBJA 2Q87A 1HQRA 3FFDB 3TJHD 4Z0XA 4CMHC 4NZRH 4OFKA 1F90H 2OR8A 2R2CA 5I8EA 1S7WA 1ORQA 4Z7NE 1KN2L 3NIGE 4RGMB 1MCDA 4ZNEE 2DM7A 3UPCA 2OTWB 4YIQA 3BIKB 1KJVA 4YPJA 2HVKA 4TSAL 3RWIB 2IBZY 4QGTA 2P43B 3HC0A 3V7MA 1JZ5A 3KPNB 1Y18A 5TDOB 4BH7A 4PGDB 4Y19A 3MR9A 3SGKA 1BREA 1JPGB 1OW0A 3WUZA 1J88A 3LSOB 2IQ9H 15C8H 1I7UA 2Z92A 2HYMA 4BQ9A 3QRFM 3C2AH 3SDCC 1CXLA 4QTHA 1U8HA 2NY2D 4JB9H 1KULA 3IKCA 4XB8A 2J12B 1YQVL 3W9EA 3CC5B 5C92A 4WY7L 1INQA 2CH8A 4NKDB 3FKUS 4JHZA 4K8RH 4JVWA 3QO1B 2NNAA 4G6FD 4PJAA 1AHWB 5TE4L 4OGAC 5ICYA 2EYSA 5DHVB 3REWB 3VJ6B 2X44D 4ZOCA 1Q9LB 3IXTA 2GKIA 5D7IF 5DMYA 2RCSH 4PTTB 3B83A 4TN9A 4JFQB 1C5CL 1P1ZB 4OCRL 5EO1B 2K7PA 3QUZD 3CZFB 3O2DH 4PRNA 2FIRT 3HG1D 3OGCB 4L3EB 5ERWA 1CD0A 4Y19E 3LB6D 4N1EA 2BC4B 2HT2D 5LVEA 1PVHA 4ODTL 4JDVB 2QHRL 2Q7YA 3FAXA 4P9ML 1MCQA 2BVUA 1J0IA 3C9NB 3ZYIA 4Z7WA 2AKRA 2V7HA 4Y8AA 4ALAH 1FVCB 3QIUB 3SGJA 3SE3A 5E9DD 1VADB 4Y2DD 5ADOL 5D1ZA 2EH7L 5BVJA 4PV9B 3GSVA 5J1AA 1MHEB 2C1PB 3VGEA 3W82A 2Y07L 4QTIH 1IGMH 3OKMA 1KG0A 5ICZA 2JB6B 4K7PL 1RK0B 2OP4H 5MI0C 4H1LG 1XGPA 1RJCA 1I1RA 4PJAE 4CJ1A 3BPLB 4BUGA 2VXQH 3WD5L 5ACZB 1EK3A 3P0YL 4X4ZA 5F1IA 4GKZA 3ALWA 2FEEI 5HHPB 3TV3H 1EH9A 4K9EC 2HMIC 3F7VA 3HNTH 4RQQA 3GBMH 1XZ0A 4MWFA 3ECBB 3MNVB 2WUCL 2AQ1A 3BYYA 4LLVA 2J3SA 1IVLA 1RJYB 5GSRB 3RHWK 1YEFH 4GS7B 3AS3A 3DYPA 2Q3ZA 3QPXL 4BK5A 5DO2C 3VA6A 3DECA 4OQTA 1AQKL 2OYPA 5HGBB 4IDLA 3TM6A 1A4JA 4X6BA 2ZPKH 4M61A 5LGHH 5B39B 2ZZUT 1S7SB 1KCSH 5I1JL 5DS8A 2FZ3B 4N8CL 3TWCL 3U30C 3ZLQC 3KLAA 3WFDH 1B6DA 4ONGH 3AU1B 3FOLB 4L8BB 3HE7B 5L88H 3ORJA 4JFXA 4LQ1A 1QSFB 3U48A 1IM3A 3H6JA 3EKCA 4CJ0A 2W0FA 4LASL 4OBSA 1KXTB 5DD0H 3BEWA 1EO7A 2QLVB 4MAUL 3DUSB 3TPUA 3WS6C 2I24N 5KVEH 2VWEE 2ZUYA 4QRSB 5EZJA 2RFXA 4EN3B 1DBJH 2A74A 3CZJA 1BM3H 1VFOA 1YQ2A 3NIFE 5DTFB 1DSFL 3GMOB 3WXWH 4B0MM 3BH8A 1N2RB 5IMOA 4FQXC 1O7VA 3BPCA 5HDQL 3IF1A 1BHGA 3EJYD 5ID0A 4KI5D 2ED9A 1EJOH 4U1KA 5DVKA 3E8UH 1RVFL 1HWHB 5DJAB 1DN0B 1ZS8B 4HQQH 1ZOXA 5ABDE 1QFHA 3GRWL 1UWGL 4K3JL 4AIZA 1U0QA 4DGYH 4X7SL 5ID1A 4HGKC 3DSFH 1MHHB 1T04B 5CBEB 1G6RL 2XKNB 4NT6A 4OFIA 2GT9A 5CHNB 1HHKA 3HUJA 4OF8A 4X8JB 4QRPB 5I74C 1A1OB 2DKUA 3QQ3A 1KTDA 4LHUG 4P23A 1Z9OA 1W2KT 2B1AH 1NBQA 4IS6A 1EO5A 2VDML 1IGYA 5CIPH 4Y5VC 2WP3T 4RGND 1E27B 3VFRA 1MJ7H 1K3IA 2EXWD 2HKHL 2P5EA 3FT3A 1IKFL 5B3NA 1N7MH 2VIRB 4QRRA 1YNTA 2WM0A 2H26A 4O58H 1SMOA 2R2EB 4QF1B 4FXLA 4M8QA 4ONOA 2UYLB 3GI8H 5C0ND 2A9NH 2P8MA 2VLRD 3NIDF 4FQPA 5CCKH 2AJ3B 4O00A 3N1QC 4NBZB 1K8DA 4XPAL 5FYJL 2FD6L 5E6YA 4MCYA 3PGDA 4H25B 3GFUA 5EBLA 1HH6B 3SGDH 3W5NA 1UYWH 4Z7QF 1EGJA 5IFAL 1RZKC 2D7NA 1J8KA 3BOVA 2XZCL 3D3VD 2P45B 3T2NL 3DJ9A 4XNUH 3C6SB 4RISL 5J7CC 3MLTB 1XR8B 5J56B 4MQXD 2ILLA 4PJFF 5IB1B 3HUJE 3RTQD 2ICES 3OX8A 4G7VL 3GSXA 4PRID 4YE4H 4ZFGL 1D5MB 1UEMA 4IOSD 3RGVB 5I16B 4XI5C 2Q7NA 2YUWA 4LSQL 3DBXB 1FE8H 1RUML 4YR6A 