4FGFA

Refinement of the structure of human basic fibroblast growth factor at 1.6 angstroms resolution and analysis of presumed heparin binding sites by selenate substitution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
PKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BASIC FIBROBLAST GROWTH FACTOR
publication title Refinement of the structure of human basic fibroblast growth factor at 1.6 A resolution and analysis of presumed heparin binding sites by selenate substitution.
pubmed rcsb
source organism Homo sapiens
molecule tags Growth factor
total genus 31
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1993-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4fgfA00
1XG6A 2D22A 1JY0A 4ZFWB 4A7YA 4F83A 1HCEA 3IM5A 5DZUA 3ZXGA 2VSEA 1TWMA 1FMZA 4FGFA 4QO3A 2KI4A 3UD7A 1SR4A 3H6RB 3KMVA 4ISQA 3QYDA 3P53A 1BFGA 2WBCA 3N7JA 4Q9GA 5BP5C 2D43A 3O3QA 3H6RA 4LO8B 2AFGA 1DQGA 4I3NA 1ISVA 3H6QA 2MIBA 1G9AA 2DS0A 3TC2A 2F8XC 3FUOA 4GOVA 4EKXB 2NYYA 3N7KA 4I37A 2D23A 5HPZA 3IAGC 1XHBA 4KEJA 1JTCA 2BFHA 1FQ9A 3AJ5A 5F8WA 2WRYA 4I6IA 5D61A 1Q04A 1HWMB 1YTOA 4KEKA 3D7WB 1BLAA 4ZLBB 1R8OA 1EVTA 1BASA 1ABRB 2FDBM 5DSSB 3BB2A 3BA5A 2E4MA 1F31A 5FZUA 2QN4A 3LTQA 3S8KA 1BFFA 1NZKA 3O4BA 4Z9WB 2Y9GA 3CAHA 4OEGA 5F8YA 1S0GA 1PUMB 3VT0A 5FZZA 2BEAA 2RQ9A 1AFCA 1S0LA 6I1BA 1HIBA 4OEEA 3AH2A 4DCKC 4J2XA 4H9WA 3CRGA 4I4QA 3P6JA 3OBTA 4D0TA 1DIWA 3F62B 1IOBA 1JT5A 3FJFA 5D63A 2Z48A 5FZYA 2D24A 4OUJA 4I4RA 2M49A 3V0AB 5FNWA 2P39A 4JKQA 1Q1UA 4OW4A 5G00A 5B2HA 1RMLA 4XFUA 2L5XA 4HR6C 3CA6A 3FGMA 3AKIA 3HSMA 1I1BA 5D62A 1BLDA 4JAWA 3I2AA 1S0FA 2GO2A 3BX1C 2DRZA 1IRPA 3CA0A 2E4MC 1Z0HA 2QYIB 3A23A 3POKA 1AVAC 3SNVA 1FV3A 2GZBA 5EC5A 1FN0A 2ET2A 3FJAA 1DLLA 3BAQA 1RZOB 3CA4A 1V6VA 1W3FA 3HBWA 1VCLA 2UUSA 4XFTA 1GGPB 3FUQA 1PWAA 1DJSB 3PUBA 4QBVA 5BXTA 4XKIA 2F2FA 2KKIA 3UD9A 3V0BA 3IIRA 1AF9A 2FGFA 2Y9XE 3FFZA 1DQOA 5EHAA 4AN6A 3VUOA 3AKHA 1TIEA 3T8SA 3UD8A 1HKNA 4AN7B 4EEEB 9ILBA 2BEBA 3LLPA 3QR5A 2D20A 3ZX7A 5GAQA 2NP0A 3AH4A 4F34A 3F1RA 1XZZA 2K4AB 4LO1A 1AVUA 2KH2A 1S0DA 2LIEA 3FJ9A 3OJVA 5F8SA 2K8RA 2NM1A 5BXPA 3MPPG 1SZ6B 4TLPA 1QXMA 1M16A 4ZA3B 4I96A 3FJIA 4PC4A 3V79C 1BARA 3A21A 1IHKA 3ZC8A 3A22A 4EFPA 3JUTA 1KNMA 3O4DA 2KLLA 2Q3NB 2ZQOA 3Q7YA 5DUYA 3O44A 3BAVA 1V6WA 1JQZA 4J23B 4LO0A 21BIA 2F2FC 3AZWA 4G6JA 4P0JA 1YXWA 3VSZA 1R8NA 4L4IA 4QD2B 4G9NA 4USPA 1G9CA 3WMUA 3CRIA 4II0A 1YBIA 1K5VA 2I1BA 1UPSA 4JPZA 2AQZA 2FFVA 3CU1B 1SR4C 2Z49A 3WINA 3WO4A 2RSTA 4Q9PA 3C9ZA 3P6IA 4IY8A 3WO2A 1ISZA 3VEQA 4LO1C 3B9UA 1AVWB 1HWOB 4OWKA 4OWLA 5I1BA 4A7ZA 3NJ5A 1RG8A 4ZFYB 2R9KB 2ZQNA 2XOAA 3BAOA 4I4XA 4ZBVB 4CJMA 5JMCA 1BFBA 2J3PA 4GOYA 2ZR1B 3FJKA 5DVHA 3FJEA 5BQUA 4OWJA 2K43A 2Y9FA 3BA4A 3PG0A 3ZXDA 1TP0A 2VLCA 4I8MA 1L2HA 4J2SA 2NVHA 1Z2VA 3O4AA 2HWMA 3O5WB 4YOLA 3RSJA 4L4HA 3HOMA 3A07A 1II4A 4I7IA 4XFSA 3Q7WA 1AVXB 4ZGRB 2D7RA 3BAGA 1FMMS 1DZCA 1JT4A 4I4OA 3R4SA 4QD2C 3VT2A 3VWCA 4IQPA 3WINC 2ESUA 4G6MA 1Q03A 3N7LA 2VXTI 1TFMB 5F90A 4QC4A 1FGAA 1V6UA 4GAIA 4QKRA 1OQLB 4LO7C 1WBCA 3V0BB 4IZEA 1FV2A 4Z8SB 2VUAA 3WMVA 2Y9WC 3N0KA 4A7KA 2VXRA 1FWUA 1MD6A 5BOWA 3Q7XA 2HW9A 1V6XA 4I4UA 1BFCA 3AKGA 3PHZA 3AH1A 1T4QA 4USOA 3AKFA 4IYBA 4ZFUB 2FO1A 1EPWA 1W3GA 2DREA 3CQAA 4I4YA 1TOOA 4OEFA 3FJHA 4HJJA 4JQ0A 1FWVA 4R6UB 3OGGA 4HA2A 2D7IA 1YYNA 4D0ZA 1HWPB 4IZXA 3I29B 3O4CA 4EFRA 4ISRA 1M2TB 1N4KA 7I1BA 2D1ZA 3FJDA 3S8JA 3BRFA 4JKXB 1G82A 4LO2A 1BA7A 1PZZA 2LIQA 2MLLB 1RY7A 1EV2A 8I1BA 41BIA 2IWTB 5JLVA 3MALA 5BVPI 3JRRA 4EB2B 1G9BA 3BTAA 3WA1A 1IILA 3ILAA 3UJ4A 2P23A 1HCDA 1MC9A 2YUGA 4H04A 4QALA 3R4UA 3IM6A 1K5UA 1IRAX 1S0BA 3ZC9A 4GP3A 1WD3A 1JT3A 1JT7A 2AXMA 4I2SA 1G9DA 2AAIB 2IHOA 2NZ9A 4LO7B 