1JFQL 5EZIH 2HRLA 4P4RB 3UTSD 5C0EA 5JUEH 1FLRH 2FH8A 5DMKB 4BKLA 2P5EE 1RZJH 3KXFA 4QRRE 4UT9H 3RJQB 4NYLA 2WBJA 5HGDA 5JXED 1KCKA 4Y1AD 1AO7A 3X3FH 2DQEL 4HV8B 2EDNA 2VDKH 5CP7A 2VLKD 3O11B 3SHSA 5FECA 5EA0H 3PNWB 4X6DF 1R24B 2NY5L 5JOPD 3M8OH 4I0PB 5E2UL 2AEPL 1EAPB 2K3TA 4DKEL 3ARBD 3K3QA 4AQOA 1E4WH 5CGYD 2ARJA 3ULUL 3HC3H 4PGCA 3NZHL 1MSPA 1LK2A 2F5AL 3MLXH 5D1XA 4UT6L 1P6AB 4H0HB 3GGWA 3RA7L 5LGJB 4GBXA 3QCVL 2IH1B 2VLJB 5DRNA 3VXPA 4GAYB 2FX9L 4AIXA 2HRPH 4OF0A 1NAMH 2DQFB 2AV1A 3TVMA 4RAVA 3MJGX 3KXFE 3D18A 1G9MH 2NXZB 3D0LB 1OTTC 3RRQA 4PP1D 4NO2A 3O3DA 2A38A 1AO7E 3F5WA 4IM8A 5IMLB 2I25N 1Y6NR 1JUFB 3STLA 1VEPA 3TT3H 1L7TL 1QFUH 2Z4QA 3FOMB 3SDDA 3SKMA 3ULSB 5T5NF 2ADGA 5HVFB 3KWWA 1QA9A 5ACLA 3U36B 4PJIA 3QIBA 5IHLB 1I1CA 1LO0H 4NQVA 5HHOA 2Q76B 3VWKB 1DE4A 1UVQA 2YD2A 3P40A 1EMTL 3BZ4A 3QWQB 1MFNA 1OGAA 4MJIB 3ZHKA 2CGRL 3QCTH 5IK3A 1MFBL 5HGHB 3ARGD 4JM2D 1NCAH 1NCDH 1YEEH 4N90D 4UZGA 4HHAA 3G5XB 2P1YA 4LAQL 4LBEB 1QBLL 1QTYT 4OZFA 3MMEB 1IKNC 1JGLL 3QUXA 2VITA 1ZLWH 4GMTL 3P2TA 3W0WB 1OY3B 5DJCA 2GFBA 4LDOB 1NC4A 1A64A 2R15A 4LCYB 2BRRH 4LFHD 5EU4A 1U92B 4YO0B 1YN7A 3DRQA 1FV1B 5DRZB 1VSCA 1F2XK 2YXMA 1YYMH 2PUQT 1X5YA 3DI2B 1Z2KA 4G9FA 3QIWC 1DUZA 3WUWA 4GAJL 4Y4FC 2DIAA 3T09A 3OAZK 4PJIE 5HHOE 2HJKB 3EO0A 2GIYA 3DOSA 4CVXB 1BF8A 4HUVB 5DDHB 4HC1A 1EX0A 1RUQL 2KQNA 2H3NA 3K46A 3DXAB 1OGAE 3HZKB 4I3SH 1CGSH 3Q3GA 4YQXL 4N0UA 5C3LD 5DT1L 1MUJA 1TTFA 5F3HA 4ZPTA 1ZA6B 5C0GB 1KLGB 4PD4K 1FCGA 3B2VH 4N8VG 1IFHH 2CO7B 2E8YA 3C5ZA 5ICXB 1MHPH 5T3ZH 4PJ8D 5EDXA 1NMBL 2FGWL 2Z8SA 1WC7B 2GSGA 4ODSL 1SBSL 2FBOJ 3O8XC 4WW2F 3LQAL 2C1OA 3FT2A 2GUOA 5FGRA 4G5ZH 2DN7A 5GJTL 3SO3B 3B2UC 3T8XA 4HPYH 3TBVA 9CGTA 3K2UH 1AP2B 1CICD 1VFAA 4G9FE 1KCUL 2NY6C 4KDTC 3TBWA 3BQUB 3W39A 2IGFL 2HN7B 2R39A 1JHLH 1XAUA 4Z95H 1J12A 1UJ3B 5FO7B 3QFDA 3VD7A 3ZZ1A 2A73A 4CU7A 1P4IL 1CGVA 1F58H 1P6FA 4ELMF 1S78D 43C9A 1N0LA 3IFPB 1OAQH 3VDAA 4N0UE 1JCKA 2R0KL 4CW1B 4L4TE 3BDYH 1IC4H 2YD8A 2PW1A 4WO4B 4CGTA 2ZUQC 3UJJH 2A6DB 3ARXA 2HLAB 1ZGLM 2HT3C 3FMGH 1JN6A 2HT4D 3GI9L 4NM8L 2Z93B 2DQUH 1F97A 4U6TA 3DUHA 3SCMD 3UYRL 1BIIB 4I13B 4P5TC 4TVPE 1DQTA 1A6TB 4WI9A 3S3PA 4Q9QL 3FO0H 5E0QA 5F7WC 5CD3B 2XA3A 4GRLB 3HPJB 1D3CA 1SEBB 4F15B 2NXYC 5SWSA 1DBMH 2FH6A 4GKSB 4WUUB 1BWWA 1PG7L 4IMKC 3S5LB 1PDKA 3C5SA 5ISZA 3HNSH 5D71H 3F6IA 3TO4D 2J8UB 2H6PB 2R23B 4PRBA 4ZUWB 2AQ2A 5GS1A 4OQTL 3B6SA 4PJEA 4WW2B 4LCWB 4DN3L 4MNQE 1P4LA 2XWJB 5A2LH 5D93C 3DMMB 1JNLH 1XH3B 1L9NA 4ZXBD 1ED3B 4O2CA 4XCFH 3V52L 3HMXL 5A3IC 2IPKB 3BH9B 1BD2E 3MLWL 3G6JB 3P73A 3HNVL 4YAQB 4LLDA 1NAKL 1FDLL 5E4EB 4GW1B 3LEXA 4Q6IB 1T7WA 3MV8B 4HW6A 3IDXH 4DTGH 3DX8A 4P99A 3L1OH 4MSWA 2NX5A 1ACZA 3KJ4B 2BSRA 3PGCA 3MBEB 1WWBX 4J3SA 1V7NL 4DKFH 5SWSE 5GGRY 2QADB 1JNJA 3VXRA 5EUOF 3AREC 4OLVH 1EAJA 5DJXB 2H32A 5ISZE 1TXKA 3RVTC 1S7XA 4Y4HD 2FIKB 2OJZL 2P7TB 3U9UB 