4LO3A 1D0HA 4I1EA 3UDAA 4J2KA 2VU9A 1WD4A 1ILR1 4WBCA 4I4SA 3NBDA 3O49A 4QKSA 3UJ0A 1ISWA 1QQLA 1IJTA 5FNXA 2FFUA 2Q9XA 4G9MA 1P63A 4ZKTB 4GAFA 2HZ9A 3AZVA 3NBCA 1EYLA 3VSFA 3CRHA 1NUNA 31BIA 4JRAA 4I4VA 4LO2C 4ZOTA 1J0SA 3FJCA 2MC2A 4IHZA 1TWEA 3H6SE 1S0EA 3BRGC 1T9FA 4J2YA 2VSAA 1ONKB 1A8DA 1CE7B 4KEIA 4D8HA 3RMXA 5BXSA 3OJMA 3O4OA 3EF2A 4LO0C 3RTIB 3HALA 3FJ8A 3N7MA 1AXMA 1YF8B 3NBEA 1QQKA 1PC8B 2D44A 3FJJA 1W3AA 1JLXA 3CA3A 4X39A 4IONA 4IY9A 1ISYA 2NTDA 4JP0A 4ENDA 3BRDA 3PMEA 4I4PA 5E24E 3WO3A 1PUUB 1Z4SA 4LO3C 3W9TA 3V0AA 1I1EA 5BP5A 3CA5A 4I1BA 3BAUA 1TTUA 5BXRA 1ISXA 1IT0A 3E8LC 3CA1A 1S0CA 4I0YA 4X3AA 4Q91A 3OGFA 3RMYA 2DRYA 3RTJB 4DENA 4DEPA 3IM7A 2X2SA 4P0LA 1DZDA 2ERMA 1HWNB 3OJ2A 2RG9B 3NBNA 4X37A 2X2TA 4X38A 4EFQA 3OBRA 1XYFA 3VT1A 1DFQA 1WBAA 5BQUC 3HMYA 3BAHA 1ITBA 3BADA 3FJBA 3I2XA 2HWAA 3K1XA 1JLYA 4P0KA 4P6AA 2KI6B 4QBCA 4KC3A 4G1RA 1CVSA 1DFCA 4FVVA 1E0OA 4KBBA 3AJ6A 4GP0A 3BA7A 3HN1A 5EG6C
chains in the Genus database with same CATH superfamily
1XG6A 2D22A 1JY0A 4ZFWB 4A7YA 4F83A 1HCEA 3IM5A 5DZUA 3ZXGA 2VSEA 1TWMA 1FMZA 4FGFA 4QO3A 2KI4A 3UD7A 1SR4A 3H6RB 3KMVA 4ISQA 3QYDA 3P53A 1BFGA 2WBCA 3N7JA 4Q9GA 5BP5C 2D43A 3O3QA 3H6RA 4LO8B 2AFGA 1DQGA 4I3NA 1ISVA 3H6QA 2MIBA 1G9AA 2DS0A 3TC2A 2F8XC 3FUOA 4GOVA 4EKXB 2NYYA 3N7KA 4I37A 2D23A 5HPZA 3IAGC 1XHBA 4KEJA 1JTCA 2BFHA 1FQ9A 3AJ5A 5F8WA 2WRYA 4I6IA 5D61A 1Q04A 1HWMB 1YTOA 4KEKA 3D7WB 1BLAA 4ZLBB 1R8OA 1EVTA 1BASA 1ABRB 2FDBM 5DSSB 3BB2A 3BA5A 2E4MA 1F31A 5FZUA 2QN4A 3LTQA 3S8KA 1BFFA 1NZKA 3O4BA 4Z9WB 2Y9GA 3CAHA 4OEGA 5F8YA 1S0GA 1PUMB 3VT0A 5FZZA 2BEAA 2RQ9A 1AFCA 1S0LA 6I1BA 1HIBA 4OEEA 3AH2A 4DCKC 4J2XA 4H9WA 3CRGA 4I4QA 3P6JA 3OBTA 4D0TA 1DIWA 3F62B 1IOBA 1JT5A 3FJFA 5D63A 2Z48A 5FZYA 2D24A 4OUJA 4I4RA 2M49A 3V0AB 5FNWA 2P39A 4JKQA 1Q1UA 4OW4A 5G00A 5B2HA 1RMLA 4XFUA 2L5XA 4HR6C 3CA6A 3FGMA 3AKIA 3HSMA 1I1BA 5D62A 1BLDA 4JAWA 3I2AA 1S0FA 2GO2A 3BX1C 2DRZA 1IRPA 3CA0A 2E4MC 1Z0HA 2QYIB 3A23A 3POKA 1AVAC 3SNVA 1FV3A 2GZBA 5EC5A 1FN0A 2ET2A 3FJAA 1DLLA 3BAQA 1RZOB 3CA4A 1V6VA 1W3FA 3HBWA 1VCLA 2UUSA 4XFTA 1GGPB 3FUQA 4UY4A 1PWAA 1DJSB 3PUBA 4QBVA 5BXTA 4XKIA 2F2FA 2KKIA 3UD9A 3V0BA 3IIRA 4MZFB 1AF9A 2FGFA 2Y9XE 3FFZA 1DQOA 5EHAA 4AN6A 3VUOA 3AKHA 1TIEA 3T8SA 3UD8A 1HKNA 4AN7B 4EEEB 9ILBA 2BEBA 3LLPA 3QR5A 2D20A 3ZX7A 5GAQA 2NP0A 3AH4A 4F34A 3F1RA 1XZZA 2K4AB 4LO1A 1AVUA 2KH2A 1S0DA 2LIEA 3FJ9A 3OJVA 5F8SA 2K8RA 2NM1A 5BXPA 3MPPG 1SZ6B 4TLPA 1QXMA 1M16A 4ZA3B 4I96A 3FJIA 4PC4A 3V79C 1BARA 3A21A 1IHKA 3ZC8A 3A22A 4EFPA 3JUTA 1KNMA 3O4DA 2KLLA 2Q3NB 2ZQOA 3Q7YA 5DUYA 3O44A 3BAVA 1V6WA 1JQZA 4J23B 4LO0A 21BIA 2F2FC 3AZWA 4G6JA 4P0JA 1YXWA 3VSZA 1R8NA 4L4IA 4QD2B 4G9NA 4USPA 1G9CA 3WMUA 3CRIA 4II0A 4MZHA 1YBIA 1K5VA 2I1BA 1UPSA 4JPZA 2AQZA 2FFVA 3CU1B 1SR4C 2Z49A 3WINA 3WO4A 2RSTA 4Q9PA 3C9ZA 3P6IA 4IY8A 3WO2A 1ISZA 3VEQA 4LO1C 3B9UA 1AVWB 1HWOB 4OWKA 4OWLA 5I1BA 4A7ZA 3NJ5A 1RG8A 4ZFYB 2R9KB 2ZQNA 2XOAA 3BAOA 4I4XA 4ZBVB 4CJMA 5JMCA 1BFBA 2J3PA 4GOYA 2ZR1B 3FJKA 5DVHA 3FJEA 5BQUA 4OWJA 2K43A 2Y9FA 3BA4A 3PG0A 3ZXDA 1TP0A 2VLCA 4I8MA 1L2HA 4J2SA 2NVHA 1Z2VA 3O4AA 2HWMA 3O5WB 4YOLA 3RSJA 4L4HA 3HOMA 3A07A 1II4A 4I7IA 4XFSA 3Q7WA 1AVXB 4ZGRB 2D7RA 3BAGA 1FMMS 1DZCA 1JT4A 4I4OA 3R4SA 4QD2C 3VT2A 4H75A 3VWCA 4IQPA 3WINC 2ESUA 4G6MA 1Q03A 3N7LA 2VXTI 1TFMB 5F90A 4QC4A 1FGAA 1V6UA 4GAIA 4QKRA 1OQLB 4LO7C 1WBCA 3V0BB 4IZEA 1FV2A 4Z8SB 2VUAA 3WMVA 2Y9WC 2NS2A 3N0KA 4A7KA 2VXRA 1FWUA 1MD6A 5BOWA 3Q7XA 2HW9A 1V6XA 4I4UA 1BFCA 3AKGA 3PHZA 3AH1A 1T4QA 4USOA 3AKFA 4IYBA 4ZFUB 2FO1A 1EPWA 1W3GA 2DREA 3CQAA 4I4YA 1TOOA 4OEFA 3FJHA 4HJJA 4JQ0A 1FWVA 4R6UB 3OGGA 4HA2A 2D7IA 1YYNA 4D0ZA 1HWPB 4MZGB 4IZXA 3I29B 3O4CA 4EFRA 4ISRA 1M2TB 1N4KA 7I1BA 2D1ZA 3FJDA 3S8JA 3BRFA 4JKXB 1G82A 4LO2A 1BA7A 1PZZA 2LIQA 2MLLB 1RY7A 1EV2A 8I1BA 41BIA 2IWTB 5JLVA 3MALA 5BVPI 3JRRA 4EB2B 1G9BA 3BTAA 3WA1A 1IILA 3ILAA 3UJ4A 2P23A 1HCDA 1MC9A 2YUGA 4H04A 4QALA 3R4UA 3IM6A 1K5UA 1IRAX 1S0BA 3ZC9A 4GP3A 1WD3A 1JT3A 1JT7A 2AXMA 4I2SA 1G9DA 2AAIB 2IHOA 2NZ9A 4LO7B 4LO3A 1D0HA 4I1EA 3UDAA 4J2KA 2VU9A 1WD4A 1ILR1 4WBCA 4I4SA 3NBDA 3O49A 4QKSA 3UJ0A 1ISWA 1QQLA 1IJTA 5FNXA 2FFUA 2Q9XA 4G9MA 1P63A 4ZKTB 4GAFA 2HZ9A 3AZVA 3NBCA 1EYLA 3VSFA 3CRHA 1NUNA 31BIA 4JRAA 4I4VA 4LO2C 4ZOTA 1J0SA 3FJCA 2MC2A 4IHZA 1TWEA 3H6SE 1S0EA 3BRGC 1T9FA 4J2YA 2VSAA 1ONKB 1A8DA 1CE7B 4KEIA 4D8HA 3RMXA 5BXSA 3OJMA 3O4OA 3EF2A 4LO0C 3RTIB 3HALA 3FJ8A 3N7MA 1AXMA 1YF8B 3NBEA 1QQKA 1PC8B 2D44A 3FJJA 1W3AA 1JLXA 3CA3A 4X39A 4IONA 4IY9A 1ISYA 2NTDA 4JP0A 4ENDA 3BRDA 3PMEA 4I4PA 5E24E 3WO3A 1PUUB 1Z4SA 4LO3C 3W9TA 3V0AA 1I1EA 5BP5A 3CA5A 4I1BA 3BAUA 1TTUA 5BXRA 1ISXA 1IT0A 3E8LC 3CA1A 1S0CA 4I0YA 4X3AA 4Q91A 3OGFA 3RMYA 2DRYA 3RTJB 4DENA 4DEPA 3IM7A 2X2SA 4P0LA 1DZDA 2ERMA 1HWNB 3OJ2A 2RG9B 3NBNA 4X37A 2X2TA 4X38A 4EFQA 3OBRA 1XYFA 3VT1A 1DFQA 1WBAA 5BQUC 3HMYA 3BAHA 1ITBA 3BADA 3FJBA 3I2XA 2HWAA 3K1XA 1JLYA 4P0KA 4P6AA 2KI6B 4QBCA 4KC3A 4G1RA 1CVSA 1DFCA 4FVVA 1E0OA 4KBBA 3AJ6A 4GP0A 3BA7A 3HN1A 5EG6C
chains in the Genus database with same CATH topology
1XG6A 2D22A 1JY0A 4ZFWB 4A7YA 4F83A 1HCEA 3IM5A 5DZUA 3ZXGA 2VSEA 1TWMA 1FMZA 4FGFA 4QO3A 2KI4A 3UD7A 1SR4A 3H6RB 3KMVA 4ISQA 3QYDA 3P53A 1BFGA 2WBCA 3N7JA 4Q9GA 5BP5C 2D43A 3O3QA 3H6RA 4LO8B 2AFGA 1DQGA 4I3NA 1ISVA 3H6QA 2MIBA 1G9AA 2DS0A 3TC2A 2F8XC 3FUOA 4GOVA 4EKXB 2NYYA 3N7KA 4I37A 2D23A 5HPZA 3IAGC 1XHBA 4KEJA 1JTCA 2BFHA 1FQ9A 3AJ5A 5F8WA 2WRYA 4I6IA 5D61A 1Q04A 1HWMB 1YTOA 4KEKA 3D7WB 1BLAA 4ZLBB 1R8OA 1EVTA 1BASA 1ABRB 2FDBM 5DSSB 3BB2A 3BA5A 2E4MA 1F31A 5FZUA 2QN4A 3LTQA 3S8KA 1BFFA 1NZKA 3O4BA 4Z9WB 2Y9GA 3CAHA 4OEGA 5F8YA 1S0GA 1PUMB 3VT0A 5FZZA 2BEAA 2RQ9A 1AFCA 1S0LA 6I1BA 1HIBA 4OEEA 3AH2A 4DCKC 4J2XA 4H9WA 3CRGA 4I4QA 3P6JA 3OBTA 4D0TA 1DIWA 3F62B 1IOBA 1JT5A 3FJFA 5D63A 2Z48A 5FZYA 2D24A 4OUJA 4I4RA 2M49A 3V0AB 5FNWA 2P39A 4JKQA 1Q1UA 4OW4A 5G00A 5B2HA 1RMLA 4XFUA 2L5XA 4HR6C 3CA6A 3FGMA 3AKIA 3HSMA 1I1BA 5D62A 1BLDA 4JAWA 3I2AA 1S0FA 2GO2A 3BX1C 2DRZA 1IRPA 3CA0A 2E4MC 1Z0HA 2QYIB 3A23A 3POKA 1AVAC 3SNVA 1FV3A 2GZBA 5EC5A 1FN0A 2ET2A 3FJAA 1DLLA 3BAQA 1RZOB 3CA4A 1V6VA 1W3FA 3HBWA 1VCLA 2UUSA 4XFTA 1GGPB 3FUQA 4UY4A 1PWAA 1DJSB 3PUBA 4QBVA 5BXTA 4XKIA 2F2FA 2KKIA 3UD9A 3V0BA 3IIRA 4MZFB 1AF9A 2FGFA 2Y9XE 3FFZA 1DQOA 5EHAA 4AN6A 3VUOA 3AKHA 1TIEA 3T8SA 3UD8A 1HKNA 4AN7B 4EEEB 9ILBA 2BEBA 3LLPA 3QR5A 2D20A 3ZX7A 5GAQA 2NP0A 3AH4A 4F34A 3F1RA 1XZZA 2K4AB 4LO1A 1AVUA 2KH2A 1S0DA 2LIEA 3FJ9A 3OJVA 5F8SA 2K8RA 2NM1A 5BXPA 3MPPG 1SZ6B 4TLPA 1QXMA 1M16A 4ZA3B 4I96A 3FJIA 4PC4A 3V79C 1BARA 3A21A 1IHKA 3ZC8A 3A22A 4EFPA 3JUTA 1KNMA 3O4DA 2KLLA 2Q3NB 2ZQOA 3Q7YA 5DUYA 3O44A 3BAVA 1V6WA 1JQZA 4J23B 4LO0A 21BIA 2F2FC 3AZWA 4G6JA 4P0JA 1YXWA 3VSZA 1R8NA 4L4IA 4QD2B 4G9NA 4USPA 1G9CA 3WMUA 3CRIA 4II0A 4MZHA 1YBIA 1K5VA 2I1BA 1UPSA 4JPZA 2AQZA 2FFVA 3CU1B 1SR4C 2Z49A 3WINA 3WO4A 2RSTA 4Q9PA 3C9ZA 3P6IA 4IY8A 3WO2A 1ISZA 3VEQA 4LO1C 3B9UA 1AVWB 1HWOB 4OWKA 4OWLA 5I1BA 4A7ZA 3NJ5A 1RG8A 4ZFYB 2R9KB 2ZQNA 2XOAA 3BAOA 4I4XA 4ZBVB 4CJMA 5JMCA 1BFBA 2J3PA 4GOYA 2ZR1B 3FJKA 5DVHA 3FJEA 5BQUA 4OWJA 2K43A 2Y9FA 3BA4A 3PG0A 3ZXDA 1TP0A 2VLCA 4I8MA 1L2HA 4J2SA 2NVHA 1Z2VA 3O4AA 2HWMA 3O5WB 4YOLA 3RSJA 4L4HA 3HOMA 3A07A 1II4A 4I7IA 4XFSA 3Q7WA 1AVXB 4ZGRB 2D7RA 3BAGA 1FMMS 1DZCA 1JT4A 4I4OA 3R4SA 4QD2C 3VT2A 4H75A 3VWCA 4IQPA 3WINC 2ESUA 4G6MA 1Q03A 3N7LA 2VXTI 1TFMB 5F90A 4QC4A 1FGAA 1V6UA 4GAIA 4QKRA 