3B9KD 3JTTA 5C0JB 4P3CH 1D5XA 4N0FA 3I75B 1UACH 2CQVA 4X6CA 4MCZA 4PJEE 4ISVA 2H8PB 1A6AB 1MRCL 1YEGH 3V4VL 3GSOA 1I7RB 2HJFA 2ORBL 5IWLA 2YPLA 3ULVE 5I1AA 5C2UB 4E42A 5E24E 4NHCH 3T77B 3MROA 3OGOE 1AGFA 5E8NB 3KPOA 5DEGB 1L0YA 4LARH 1CVSC 2F15A 4LRNL 3WNPA 3LDBB 1NGYB 3VFNB 5GS0L 2DWEA 4U3CA 4XH2B 4K3DH 4XPFL 5DUPL 1FZMB 3MBXH 5FXCH 5K33A 4KHXL 5D1QC 2HFFA 2NX5E 4LSTL 2IPUK 2BERA 3E0GA 2R1YB 2MFNA 1KB5H 1UWXH 4QT5A 1N5AA 2JJSA 1A7PH 5C3TA 3BZEA 2KL6A 3LKNB 1CFSA 3VXRE 3MUGB 3GK8L 2EDTA 4Y4KA 1VGKA 4OCXL 4GRWF 3H8NA 4R7NA 1BJ1H 4Z5RA 4R8WH 4YBLB 2ID5A 2FYYA 4XNYL 4OZIB 1A7OH 1IEBA 1HSAB 5JPMB 3LQZB 5GZND 2LVEA 1YPZA 1FORH 4ODHH 2WIIB 1W72H 1Q0YL 1BVLB 2ICEB 2YPLE 1B2WH 4R97B 5GGTH 1WZMA 3SDAA 5TJWK 1EGJL 2YKLH 1TCRB 4LSRL 4O51A 1IEAA 1G7QB 2KKQA 1HH9B 4D9RE 1XCQB 5D8JL 1RZ8B 4FG6D 3BN9D 1G9NL 4NQCD 1EEQA 4I4WB 4L8SC 3VDCA 5E5MB 2R0WH 4UAOC 4R2GD 2ZUXA 1DP0A 1VERA 1SVZA 4ETQA 3MV7A 4U1JB 2EDXA 2NMSA 4G8IB 4QXGL 4RRPG 1JK8A 2NY3C 1N3NB 2UY7A 5DVLA 1ZAGA 1N4XL 5DURB 5D7SL 1UM6H 1QBML 2DTSA 1JYNA 4XBGB 4FQ1H 2I9TB 1VFUA 1IAMA 4PBVC 2VB5A 1WV7T 3LN9A 4FQIL 1YPZE 5IFHH 2F5BH 5FA4A 5HYJA 5DUMH 3GJFA 1QNZL 4HEPG 4MA7L 3AAZB 5FK9A 2CLRB 4OCSL 3FO2B 3T0EB 1I9IL 5EC2A 4U1LB 2CDEA 1I3GL 3JBG7 4ZOAA 2AXJA 5D2NB 1QACA 3MLSL 1QKZL 3U7YL 2ADIB 4FQCH 3GMMB 1U41A 3FQWB 5HHNB 4E41D 5MEOB 4X7EC 1JWSB 3B9AA 3WFBL 4DGIL 4O2FB 3H9SA 4RAUB 1NUFA 4U31A 4XWGH 1YN6B 5D72H 4GW4B 3MV7E 4KKBC 3T2QA 1IGCL 2H1PH 4XP1L 1DR9A 2EDQA 3C6LC 1JZ2A 2D7TL 4PJ9D 3U7AA 4BSVB 3MGOB 5DQDL 3QUYB 1FC2D 2CLZB 4ODVL 3RP1A 3RWHA 1C08A 3O3AB 4JANB 4HJ0D 5GIRB 1SEQL 2QSTA 1TENA 1BVZA 4WDIB 3VXNB 1A6UL 3E1F1 4NRYB 5CMAB 3W81A 4BH8B 5HYJE 1JGEB 1FYTD 4OF7A 4U6YB 4J4PC 5F70A 2W9DL 3LMJH 4NFCA 1UZ6F 4TSAH 4L9LA 2O5YL 3JWOC 3EYQD 1FFPB 2MCG1 1QFWL 5FM5M 4G8GA 3WLWD 5CIPB 1QO3B 3IXAB 3KPQB 3UDWC 4R6UA 4XXCA 4A6YA 2WQRA 2UWEA 5HYSG 1YQVH 3CVIL 3H9SE 1P9MA 3BP5A 3DETC 3Q5YA 3PDDA 4F9PA 5C0RL 4WY7H 1RIHL 4XNMB 1X7QB 3FONB 5KAQF 1YY9C 4PTUA 5DD6B 2CDGB 4X4XB 5J6HA 1RIUL 5CWSB 1LP9F 4UQ2A 1XF2B 1MH5A 1XGTB 1T1YB 5IMMA 5DHYB 2VLMD 3G5ZA 1XMWA 1TZIA 2P44B 32C2B 2YEZB 4DFHA 1BFVL 1F2QA 3OG4B 3QDJD 1NLBL 1F11A 4FQ2L 5CSZB 1JV5A 1UT9A 4H1LH 1XF5A 5IM7A 3FT4B 2YA0A 1P7QA 4J2XA 1IAOA 3P9WB 1IGIH 4ODTH 4W6YB 3SGKC 4LVEA 1OW0C 2B0SL 5EIIB 2C3WA 5AYQA 2LTQC 4P9MH 2HP4A 1YDPA 3QXWA 3M17B 5D2NC 1HXYA 2D03H 2DOCA 3QUZA 5M95B 3P11L 3KDMB 2X4OA 3FQXA 1QLFA 1N6UA 3BPOB 4U3XA 1JWUA 4GOSA 4MZ3A 1OGTA 4HZAA 2UWEE 2NZ9C 1U8KA 2EH7H 4PG9B 3G04A 4P57B 5BQ7A 2Y07H 4XVSL 1IT9H 3JV4B 4JQIL 4K7PH 4XPHL 3WL9A 2V7NA 4B50A 1GCFA 5E9DA 1IMHC 3KYMA 3WD5H 4Y2DA 4EUPA 1AKJB 4QHLB 3P0YH 5C08D 1MVFA 2VABA 1U2HA 5D7LB 4X0KB 5JHDB 4NQEB 4P5MA 4ZTOL 1JL8A 2N1KA 3P4OA 4Y8DC 4NZTL 3QPXH 4YHYB 4U49A 1JZ7A 1TVBB 5F7NC 2HH0L 2Y1VA 2O61A 1M71A 1QFOA 3BKML 4FXKA 5KS9A 4LPUA 4F7CA 3L3JB 5I1JH 3DGGB 4PJCA 