1OQLB 4LO7C 1WBCA 3V0BB 4IZEA 1FV2A 4Z8SB 2VUAA 3WMVA 2Y9WC 2NS2A 3N0KA 4A7KA 2VXRA 1FWUA 1MD6A 5BOWA 3Q7XA 2HW9A 1V6XA 4I4UA 1BFCA 3AKGA 3PHZA 3AH1A 1T4QA 4USOA 3AKFA 4IYBA 4ZFUB 2FO1A 1EPWA 1W3GA 2DREA 3CQAA 4I4YA 1TOOA 4OEFA 3FJHA 4HJJA 4JQ0A 1FWVA 4R6UB 3OGGA 4HA2A 2D7IA 1YYNA 4D0ZA 1HWPB 4MZGB 4IZXA 3I29B 3O4CA 4EFRA 4ISRA 1M2TB 1N4KA 7I1BA 2D1ZA 3FJDA 3S8JA 3BRFA 4JKXB 1G82A 4LO2A 1BA7A 1PZZA 2LIQA 2MLLB 1RY7A 1EV2A 8I1BA 41BIA 2IWTB 5JLVA 3MALA 5BVPI 3JRRA 4EB2B 1G9BA 3BTAA 3WA1A 1IILA 3ILAA 3UJ4A 2P23A 1HCDA 1MC9A 2YUGA 4H04A 4QALA 3R4UA 3IM6A 1K5UA 1IRAX 1S0BA 3ZC9A 4GP3A 1WD3A 1JT3A 1JT7A 2AXMA 4I2SA 1G9DA 2AAIB 2IHOA 2NZ9A 4LO7B 4LO3A 1D0HA 4I1EA 3UDAA 4J2KA 2VU9A 1WD4A 1ILR1 4WBCA 4I4SA 3NBDA 3O49A 4QKSA 3UJ0A 1ISWA 1QQLA 1IJTA 5FNXA 2FFUA 2Q9XA 4G9MA 1P63A 4ZKTB 4GAFA 2HZ9A 3AZVA 3NBCA 1EYLA 3VSFA 3CRHA 1NUNA 31BIA 4JRAA 4I4VA 4LO2C 4ZOTA 1J0SA 3FJCA 2MC2A 4IHZA 1TWEA 3H6SE 1S0EA 3BRGC 1T9FA 4J2YA 2VSAA 1ONKB 1A8DA 1CE7B 4KEIA 4D8HA 3RMXA 5BXSA 3OJMA 3O4OA 3EF2A 4LO0C 3RTIB 3HALA 3FJ8A 3N7MA 1AXMA 1YF8B 3NBEA 1QQKA 1PC8B 2D44A 3FJJA 1W3AA 1JLXA 3CA3A 4X39A 4IONA 4IY9A 1ISYA 2NTDA 4JP0A 4ENDA 3BRDA 3PMEA 4I4PA 5E24E 3WO3A 1PUUB 1Z4SA 4LO3C 3W9TA 3V0AA 1I1EA 5BP5A 3CA5A 4I1BA 3BAUA 1TTUA 5BXRA 1ISXA 1IT0A 3E8LC 3CA1A 1S0CA 4I0YA 4X3AA 4Q91A 3OGFA 3RMYA 2DRYA 3RTJB 4DENA 4DEPA 3IM7A 2X2SA 4P0LA 1DZDA 2ERMA 1HWNB 3OJ2A 2RG9B 3NBNA 4X37A 2X2TA 4X38A 4EFQA 3OBRA 1XYFA 3VT1A 1DFQA 1WBAA 5BQUC 3HMYA 3BAHA 1ITBA 3BADA 3FJBA 3I2XA 2HWAA 3K1XA 1JLYA 4P0KA 4P6AA 2KI6B 4QBCA 4KC3A 4G1RA 1CVSA 1DFCA 4FVVA 1E0OA 4KBBA 3AJ6A 4GP0A 3BA7A 3HN1A 5EG6C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XG6 A;  2D22 A;  1JY0 A;  4ZFW B;  4A7Y A;  4F83 A;  1HCE A;  3IM5 A;  5DZU A;  3ZXG A;  2VSE A;  1TWM A;  1FMZ A;  4FGF A;  4QO3 A;  2KI4 A;  3UD7 A;  1SR4 A;  3H6R B;  3KMV A;  4ISQ A;  3QYD A;  3P53 A;  1BFG A;  2WBC A;  3N7J A;  4Q9G A;  5BP5 C;  2D43 A;  3O3Q A;  3H6R A;  4LO8 B;  2AFG A;  1DQG A;  4I3N A;  1ISV A;  3H6Q A;  2MIB A;  1G9A A;  2DS0 A;  3TC2 A;  2F8X C;  3FUO A;  4GOV A;  4EKX B;  2NYY A;  3N7K A;  4I37 A;  2D23 A;  5HPZ A;  3IAG C;  1XHB A;  4KEJ A;  1JTC A;  2BFH A;  1FQ9 A;  3AJ5 A;  5F8W A;  2WRY A;  4I6I A;  5D61 A;  1Q04 A;  1HWM B;  1YTO A;  4KEK A;  3D7W B;  1BLA A;  4ZLB B;  1R8O A;  1EVT A;  1BAS A;  1ABR B;  2FDB M;  5DSS B;  3BB2 A;  3BA5 A;  2E4M A;  1F31 A;  5FZU A;  2QN4 A;  3LTQ A;  3S8K A;  1BFF A;  1NZK A;  3O4B A;  4Z9W B;  2Y9G A;  3CAH A;  4OEG A;  5F8Y A;  1S0G A;  1PUM B;  3VT0 A;  5FZZ A;  2BEA A;  2RQ9 A;  1AFC A;  1S0L A;  6I1B A;  1HIB A;  4OEE A;  3AH2 A;  4DCK C;  4J2X A;  4H9W A;  3CRG A;  4I4Q A;  3P6J A;  3OBT A;  4D0T A;  1DIW A;  3F62 B;  1IOB A;  1JT5 A;  3FJF A;  5D63 A;  2Z48 A;  5FZY A;  2D24 A;  4OUJ A;  4I4R A;  2M49 A;  3V0A B;  5FNW A;  2P39 A;  4JKQ A;  1Q1U A;  4OW4 A;  5G00 A;  5B2H A;  1RML A;  4XFU A;  2L5X A;  4HR6 C;  3CA6 A;  3FGM A;  3AKI A;  3HSM A;  1I1B A;  5D62 A;  1BLD A;  4JAW A;  3I2A A;  1S0F A;  2GO2 A;  3BX1 C;  2DRZ A;  1IRP A;  3CA0 A;  2E4M C;  1Z0H A;  2QYI B;  3A23 A;  3POK A;  1AVA C;  3SNV A;  1FV3 A;  2GZB A;  5EC5 A;  1FN0 A;  2ET2 A;  3FJA A;  1DLL A;  3BAQ A;  1RZO B;  3CA4 A;  1V6V A;  1W3F A;  3HBW A;  1VCL A;  2UUS A;  4XFT A;  1GGP B;  3FUQ A;  1PWA A;  1DJS B;  3PUB A;  4QBV A;  5BXT A;  4XKI A;  2F2F A;  2KKI A;  3UD9 A;  3V0B A;  3IIR A;  1AF9 A;  2FGF A;  2Y9X E;  3FFZ A;  1DQO A;  5EHA A;  4AN6 A;  3VUO A;  3AKH A;  1TIE A;  3T8S A;  3UD8 A;  1HKN A;  4AN7 B;  4EEE B;  9ILB A;  2BEB A;  3LLP A;  3QR5 A;  2D20 A;  3ZX7 A;  5GAQ A;  2NP0 A;  3AH4 A;  4F34 A;  3F1R A;  1XZZ A;  2K4A B;  