3MLRH 3QAZB 3JWNC 3TEUA 3G5YA 1WWAX 3QJFB 1HZHH 1LP9B 2VDOH 3SE3C 4PLKC 4LASH 1XIWB 5D1ZC 4JQVC 1H5BB 3RWCB 4MAUH 5C7XL 2EYRA 2X41A 1ZHLB 4YZFE 2XY2A 4BA8A 1G1YA 3BPNC 2VWEC 3D2UD 1G7PB 3G6DL 5I8OH 4JZOA 5E9DE 1Q0XL 3L7EB 5TF0A 4MQ7B 3GB7B 2P46B 4FZEL 1UH2A 3P4LA 4NKMA 1CL7L 1CFQB 4YH6A 4XP4H 5F7KC 3GSNB 4OLUH 5HDQH 3CFJB 4WV1A 1IZKA 3FN3A 5ALCH 1AD0B 1ZT1A 3GKZA 5BV7L 1OP5K 3IDIA 1YEDB 4NO0B 5KS9E 1AFVH 3DIFB 4M43H 3SEPA 3RL1B 4PJ5D 5DJDB 3RUGF 3MACL 4PJCE 1KB9J 4KPHH 4X7TA 3EGSB 4F8QA 1CDCA 4X7SH 2A1WL 5D5MA 2P5WD 3U0TB 4FHBD 1AGDA 1ZT4A 2ZKHL 1BOGA 3C60A 5EB9A 5HDBF 3VFWB 4N8PA 1BEYL 3W2DL 1T21A 3RNKB 3ULVL 1LEKB 2WNGA 3ZDZE 5IHZB 2WW8A 3EYFA 4FZ8L 1T66C 1Z5LA 2PCPB 4R90H 5IG7B 3NN8A 4RFOL 4OZHA 1NBYA 2Y06L 2VDMH 2Y5TA 2FJGA 4MD5A 1BGXL 2HKHH 4KROD 1WZ1L 2J5LC 4OB5L 5INDB 3L3OA 3QBTB 1OD9A 4M1CD 4APQC 1YZZA 5JO5A 2DJ4A 3QXUA 3VFUB 5F7MC 3GHEL 4XPAH 4JCLA 2F58L 2FD6H 2FEDC 5FYJH 2G75B 1WTGT 3GM8A 4IOIA 8FABB 4MB3A 1EBAA 2BOCB 1T80A 5IB4B 5FCSH 1SYVA 4U6HA 1GZPA 4NKOB 4Z77A 4F7PA 2VLRA 4M9OA 4KI5E 2ZUTA 3V5DA 2GSIB 5D5ME 5IFAH 1BFOB 5DA4A 2XZCH 3PWVB 1ULVA 3WNKA 1L0XA 3NCBB 2R1XA 5J3HC 5IV2B 4AT6B 3WHE0 3L7FB 1HYSC 2XNAB 5EOCL 3VRLE 4HFUL 4FFWD 1NBVL 3QNYB 3L3KA 3DVFA 3PV7A 5B3JF 2AEQL 3D5OF 4G7VH 3GMNB 4JPIA 1VACB 1MJJB 5JOEA 3EHBC 3D3VA 4JQXA 4P23C 4OZHE 1RUMH 4MDJA 2GW5A 3C8KA 2K7QA 3IDGA 1YY8A 2YRLA 5J11B 5L2JA 1R3KB 3RTQA 1OAZL 3O4LA 4PRIA 2G60L 4YGVA 4EI5B 3V8OA 3I02B 4MAYB 4L8CB 1CE6B 4ZAKC 4JFFD 3RWEB 4L4VB 3UTSA 1MWAH 3MFFB 3MNWB 3QO0B 5L0QC 2DQEH 5EZOH 3VG9C 3S37X 3T1FA 4RGNE 3BE1H 3QQ9C 5LGKA 1MQKH 2DBJA 5D7IA 4XCYA 1H9VA 4XGZA 1RJLB 1ND0B 3OKNA 3T4YA 3WO4B 3S96B 2ZOLB 1QSEB 3HAEG 2NY5H 5C0BB 5JXEA 3O6FC 4Y1AA 5D6CA 2AEPH 3QRGH 5E2UH 5K9KA 2VLRE 4DKEH 3OXSA 2CO6B 5J13B 5FYKH 2DWDB 1YMMD 3MRIA 5HD8D 5I1DB 4JFOA 5M7QA 2VLKA 3SKOA 1OTSD 2Z8WC 3NZHH 5IBLC 4S10A 3FO1A 2F5AH 1M7IB 1QSZA 5JNYB 1OQXA 5INCA 3D3VE 1IE5A 1ZLVH 3PIQA 3QCVH 4KMTL 6FABL 5F88B 3VMOA 3KYOB 2LU7A 1E6OH 2DYPD 2WWMD 4PRIE 3NCMA 1U3YA 4MXVE 4ORGA 3KS0H 4JFDB 4KK8D 4JLRB 4RCAA 4FP8H 3EO1B 3UTSE 5EC1B 2R9HD 4JRXB 3OXRA 3V5HB 4DQOL 4D0BB 3CNKA 1U8PA 3P30H 2ICWI 1AXIB 3WFHB 4Q7DA 4Y1AE 3UMTA 3LOWA 3T08A 5JA9A 5IVZB 3ROOA 3SPVA 3HE6C 1WFTA 4NQTA 1LE9B 2NY0C 2VLKE 5E5UB 1EMTH 2FL5A 4M4RA 3RY4A 5JOPE 1WJ3A 2CGRH 3TA3B 4LIQL 4OIAA 1MFBH 1NFIB 5ILTL 2R0ZL 3H9HA 3U46A 3VXMB 4NC2B 4GBXC 5HYFA 2JK5A 3X12A 3O2VL 3LKQB 5LQBL 1NDGB 2NW3A 2HVJA 4R3SB 5KSBB 4JFHD 4HS6B 3RY6C 1SYSB 3Q6FA 4GMTH 4RMWA 3TVMC 3ARGA 4HWBA 4JM2A 3MV9B 1BP3B 4OF6A 4UOJA 1YEJL 3ARDB 5GRUL 2E7HA 3D0VA 3P4NB 4IRJB 1R5IB 1MCRA 3DX7A 1MCFA 1HSBB 3M1BB 5I1IL 4OZGB 5DFVD 3HMWH 3UTOA 2MQ0A 4JM4L 3VXSB 3SDDC 4JRWA 5H8DA 1A2YB 3K7UA 3B9DA 3OBAA 1HINH 3DX9B 1NUDA 4GAJH 5SX5K 4OD1L 3L5JA 1GGUA 1NGXA 3H2WA 3QIBC 3QUMA 4KJQD 3DROB 5DO2D 1E28B 3SQBA 4D8PA 2WINB 2X4NB 1B0WA 3EFDL 