4LO1 A;  1AVU A;  2KH2 A;  1S0D A;  2LIE A;  3FJ9 A;  3OJV A;  5F8S A;  2K8R A;  2NM1 A;  5BXP A;  3MPP G;  1SZ6 B;  4TLP A;  1QXM A;  1M16 A;  4ZA3 B;  4I96 A;  3FJI A;  4PC4 A;  3V79 C;  1BAR A;  3A21 A;  1IHK A;  3ZC8 A;  3A22 A;  4EFP A;  3JUT A;  1KNM A;  3O4D A;  2KLL A;  2Q3N B;  2ZQO A;  3Q7Y A;  5DUY A;  3O44 A;  3BAV A;  1V6W A;  1JQZ A;  4J23 B;  4LO0 A;  21BI A;  2F2F C;  3AZW A;  4G6J A;  4P0J A;  1YXW A;  3VSZ A;  1R8N A;  4L4I A;  4QD2 B;  4G9N A;  4USP A;  1G9C A;  3WMU A;  3CRI A;  4II0 A;  1YBI A;  1K5V A;  2I1B A;  1UPS A;  4JPZ A;  2AQZ A;  2FFV A;  3CU1 B;  1SR4 C;  2Z49 A;  3WIN A;  3WO4 A;  2RST A;  4Q9P A;  3C9Z A;  3P6I A;  4IY8 A;  3WO2 A;  1ISZ A;  3VEQ A;  4LO1 C;  3B9U A;  1AVW B;  1HWO B;  4OWK A;  4OWL A;  5I1B A;  4A7Z A;  3NJ5 A;  1RG8 A;  4ZFY B;  2R9K B;  2ZQN A;  2XOA A;  3BAO A;  4I4X A;  4ZBV B;  4CJM A;  5JMC A;  1BFB A;  2J3P A;  4GOY A;  2ZR1 B;  3FJK A;  5DVH A;  3FJE A;  5BQU A;  4OWJ A;  2K43 A;  2Y9F A;  3BA4 A;  3PG0 A;  3ZXD A;  1TP0 A;  2VLC A;  4I8M A;  1L2H A;  4J2S A;  2NVH A;  1Z2V A;  3O4A A;  2HWM A;  3O5W B;  4YOL A;  3RSJ A;  4L4H A;  3HOM A;  3A07 A;  1II4 A;  4I7I A;  4XFS A;  3Q7W A;  1AVX B;  4ZGR B;  2D7R A;  3BAG A;  1FMM S;  1DZC A;  1JT4 A;  4I4O A;  3R4S A;  4QD2 C;  3VT2 A;  3VWC A;  4IQP A;  3WIN C;  2ESU A;  4G6M A;  1Q03 A;  3N7L A;  2VXT I;  1TFM B;  5F90 A;  4QC4 A;  1FGA A;  1V6U A;  4GAI A;  4QKR A;  1OQL B;  4LO7 C;  1WBC A;  3V0B B;  4IZE A;  1FV2 A;  4Z8S B;  2VUA A;  3WMV A;  2Y9W C;  3N0K A;  4A7K A;  2VXR A;  1FWU A;  1MD6 A;  5BOW A;  3Q7X A;  2HW9 A;  1V6X A;  4I4U A;  1BFC A;  3AKG A;  3PHZ A;  3AH1 A;  1T4Q A;  4USO A;  3AKF A;  4IYB A;  4ZFU B;  2FO1 A;  1EPW A;  1W3G A;  2DRE A;  3CQA A;  4I4Y A;  1TOO A;  4OEF A;  3FJH A;  4HJJ A;  4JQ0 A;  1FWV A;  4R6U B;  3OGG A;  4HA2 A;  2D7I A;  1YYN A;  4D0Z A;  1HWP B;  4IZX A;  3I29 B;  3O4C A;  4EFR A;  4ISR A;  1M2T B;  1N4K A;  7I1B A;  2D1Z A;  3FJD A;  3S8J A;  3BRF A;  4JKX B;  1G82 A;  4LO2 A;  1BA7 A;  1PZZ A;  2LIQ A;  2MLL B;  1RY7 A;  1EV2 A;  8I1B A;  41BI A;  2IWT B;  5JLV A;  3MAL A;  5BVP I;  3JRR A;  4EB2 B;  1G9B A;  3BTA A;  3WA1 A;  1IIL A;  3ILA A;  3UJ4 A;  2P23 A;  1HCD A;  1MC9 A;  2YUG A;  4H04 A;  4QAL A;  3R4U A;  3IM6 A;  1K5U A;  1IRA X;  1S0B A;  3ZC9 A;  4GP3 A;  1WD3 A;  1JT3 A;  1JT7 A;  2AXM A;  4I2S A;  1G9D A;  2AAI B;  2IHO A;  2NZ9 A;  4LO7 B;  4LO3 A;  1D0H A;  4I1E A;  3UDA A;  4J2K A;  2VU9 A;  1WD4 A;  1ILR 1;  4WBC A;  4I4S A;  3NBD A;  3O49 A;  4QKS A;  3UJ0 A;  1ISW A;  1QQL A;  1IJT A;  5FNX A;  2FFU A;  2Q9X A;  4G9M A;  1P63 A;  4ZKT B;  4GAF A;  2HZ9 A;  3AZV A;  3NBC A;  1EYL A;  3VSF A;  3CRH A;  1NUN A;  31BI A;  4JRA A;  4I4V A;  4LO2 C;  4ZOT A;  1J0S A;  3FJC A;  2MC2 A;  4IHZ A;  1TWE A;  3H6S E;  1S0E A;  3BRG C;  1T9F A;  4J2Y A;  2VSA A;  1ONK B;  1A8D A;  1CE7 B;  4KEI A;  4D8H A;  3RMX A;  5BXS A;  3OJM A;  3O4O A;  3EF2 A;  4LO0 C;  3RTI B;  3HAL A;  3FJ8 A;  3N7M A;  1AXM A;  1YF8 B;  3NBE A;  1QQK A;  1PC8 B;  2D44 A;  3FJJ A;  1W3A A;  1JLX A;  3CA3 A;  4X39 A;  4ION A;  4IY9 A;  1ISY A;  2NTD A;  4JP0 A;  4END A;  3BRD A;  3PME A;  4I4P A;  5E24 E;  3WO3 A;  1PUU B;  1Z4S A;  4LO3 C;  3W9T A;  3V0A A;  1I1E A;  5BP5 A;  3CA5 A;  4I1B A;  3BAU A;  1TTU A;  5BXR A;  1ISX A;  1IT0 A;  3E8L C;  3CA1 A;  1S0C A;  4I0Y A;  4X3A A;  4Q91 A;  3OGF A;  3RMY A;  2DRY A;  3RTJ B;  4DEN A;  4DEP A;  3IM7 A;  2X2S A;  4P0L A;  1DZD A;  2ERM A;  1HWN B;  3OJ2 A;  2RG9 B;  3NBN A;  4X37 A;  2X2T A;  4X38 A;  4EFQ A;  3OBR A;  1XYF A;  3VT1 A;  1DFQ A;  1WBA A;  5BQU C;  3HMY A;  3BAH A;  1ITB A;  3BAD A;  3FJB A;  3I2X A;  2HWA A;  3K1X A;  1JLY A;  4P0K A;  4P6A A;  2KI6 B;  4QBC A;  4KC3 A;  4G1R A;  1CVS A;  1DFC A;  4FVV A;  1E0O A;  4KBB A;  3AJ6 A;  4GP0 A;  3BA7 A;  3HN1 A;  5EG6 C; 
#chains in the Genus database with same CATH topology
 1XG6 A;  2D22 A;  1JY0 A;  4ZFW B;  4A7Y A;  4F83 A;  1HCE A;  3IM5 A;  5DZU A;  3ZXG A;  2VSE A;  1TWM A;  1FMZ A;  4FGF A;  4QO3 A;  2KI4 A;  3UD7 A;  1SR4 A;  3H6R B;  3KMV A;  4ISQ A;  3QYD A;  3P53 A;  1BFG A;  2WBC A;  3N7J A;  4Q9G A;  5BP5 C;  2D43 A;  3O3Q A;  3H6R A;  4LO8 B;  2AFG A;  1DQG A;  4I3N A;  1ISV A;  3H6Q A;  2MIB A;  1G9A A;  2DS0 A;  3TC2 A;  2F8X C;  3FUO A;  4GOV A;  4EKX B;  2NYY A;  3N7K A;  4I37 A;  2D23 A;  5HPZ A;  3IAG C;  1XHB A;  4KEJ A;  1JTC A;  2BFH A;  1FQ9 A;  3AJ5 A;  5F8W A;  2WRY A;  4I6I A;  5D61 A;  1Q04 A;  1HWM B;  1YTO A;  4KEK A;  3D7W B;  1BLA A;  4ZLB B;  1R8O A;  1EVT A;  1BAS A;  1ABR B;  2FDB M;  5DSS B;  3BB2 A;  3BA5 A;  2E4M A;  1F31 A;  5FZU A;  2QN4 A;  3LTQ A;  3S8K A;  1BFF A;  1NZK A;  3O4B A;  4Z9W B;  2Y9G A;  3CAH A;  4OEG A;  5F8Y A;  1S0G A;  1PUM B;  3VT0 A;  5FZZ A;  2BEA A;  2RQ9 A;  1AFC A;  1S0L A;  6I1B A;  1HIB A;  4OEE A;  3AH2 A;  4DCK C;  4J2X A;  4H9W A;  3CRG A;  4I4Q A;  3P6J A;  3OBT A;  4D0T A;  1DIW A;  3F62 B;  1IOB A;  1JT5 A;  3FJF A;  5D63 A;  2Z48 A;  5FZY A;  2D24 A;  4OUJ A;  4I4R A;  2M49 A;  3V0A B;  5FNW A;  2P39 A;  4JKQ A;  1Q1U A;  4OW4 A;  5G00 A;  5B2H A;  1RML A;  4XFU A;  2L5X A;  4HR6 C;  3CA6 A;  3FGM A;  3AKI A;  3HSM A;  1I1B A;  5D62 A;  1BLD A;  4JAW A;  3I2A A;  1S0F A;  2GO2 A;  3BX1 C;  2DRZ A;  1IRP A;  3CA0 A;  2E4M C;  1Z0H A;  2QYI B;  3A23 A;  3POK A;  1AVA C;  3SNV A;  1FV3 A;  2GZB A;  5EC5 A;  1FN0 A;  2ET2 A;  3FJA A;  1DLL A;  3BAQ A;  1RZO B;  3CA4 A;  1V6V A;  1W3F A;  3HBW A;  1VCL A;  2UUS A;  4XFT A;  1GGP B;  3FUQ A;  4UY4 A;  1PWA A;  1DJS B;  3PUB A;  4QBV A;  5BXT A;  4XKI A;  2F2F A;  2KKI A;  3UD9 A;  3V0B A;  3IIR A;  4MZF B;  1AF9 A;  2FGF A;  2Y9X E;  3FFZ A;  1DQO A;  5EHA A;  4AN6 A;  3VUO A;  3AKH A;  1TIE A;  3T8S A;  3UD8 A;  1HKN A;  4AN7 B;  4EEE B;  9ILB A;  2BEB A;  3LLP A;  3QR5 A;  2D20 A;  3ZX7 A;  5GAQ A;  2NP0 A;  3AH4 A;  4F34 A;  3F1R A;  1XZZ A;  2K4A B;  4LO1 A;  1AVU A;  2KH2 A;  1S0D A;  2LIE A;  3FJ9 A;  3OJV A;  5F8S A;  2K8R A;  2NM1 A;  5BXP A;  3MPP G;  1SZ6 B;  4TLP A;  1QXM A;  1M16 A;  4ZA3 B;  4I96 A;  3FJI A;  4PC4 A;  3V79 C;  1BAR A;  3A21 A;  1IHK A;  3ZC8 A;  3A22 A;  4EFP A;  3JUT A;  1KNM A;  3O4D A;  2KLL A;  2Q3N B;  2ZQO A;  3Q7Y A;  5DUY A;  3O44 A;  3BAV A;  1V6W A;  1JQZ A;  4J23 B;  4LO0 A;  21BI A;  2F2F C;  3AZW A;  4G6J A;  4P0J A;  1YXW A;  3VSZ A;  1R8N A;  4L4I A;  4QD2 B;  4G9N A;  4USP A;  1G9C A;  3WMU A;  3CRI A;  4II0 A;  4MZH A;  1YBI A;  1K5V A;  2I1B A;  1UPS A;  4JPZ A;  2AQZ A;  2FFV A;  3CU1 B;  1SR4 C;  2Z49 A;  3WIN A;  3WO4 A;  2RST A;  4Q9P A;  3C9Z A;  3P6I A;  4IY8 A;  3WO2 A;  1ISZ A;  3VEQ A;  4LO1 C;  3B9U A;  1AVW B;  1HWO B;  4OWK A;  4OWL A;  5I1B A;  4A7Z A;  3NJ5 A;  1RG8 A;  4ZFY B;  2R9K B;  2ZQN A;  2XOA A;  3BAO A;  4I4X A;  4ZBV B;  4CJM A;  5JMC A;  1BFB A;  2J3P A;  4GOY A;  2ZR1 B;  3FJK A;  5DVH A;  3FJE A;  5BQU A;  4OWJ A;  2K43 A;  2Y9F A;  3BA4 A;  3PG0 A;  3ZXD A;  1TP0 A;  2VLC A;  4I8M A;  1L2H A;  4J2S A;  2NVH A;  1Z2V A;  3O4A A;  2HWM A;  3O5W B;  4YOL A;  3RSJ A;  4L4H A;  3HOM A;  3A07 A;  1II4 A;  4I7I A;  4XFS A;  3Q7W A;  1AVX B;  4ZGR B;  2D7R A;  3BAG A;  1FMM S;  1DZC A;  1JT4 A;  4I4O A;  3R4S A;  4QD2 C;  3VT2 A;  4H75 A;  3VWC A;  4IQP A;  3WIN C;  2ESU A;  4G6M A;  1Q03 A;  3N7L A;  2VXT I;  