4XP6H 1RUQH 2Z35A 1MI5B 1X6LA 2GJ6B 5F3BA 4RFEB 2KBGA 3LD8B 5DT1H 5E99L 3V5KA 3DLQR 5EO0A 4WENB 3MODL 4HKJB 4LQFL 5HPOA 3QUXC 3FQTB 3QXAB 4HK0A 1NMBH 5DWUL 1IEHA 4ODSH 3ZE2F 4N90E 4MD4B 1SBSH 1MHCB 2EYTB 3MNZA 3WEXB 4V2CB 4KRNA 3LQAH 4S1DD 1CDJA 4JKWA 4ZTPH 4E5XA 5I73C 4PJ8A 5GJTH 5C2BH 1S7QB 1NANH 1NFDA 1W72B 1T3FB 5A1AA 2BDNH 3IGAA 4JO4L 1LD9A 1QFWI 1QZ1A 3OAUH 2IGFH 3QUKA 4NN7C 2MOVA 5CJQL 1ZWIB 1CICA 1P4IH 2R2BB 1ZKAA 4HFWA 1UWEL 1XGYL 4M62L 4Q58C 5GGRA 1A7RL 3F12B 4LHJB 2R0KH 1JWMB 3ARZA 4LVHB 4PJFA 3AGVA 1XGRA 3ARFB 5I0DA 3NTCL 2E6PA 4TUJB 4LRIA 5DJ8A 4G9DA 3FB5A 3QIUD 2OZ4H 4DN4L 3JUZA 3NVQA 4NM8H 3WBDA 5KBNC 3MJ8B 4I48B 5H2BA 5EZLA 1JGUL 3B9EA 5L8JB 1F3JB 4EVNB 2R69H 1Z9LA 1Q9KB 4YFLF 4RGOH 2FX8L 4QRTB 4DW2L 4F3FB 5E8DL 2E7LA 2DAVA 1NFDE 5IJVB 2DS4A 1JIBA 1HIMH 1S5IL 2GTZB 3KPMA 4LVOC 5CEXB 1PG7H 2P48B 3CDCA 4NBYB 4GG6E 1K9TA 1I7TA 2V5RA 3IFOB 1UENA 5I1CL 4DJMA 1EO8L 3RVUD 5AWNL 2PXYC 5AUMA 1TJHL 4JZJA 1JNHB 4DN3H 4U7SA 4JO1L 5DEFB 1LQSR 1U8IA 3O6KH 5HHQA 1S5HA 2W60A 2ESVB 3HE7D 2VLLA 3V52H 3HMXH 3T0XA 1QSFD 3HNVH 4D0DB 1X6NA 2DQCL 3QEQB 4OFPA 1FDLH 1Q9WB 3O9WB 1T7ZA 2PTTA 3RVVD 3WNMA 4JN2A 2NLJA 3BD3A 3QPQC 1JGDB 4U33A 3U6RA 3ZKNC 5IESL 3FO9B 3V6FB 2CDFA 2OL3L 4EN3D 3NFSH 1CR9H 1FHGA 3P0GB 5HHVH 5C09B 5JORB 3U79A 3NPSB 1FG9C 4GKNB 4KKCC 1QEWA 2PNDA 2ZCHH 1T1WB 2PKDA 5BZWB 2OJZH 4OV5B 4M5YL 4L3CB 1G7JB 4QCIA 3QNXA 5K93A 2DI8A 4G6KL 2OM5A 2OR7A 4JO3H 5GS1C 1MRCH 4LSVL 1PX3A 4UOW0 1ADQL 4Y4HA 1WQVT 4B53A 1C1EL 3B9KA 5KSUA 3ULVC 3LRSB 1KIUA 3OWEA 1Q94B 5DYOB 3U83A 4ZDHA 5JMRA 1XGQA 1M6OA 2PYEB 4M1DL 2JJTA 5C6TL 4LRNH 2P24B 1S9VB 3CH1B 2W65B 4J3WA 4TUOA 5JZ7C 4QRPD 1CL7I 1MIEH 2UZIL 4QO1A 5FF6B 5A2IH 3IVKB 4G6JL 4RX4A 4OFDA 4KHXH 1GOGA 2X2YA 3LS5L 1PKOA 4LSTH 5CD5C 2EEBA 3LS4L 2D4DA 1M1SA 3H42H 4OF5A 5E00B 4NN6C 1FH5H 3QWOB 2D7MA 1OTTD 5EORH 1WCBA 4H1LB 4NWTH 3W11D 4Y5YB 5FKAB 1K2DB 3GK8H 1YJDC 3LIZH 2XICA 1RUAL 3KPPB 5GGUA 4J6RH 5I76A 1V05A 1OF2B 5MEPA 2DQTL 5HI4C 3CVHL 3HHRB 4XNYH 4BSWA 1UQSA 2EDYA 2WUBH 5F7EL 5E8PB 2G2RB 3VFOA 1L6ZA 3DURB 3IAQA 2Y36L 1X5JA 1YNLL 4TQEH 2HG5A 2X42A 1RIVL 4YDJB 4M93C 4CMMB 5IWLC 1ZLSL 5CSGA 5IW1B 3BW9A 2E8ZA 4NKQB 5KSAC 2AQ3A 4HX1A 2F54B 2GJZA 2XG5A 4AQ1B 4XAWL 1FZOA 4QNPE 4QRUB 4EQ3A 1JHKL 1NJ9A 3UP1A 3A6CH 5D8JH 3PJSB 1T4KB 4WFHD 5FYLH 3RGVD 4KDWA 3SDXF 4R0LA 5BZDA 2O93L 3TO2A 4WNQA 4J12A 1G9NH 1L4IA 1K8IB 1QOKA 2DKSA 1S9XB 2JLLA 3ZO0A 5IB2B 3PUCA 3RVXC 2AJUH 4QXGH 2ZJSH 4QWWD 3N85L 3MRJA 3DRTA 2N7AA 1I85A 4NQCA 4Y4KC 5DJ6B 1X5FA 2EE9A 1G7IA 3W9DB 1ZHNB 1G0DA 4XWOD 3QIWD 3IDNA 4J3TA 2B4CH 5EU7E 1AGBA 1EIBA 4HLJA 4FQIH 3CFKB 4I0PD 4IIQC 2W0LA 4I5BA 1K4CB 4NZUL 3W5MA 3CFDA 4AENB 1NC2B 5K9OB 1QNZH 4MA7H 4OCSH 1R5VA 4JRYB 3VFTB 1I9IH 3WLBA 1CT8A 1JF6A 3N9GH 4POUB 4JKLA 1I3GH 2PTVA 3JUYA 3L3IA 4Z7UB 4D2NA 1AXTL 3WHXA 1A9EA 4PS4L 1S9YA 2WIMA 1EXUB 3LKPA 5I1GL 3QA3B 