1TFM B;  5F90 A;  4QC4 A;  1FGA A;  1V6U A;  4GAI A;  4QKR A;  1OQL B;  4LO7 C;  1WBC A;  3V0B B;  4IZE A;  1FV2 A;  4Z8S B;  2VUA A;  3WMV A;  2Y9W C;  2NS2 A;  3N0K A;  4A7K A;  2VXR A;  1FWU A;  1MD6 A;  5BOW A;  3Q7X A;  2HW9 A;  1V6X A;  4I4U A;  1BFC A;  3AKG A;  3PHZ A;  3AH1 A;  1T4Q A;  4USO A;  3AKF A;  4IYB A;  4ZFU B;  2FO1 A;  1EPW A;  1W3G A;  2DRE A;  3CQA A;  4I4Y A;  1TOO A;  4OEF A;  3FJH A;  4HJJ A;  4JQ0 A;  1FWV A;  4R6U B;  3OGG A;  4HA2 A;  2D7I A;  1YYN A;  4D0Z A;  1HWP B;  4MZG B;  4IZX A;  3I29 B;  3O4C A;  4EFR A;  4ISR A;  1M2T B;  1N4K A;  7I1B A;  2D1Z A;  3FJD A;  3S8J A;  3BRF A;  4JKX B;  1G82 A;  4LO2 A;  1BA7 A;  1PZZ A;  2LIQ A;  2MLL B;  1RY7 A;  1EV2 A;  8I1B A;  41BI A;  2IWT B;  5JLV A;  3MAL A;  5BVP I;  3JRR A;  4EB2 B;  1G9B A;  3BTA A;  3WA1 A;  1IIL A;  3ILA A;  3UJ4 A;  2P23 A;  1HCD A;  1MC9 A;  2YUG A;  4H04 A;  4QAL A;  3R4U A;  3IM6 A;  1K5U A;  1IRA X;  1S0B A;  3ZC9 A;  4GP3 A;  1WD3 A;  1JT3 A;  1JT7 A;  2AXM A;  4I2S A;  1G9D A;  2AAI B;  2IHO A;  2NZ9 A;  4LO7 B;  4LO3 A;  1D0H A;  4I1E A;  3UDA A;  4J2K A;  2VU9 A;  1WD4 A;  1ILR 1;  4WBC A;  4I4S A;  3NBD A;  3O49 A;  4QKS A;  3UJ0 A;  1ISW A;  1QQL A;  1IJT A;  5FNX A;  2FFU A;  2Q9X A;  4G9M A;  1P63 A;  4ZKT B;  4GAF A;  2HZ9 A;  3AZV A;  3NBC A;  1EYL A;  3VSF A;  3CRH A;  1NUN A;  31BI A;  4JRA A;  4I4V A;  4LO2 C;  4ZOT A;  1J0S A;  3FJC A;  2MC2 A;  4IHZ A;  1TWE A;  3H6S E;  1S0E A;  3BRG C;  1T9F A;  4J2Y A;  2VSA A;  1ONK B;  1A8D A;  1CE7 B;  4KEI A;  4D8H A;  3RMX A;  5BXS A;  3OJM A;  3O4O A;  3EF2 A;  4LO0 C;  3RTI B;  3HAL A;  3FJ8 A;  3N7M A;  1AXM A;  1YF8 B;  3NBE A;  1QQK A;  1PC8 B;  2D44 A;  3FJJ A;  1W3A A;  1JLX A;  3CA3 A;  4X39 A;  4ION A;  4IY9 A;  1ISY A;  2NTD A;  4JP0 A;  4END A;  3BRD A;  3PME A;  4I4P A;  5E24 E;  3WO3 A;  1PUU B;  1Z4S A;  4LO3 C;  3W9T A;  3V0A A;  1I1E A;  5BP5 A;  3CA5 A;  4I1B A;  3BAU A;  1TTU A;  5BXR A;  1ISX A;  1IT0 A;  3E8L C;  3CA1 A;  1S0C A;  4I0Y A;  4X3A A;  4Q91 A;  3OGF A;  3RMY A;  2DRY A;  3RTJ B;  4DEN A;  4DEP A;  3IM7 A;  2X2S A;  4P0L A;  1DZD A;  2ERM A;  1HWN B;  3OJ2 A;  2RG9 B;  3NBN A;  4X37 A;  2X2T A;  4X38 A;  4EFQ A;  3OBR A;  1XYF A;  3VT1 A;  1DFQ A;  1WBA A;  5BQU C;  3HMY A;  3BAH A;  1ITB A;  3BAD A;  3FJB A;  3I2X A;  2HWA A;  3K1X A;  1JLY A;  4P0K A;  4P6A A;  2KI6 B;  4QBC A;  4KC3 A;  4G1R A;  1CVS A;  1DFC A;  4FVV A;  1E0O A;  4KBB A;  3AJ6 A;  4GP0 A;  3BA7 A;  3HN1 A;  5EG6 C; 
#chains in the Genus database with same CATH homology
 1XG6 A;  2D22 A;  1JY0 A;  4ZFW B;  4A7Y A;  4F83 A;  1HCE A;  3IM5 A;  5DZU A;  3ZXG A;  2VSE A;  1TWM A;  1FMZ A;  4FGF A;  4QO3 A;  2KI4 A;  3UD7 A;  1SR4 A;  3H6R B;  3KMV A;  4ISQ A;  3QYD A;  3P53 A;  1BFG A;  2WBC A;  3N7J A;  4Q9G A;  5BP5 C;  2D43 A;  3O3Q A;  3H6R A;  4LO8 B;  2AFG A;  1DQG A;  4I3N A;  1ISV A;  3H6Q A;  2MIB A;  1G9A A;  2DS0 A;  3TC2 A;  2F8X C;  3FUO A;  4GOV A;  4EKX B;  2NYY A;  3N7K A;  4I37 A;  2D23 A;  5HPZ A;  3IAG C;  1XHB A;  4KEJ A;  1JTC A;  2BFH A;  1FQ9 A;  3AJ5 A;  5F8W A;  2WRY A;  4I6I A;  5D61 A;  1Q04 A;  1HWM B;  1YTO A;  4KEK A;  3D7W B;  1BLA A;  4ZLB B;  1R8O A;  1EVT A;  1BAS A;  1ABR B;  2FDB M;  5DSS B;  3BB2 A;  3BA5 A;  2E4M A;  1F31 A;  5FZU A;  2QN4 A;  3LTQ A;  3S8K A;  1BFF A;  1NZK A;  3O4B A;  4Z9W B;  2Y9G A;  3CAH A;  4OEG A;  5F8Y A;  1S0G A;  1PUM B;  3VT0 A;  5FZZ A;  2BEA A;  2RQ9 A;  1AFC A;  1S0L A;  6I1B A;  1HIB A;  4OEE A;  3AH2 A;  4DCK C;  4J2X A;  4H9W A;  3CRG A;  4I4Q A;  3P6J A;  3OBT A;  4D0T A;  1DIW A;  3F62 B;  1IOB A;  1JT5 A;  3FJF A;  5D63 A;  2Z48 A;  5FZY