4DCQB 1QYGL 1QKZH 3U7YH 4HCRA 3PWUB 2A6KB 3BDBA 3JV0A 2VLJD 1QR4A 4DGVL 5DFTA 5T1MB 3IAGC 3UYPA 5HY9A 4YHNA 4NJ9L 3BXNB 2ATKA 2EDEA 3OKKB 4F7MA 3VFMA 4XBPB 3KPSB 4LSPH 4LHUB 3HB3C 3MRNA 1T0NB 1CGXA 1IGCH 2XACC 4ZQKB 2NXZD 4E41A 3MRCA 4L5FL 4NQCE 2D7TH 4KVCH 3BT2L 2Q8BL 1CGTA 4J1UB 2G9HA 3PL6B 5F6HI 5DQDH 4U1SB 5AAWA 3R1GL 1DQQB 4ESKA 5JMOC 2C3HA 3CIQA 1PLGL 2DLGA 4J8RA 3VW3L 4PJ9A 4YHOL 3VWKD 4D3CL 4PY7B 1RZ7L 2W9DH 4RIRA 3LH2H 2O5YH 1K6QH 1AGEA 2YA1A 1QFWH 1KCVH 2XWBB 4MJID 1SJEB 2C4FT 4MB4A 1FYTA 4W68A 5F6IB 2BNQD 1IGFL 1EJ6A 5TE6L 3OKEA 5GHWL 2EE2A 3P9LA 5DZOA 3RWDB 1S8DB 2ZOKB 3VFPB 3CVIH 1B90A 5CLWA 2FDBP 3RDTB 5C0RH 3W0WD 1RIHH 1CE1L 1OT1A 3HR6A 3ZT6A 1U8JB 4W4OA 3QDHA 5EPMB 1TIUA 4E41E 2YSSB 2YOCA 1ZEAL 1RIUH 5EU6B 3MRQA 2P8LA 3K1DA 1LE5B 2CD0A 4OLWL 3LKOA 4XC3H 3U4AA 2X4RB 3CPLA 1X5XA 5JW3L 5MEND 5B8CB 3I6GA 1SM3L 3EYVB 5I2IA 1BFVH 1NEZA 2XI9A 5ACMA 1NLBH 1MEXL 1T5XA 4FQ2H 4OJFL 5CINL 4UINL 3TJHC 3QHFL 5JOFA 5TQ2L 3GKWH 1W0VA 3QUML 3IAPA 4O2EB 3KYKL 4L9LC 5C9JA 3RZCB 4XXDB 4WFGD 2PO6B 5GZOD 1AJ7L 3X13A 4NRZB 4OCWL 1JYVA 5DFWH 3P9MA 4ODUB 2VSCA 3GMPB 1J05B 1FYTE 4Z7NF 3F7YA 3NIGF 5HVHC 1S7UB 1LO4H 3MGTB 5GS2H 5HI5D 4XXCC 3NMEA 5KOVC 2GITB 5F7FA 4K7FA 4QXTB 3EZJB 5DJ0B 3IJSA 1V7ML 1BLNA 4M6ML 2O5ZL 2E27L 1MLCA 3HC4L 3QH3A 4F9PC 2RQ8A 2GK2A 3WIFB 4XVSH 1A4KA 1YMHB 1HHIA 2X5PA 2NY2C 4Q9RL 1F42A 4U1GC 1OSPL 4LP5A 3RI5K 4P4KB 2VDNL 5GGVL 4WRLA 3HI5H 2FRGP 1HN1A 3FQUB 4J7RA 3FB8B 2IAND 3NABL 4I1NB 4ZFZB 1UCTA 2GCYA 3BQUD 1HKLL 1ZVSA 1T83A 5BRZB 4U1MA 4NZTH 4YDKL 4RBPH 3S4SA 4LMQI 5C08A 4QXWA 4H5SB 1MJUH 2X1WL 1KLUA 1I1YA 2VLME 4X5XA 3PHQB 1MCIA 3QDJE 5FB8A 4NSKA 5FUZL 4J3VA 3WS3A 3E6FA 4TVSa 5ANMB 3O3EB 1MFDL 4JAMA 5KVGL 5TH2A 3QUZC 3VD3A 25C8L 5F6IC 5I18H 3LB6C 4F2MB 2HT2C 1WT5A 3OJDB 2HJLA 3X11B 4H8WL 4X6FA 1XT5A 1KJ2A 5JDSA 3G6DH 4XTRD 4P3DB 1A7QH 1MCPH 1Q0XH 1UKTA 4IJ3B 3THML 1HILA 1LVEA 4G43B 3Q6GL 4GRLD 1UXWA 1FNEB 4MA8L 4FZEH 3TJEH 5CZVL 2FHCA 3D9AL 1J1OL 3D2UA 4J3UA 5B8CC 1IC7H 4WUUD 4UQ3A 3NFNA 2IAMB 5C08E 1KSRA 4C57C 1IILE 1HHGA 4PJXA 1CGUA 4PJAF 5IBTH 1T6WA 3ARQA 4XCEA 3MACH 4PLNC 1JPFB 4HK3J 1PYWB 2JIXD 4LCWD 4Z78B 1A6PA 2A1WH 3EAKA 3DNKA 4MXWL 4N0CD 4UB0H 2Q86B 3DMMD 2ZKHH 2V2WA 2Q8AL 4GXVL 4PJ5A 1L7IH 1FRGL 1BEYH 3W2DH 3GSUB 1HE7A 4ZO6A 5F7UA 4LSSH 4ORZC 2DF3A 5T33L 3I2CL 4NCC1 4X9FA 2P5WA 4FOMA 4UDUB 4RFOH 3JV6B 4F7EA 2CIKA 3MV8D 1ZLWK 2Y06H 5B21A 3T4AA 3QSKB 2PYFB 3TZVB 2H2SC 4NFDA 5CILL 5IIEB 1QUNA 5I8EB 4OB5H 5KJRH 3MBED 3HFMH 1BX2B 4JFPA 2AERT 4HJGB 1AY1H 2PTUA 4YHLH 4PB0L 2QADD 3BO8A 1UA6L 1KN4L 2HFEB 2GK0B 2YD4A 1KJVB 4KUZL 1JF5A 2H9GB 4PJXE 1V3JA 4NBXB 1FFRA 2F58H 1CQKA 4XNQB 1S7VB 4GQ9L 4JFYA 4KZDH 1VPOL 1FZJB 5DXWA 3DUUB 3NIFF 4OLXL 2I07A 1B0GA 3TYFB 4U0RB 5IEHA 3MRPB 4IRSB 4RDQF 1QRKA 2CPCA 5EOCH 3DV4A 3QQNA 4PJ5E 3IKCB 1NBVH 3MJ7A 1INDL 3BP7A 4JREB 5TDNA 4K8RD 2AEQH 4BELD 5BW7A 2VISB 3OKOA 2P5WE 4F7TA 1F45A 3HAEH 3RL2B 5I9QB 5T5NG 4BFGA 4GMSL 3CMGA 3M07A 5CBAA 4HDIB 5TPWH 1CYGA 1OAZH 5F97E 1KF9B 3MRBB 4PRAB 4XPBH 4KKBD 4IRZH 1GAFL 4FN0A 3IXTB 5GSVA 2R56L 3MCLH 1R3LB 3O45B 4GW5B 3AROA 4RGNC 1F02I 1FSKB 3MOBL 1FPTH 2EXWC 5FA3A 2O26U 5I71B 1PQZA 3AMLA 3OAYK 1XR9B 2OQJB 4JFFA 3H0TB 1KBGL 5C0NC 2L4OA 2Q7YB 4BK4A 4JFEB 1T1ZA 1TZGH 1A14L 1AI1H 1RMFL 2EO1A 4JDZA 5DC0A 4Z7WB 3E2HB 1U8MA 5K9QI 1WWCA 4NZJA 3PWNB 1I8IA 4OLYL 1MJ8L 2MTPA 4OI7A 1T2XA 4JJ5A 1KG0B 1YMMA 5ICZB 4UI2A 2VZVA 1A3LL 1XGPB 4PGBA 2L7JA 2F8VA 2UUDH 3UJTH 1M4KA 4ZS6C 1C16A 3TBYB 4MQXC 1ZSDA 2AK4D 3RTQC 3ZT5A 5F1IB 4RA0C 4NNYB 4IDJH 3BZDA 3F7VB 1XZ0B 4HIEA 1DDHA 2BCKB 3V9FA 3HUJF 5ENWB 4WW1A 1FBIH 4UBDD 4G80A 1A6ZA 4K71B 5LAXA 2XA8L 2Y6SD 3WNOA 2HKFH 1FZKA 4QHNB 2X9XA 2DYPA 4AH2B 4X6BB 3G9VA 2OK0L 2F53B 2DMBA 5DS8B 2E9WA 1F8TH 4JFFE 2A77L 5JXEC 4YXKL 3NCEB 4PGJA 3QEUA 1WIPA 4X99B 4YXHL 5T1DL 1I8KB 4MNHA 1NCBL 1WF5A 5IJKC 1QLRA 2QQKH 3NCJL 3WNLA 1CXFA 3T0ED 4OKVB 1OLLA 3PDOA 4LIQH 4P9HL 5FKPB 5ILTH 2R0ZH 4JREC 1A1MB 4HH8A 1DLHB 4JR9H 2AXHA 3ARBC 1FC1A 3BD5A 5M94B 1YMME 3NACL 1BFTA 1X5ZA 35C8L 5CGYC 1NCCL 3ZE0E 1U3HC 2ZUWA 4MNGB 2RFXB 5LQBH 3KLDA 5J6GA 2E7CA 3UC0H 1NSNH 4FFVD 2ZSWA 3REVA 4R96B 4PBWD 2HLFC 4E0RA 3BH8B 5IMOB 5DQ9B 1YEJH 1G7HA 3BPCB 1DQLL 4D0CB 1DQMH 1SVCP 4BUHA 1CBVH 3X14A 2DM4A 1RURL 3CK0L 2IFGA 1MCSA 1ETZB 1U3JA 2KUTA 5L6YL 4XPGH 3QUYD 2XPGB 4PJ7A 4PP1C 5HVGB 2XWTB 5T5FH 4BQBA 3IYLW 2ERJB 3E2HC 1KENL 3S34L 4UTAL 5FGCE 2OTWA 3BIKA 4FQHB 2X1PA 3QEGH 3RWFB 4UNVA 3RWIA 3MODH 3MLVL 4LQFH 1OM3H 1DANU 3V0WH 3JWDL 1JF1A 4PGDA 1MAML 3VFRB 1VEOA 5DWUH 3FT3B 3ARGC 4JM2C 2BOBB 4OIBA 2H26B 4LU5L 1S7RB 1Q9OB 1V5JA 4LLYB 2ENSA 2XZQH 4PJDF 1R6VA 4JFHE 1UWXK 4XHJD 5IROA 2R4SH 3O2WL 3CC5A 1GOHA 3UTPD 4NKDA 4XP5L 4PJ7E 1JGVH 2J1KA 3QO1A 1Y0LB 4YHML 1BAFL 1IAIH 1AHWA 4XNXH 2ICWB 5CJQH 1MELA 3TFKD 5DHVA 5EOQL 4LSUL 4S1SL 1UWEH 4ONHA 4UTBL 3K74B 3REWA 3VJ6A 1LWRA 1A7RH 4LPXA 3TNMB 4KJYB 3GSXB 5DR5L 5EG6C 4PTTA 3QZWG 3MLYL 3H3KA 4LKXB 5GRJL 1A9BB 2CUIA 3CFEB 4JFQA 1P1ZA 3MLZL 4PJIF 5EO1A 2OMBA 3NTCH 3T65B 3CZFA 5C0EB 3TBTA 5AYUL 3OGCA 4XX1G 3BESR 4X5LA 3ZDXE 1R3HB 4DN4H 2BC4A 1IQWL 2DM3A 5D6DC 4JDVA 1T66D 3QDMB 1JGUH 2WBJB 4JFZL 4WI7A 3NGBB 3GMQA 4U6VH 1O5DT 3FTGA 3HCVB 1FVCA 3QIUA 1QBBA 3MXWL 4PJ8C 2FX8H 1CG9A 1VADA 5CP7B 4DW2H 1TETL 1ROWA 1XF3B 4XHQA 5D7LD 3BWUC 1MHEA 2C1PA 5JHDD 4NQED 1S5IH 4YDIL 2JB6A 3S36L 1DQDL 5AD0B 4MB5A 1B88A 4TNVF 4AM0B 1BWMA 5C6PB 1U95B 2XV6B 1CIUA 4HKXB 1W0YT 5I1CH 4OAWB 4PGCB 2E3VA 1RU9L 4BQCA 4N0YL 2FR4A 1LK2B 5AWNH 3MNVA 2Q6WB 1W0WB 2N7BA 5D1XB 2X4SB 5GRVL 1RJYA 1I8MB 3ZKSD 1NGWA 4AEIL 4JO1H 3ESVF 1RUPL 1UZ8A 4NRXA 1MFCH 3V8CA 4LRIC 2C3VB 1S78C 4LPCA 5B39A 3DARA 4H88H 2FZ3A 3GDBA 4CDGC 3RAJH 1XIWD 2P49B 2GTWB 3EHBD 3AU1A 4YNYB 3FOLA 3EOTH 4YX2L 3O3DB 4L8BA 2GAZB 1MFEH 3F5WB 3HE7A 4KH2A 4M6OL 4R4FL 4XP9L 5IESH 1QSFA 3PWJB 2OL3H 2HT4C 2NCMA 4HBCL 2E7LC 3SKMB 3WNNA 4PB9L 4DUVA 2ADGB 3SCMC 3SKJL 3IT8D 3DUSA 2QSCL 2RB8A 1U6AL 1JE6A 3VXQB 3QJHA 4QRSA 3CU7A 3QQ9D 4EN3A 4RZCB 4YEEA 3SGEH 4ERSL 1G9EA 2XIDA 4G6KH 5DTFA 1WBXB 3GMOA 4NO0D 4F58L 4YFDB 5D4QA 2GYSA 1N2RA 1YEIH 3O6FD 4JZJC 2DQHL 4LSVH 1ADQH 4XMKL 3TO4C 5IEKA 1C5DB 1QP1A 3CXDH 3K8MA 4ZUTB 1RQ5A 5DJAA 1DN0A 2X1OA 1RJZB 1ZS8A 1S3KH 5C6TH 4PLJD 1F4WH 2BVPB 2KZ1B 5FM4A 5FO9B 1EDQA 1MHHA 1T04A 5CBEA 3A0OA 3H3PL 4ZXBC 3VGHA 2PR4L 3CUPB 3WN5B 4P59L 1QSFE 3LS5H 3INUL 2VZUA 1KT2B 3IDMB 4RFNB 2B4CC 2BNRB 5CHNA 3LS4H 3EJZD 4X8JA 4QRPA 4KRLB 3ZSTA 5I30L 1A1OA 4Z7VB 3WUWB 2SEBB 5ITBH 4MS8D 5ALBH 2JF1A 4X4MA 5E08L 1E27A 2FLRT 4ELKB 2DQTH 4D94A 1O0VA 2H3NB 2DM2A 3CVHH 5F44A 2VIRA 4HUWB 1CDIA 1DUYB 5DK3A 1OB1B 5F7EH 1OCWH 4M7KL 3VD4A 1FAIL 2R2EA 1YNLH 4FQJH 2AAVA 2UYLA 3HE6D 1RIVH 4HS8L 3DI3B 3B9KC 2AJ3A 3O6ML 5T3ZD 1GHFL 3SO5A 2B20A 1H3VA 4XAWH 2JJTC 3DSNA 4H25A 2EC9U 1JHKH 1U8LA 2GSGB 3Q48A 4NNXB 4U6XB 4M1GL 4PJEF 3FB6B 4WU7B 1SY6H 3FCTA 3MOAL 3O41B 4NCDA 4OBRA 4KAQL 5DQJA 3MLTA 1XR8A 3T8XB 5CJ5A 3ULVF 5IB1A 2UZXB 4QRPE 1I1FA 1J0HA 1PD6A 3TH2T 3RGVA 1RHHB 5I16A 4EI5D 2XTJB 2EEDA 3E6HB 3DBXA 4MAYD 3V4PL 1IKNA 3HS0A 3GZKA 4L4VD 3X3GH 4X4ME 5DMKA 2AI0H 3QFJB 3B5HA 2X70B 4FNLH 1KTLA 1U36A 43C9B 1QSED 2NY1B 5C0BD 4NZUH 2PW1B 3QIWA 2IPUG 2X10A 1MLBB 3PNWA 2AXGB 2EKJA 2FJHA 1R24A 3CLFH 5GZNC 3IB4A 1G7MB 2C3XA 1AXTH 4I0PA 4PS4H 1EAPA 5DJYB 5I1GH 2PW2B 1QYGH 3FRUB 4KQ3L 4R0LC 5KZCB 4JPKL 5A2KH 5J0BA 4DGVH 5I0ZA 3WSQH 2DL2A 4NC1E 3RWJB 4DAGL 2OI9C 4LOUD 5E8OB 3VU2A 2IQAB 4WFHE 1OTUD 3I3DA 3BX7C 5LGJA 4FG6C 4Y16B 5BV7B 2IH1A 3BN9C 4JFDD 3GBNL 2VLJA 4GAYA 3SE8H 3QCUH 3H3BC 1J0ZA 4JRXD 3BT2H 2W92A 4PRBB 2DQFA 4R2GC 4PP2B 4KGJA 1Q72L 3DYMA 3B6SB 4PJEB 4HIHB 3D0LA 4L8DA 4GG8B 1PLGH 4LCCC 1U93B 2AK1L 5IMLA 5F1NB 3BIBX 4YHOH 5FCUL 4V1DB 5D7JB 1FL3A 4LK4A 2ZNWA 3FOMA 1GGCL 2DQGL 3ULSA 3N1PC 2DQJL 2DDQL 5T1KA 4KWUA 3I3BA 2QQNL 5EOTB 1ZT7B 3U36A 4TULL 3TA3D 4Z8FH 2CIIA 1FIGL 5F1KC 3VWKA 3MA7B 3VXMD 1QHPA 5JW5A 3MRMB 1YPZF 3DX8B 1IGFH 5IVXB 5TE6H 4MSWB 4WU5A 5GHWH 4MJIA 5F72S 5LG1A 5I75B 2IPTH 2ZWLT 1EEZB 5HGHA 2XXMB 3EJJX 3MV9D 1YNKL 1CE1H 3WO3B 5IQ7L 2BNQA 2JCCB 3G5XA 1LO2L 2H32B 4JG0H 5FO8B 2VLJE 1S7XB 4IRJD 1NGQH 1ZEAH 5DVMA 3CDFA 2G5BA 3JTTB 4LGPB 1F6FB 3TC9A 4OLWH 1D5XB 2VKWA 3KPLA 4OD3H 3VXSD 1V3MA 3W0WA 4QRQB 1FFOB 4X6CB 5JW3H 4LCYA 1AQDB 1SM3H 1KYOK 1KPRA 1U92A 2XQBL 4YO0A 5HGAB 2QQLL 3DVNB 3GSRB 1MEXH 4OJFH 5CINH 4UINH 1FV1A 3QHFH 5KOMC 5DRZA 5TQ2H 5JR1L 1NCWL 2QR0B 4LLQA 5L7XH 1BQHA 3GM0A 3KYKH 5B38G 5E2TL 5MENA 1A3RH 1J1XL 4HJ0C 7FABL 2PXYD 1GIGH 3HAEB 1ZVYA 5F6HJ 1AJ7H 4K9EL 1CF8L 1MI5D 1G84A 4HBQA 4DVBA 1J1PH 2HJKA 1JYWA 4CVXA 4R4BA 4OTXL 3CDGB 2HFFB 3EYQC 1CK0L 4B5EA 1AC6A 5C0DB 4ZO8A 4PJBB 1G7LB 3HZKA 4MJIE 5IB3B 3WLWC 4M6MH 1FL6B 4G6ML 2EECA 1CFSB