A;  2D24 A;  4OUJ A;  4I4R A;  2M49 A;  3V0A B;  5FNW A;  2P39 A;  4JKQ A;  1Q1U A;  4OW4 A;  5G00 A;  5B2H A;  1RML A;  4XFU A;  2L5X A;  4HR6 C;  3CA6 A;  3FGM A;  3AKI A;  3HSM A;  1I1B A;  5D62 A;  1BLD A;  4JAW A;  3I2A A;  1S0F A;  2GO2 A;  3BX1 C;  2DRZ A;  1IRP A;  3CA0 A;  2E4M C;  1Z0H A;  2QYI B;  3A23 A;  3POK A;  1AVA C;  3SNV A;  1FV3 A;  2GZB A;  5EC5 A;  1FN0 A;  2ET2 A;  3FJA A;  1DLL A;  3BAQ A;  1RZO B;  3CA4 A;  1V6V A;  1W3F A;  3HBW A;  1VCL A;  2UUS A;  4XFT A;  1GGP B;  3FUQ A;  4UY4 A;  1PWA A;  1DJS B;  3PUB A;  4QBV A;  5BXT A;  4XKI A;  2F2F A;  2KKI A;  3UD9 A;  3V0B A;  3IIR A;  4MZF B;  1AF9 A;  2FGF A;  2Y9X E;  3FFZ A;  1DQO A;  5EHA A;  4AN6 A;  3VUO A;  3AKH A;  1TIE A;  3T8S A;  3UD8 A;  1HKN A;  4AN7 B;  4EEE B;  9ILB A;  2BEB A;  3LLP A;  3QR5 A;  2D20 A;  3ZX7 A;  5GAQ A;  2NP0 A;  3AH4 A;  4F34 A;  3F1R A;  1XZZ A;  2K4A B;  4LO1 A;  1AVU A;  2KH2 A;  1S0D A;  2LIE A;  3FJ9 A;  3OJV A;  5F8S A;  2K8R A;  2NM1 A;  5BXP A;  3MPP G;  1SZ6 B;  4TLP A;  1QXM A;  1M16 A;  4ZA3 B;  4I96 A;  3FJI A;  4PC4 A;  3V79 C;  1BAR A;  3A21 A;  1IHK A;  3ZC8 A;  3A22 A;  4EFP A;  3JUT A;  1KNM A;  3O4D A;  2KLL A;  2Q3N B;  2ZQO A;  3Q7Y A;  5DUY A;  3O44 A;  3BAV A;  1V6W A;  1JQZ A;  4J23 B;  4LO0 A;  21BI A;  2F2F C;  3AZW A;  4G6J A;  4P0J A;  1YXW A;  3VSZ A;  1R8N A;  4L4I A;  4QD2 B;  4G9N A;  4USP A;  1G9C A;  3WMU A;  3CRI A;  4II0 A;  4MZH A;  1YBI A;  1K5V A;  2I1B A;  1UPS A;  4JPZ A;  2AQZ A;  2FFV A;  3CU1 B;  1SR4 C;  2Z49 A;  3WIN A;  3WO4 A;  2RST A;  4Q9P A;  3C9Z A;  3P6I A;  4IY8 A;  3WO2 A;  1ISZ A;  3VEQ A;  4LO1 C;  3B9U A;  1AVW B;  1HWO B;  4OWK A;  4OWL A;  5I1B A;  4A7Z A;  3NJ5 A;  1RG8 A;  4ZFY B;  2R9K B;  2ZQN A;  2XOA A;  3BAO A;  4I4X A;  4ZBV B;  4CJM A;  5JMC A;  1BFB A;  2J3P A;  4GOY A;  2ZR1 B;  3FJK A;  5DVH A;  3FJE A;  5BQU A;  4OWJ A;  2K43 A;  2Y9F A;  3BA4 A;  3PG0 A;  3ZXD A;  1TP0 A;  2VLC A;  4I8M A;  1L2H A;  4J2S A;  2NVH A;  1Z2V A;  3O4A A;  2HWM A;  3O5W B;  4YOL A;  3RSJ A;  4L4H A;  3HOM A;  3A07 A;  1II4 A;  4I7I A;  4XFS A;  3Q7W A;  1AVX B;  4ZGR B;  2D7R A;  3BAG A;  1FMM S;  1DZC A;  1JT4 A;  4I4O A;  3R4S A;  4QD2 C;  3VT2 A;  4H75 A;  3VWC A;  4IQP A;  3WIN C;  2ESU A;  4G6M A;  1Q03 A;  3N7L A;  2VXT I;  1TFM B;  5F90 A;  4QC4 A;  1FGA A;  1V6U A;  4GAI A;  4QKR A;  1OQL B;  4LO7 C;  1WBC A;  3V0B B;  4IZE A;  1FV2 A;  4Z8S B;  2VUA A;  3WMV A;  2Y9W C;  2NS2 A;  3N0K A;  4A7K A;  2VXR A;  1FWU A;  1MD6 A;  5BOW A;  3Q7X A;  2HW9 A;  1V6X A;  4I4U A;  1BFC A;  3AKG A;  3PHZ A;  3AH1 A;  1T4Q A;  4USO A;  3AKF A;  4IYB A;  4ZFU B;  2FO1 A;  1EPW A;  1W3G A;  2DRE A;  3CQA A;  4I4Y A;  1TOO A;  4OEF A;  3FJH A;  4HJJ A;  4JQ0 A;  1FWV A;  4R6U B;  3OGG A;  4HA2 A;  2D7I A;  1YYN A;  4D0Z A;  1HWP B;  4MZG B;  4IZX A;  3I29 B;  3O4C A;  4EFR A;  4ISR A;  1M2T B;  1N4K A;  7I1B A;  2D1Z A;  3FJD A;  3S8J A;  3BRF A;  4JKX B;  1G82 A;  4LO2 A;  1BA7 A;  1PZZ A;  2LIQ A;  2MLL B;  1RY7 A;  1EV2 A;  8I1B A;  41BI A;  2IWT B;  5JLV A;  3MAL A;  5BVP I;  3JRR A;  4EB2 B;  1G9B A;  3BTA A;  3WA1 A;  1IIL A;  3ILA A;  3UJ4 A;  2P23 A;  1HCD A;  1MC9 A;  2YUG A;  4H04 A;  4QAL A;  3R4U A;  3IM6 A;  1K5U A;  1IRA X;  1S0B A;  3ZC9 A;  4GP3 A;  1WD3 A;  1JT3 A;  1JT7 A;  2AXM A;  4I2S A;  1G9D A;  2AAI B;  2IHO A;  2NZ9 A;  4LO7 B;  4LO3 A;  1D0H A;  4I1E A;  3UDA A;  4J2K A;  2VU9 A;  1WD4 A;  1ILR 1;  4WBC A;  4I4S A;  3NBD A;  3O49 A;  4QKS A;  3UJ0 A;  1ISW A;  1QQL A;  1IJT A;  5FNX A;  2FFU A;  2Q9X A;  4G9M A;  1P63 A;  4ZKT B;  4GAF A;  2HZ9 A;  3AZV A;  3NBC A;  1EYL A;  3VSF A;  3CRH A;  1NUN A;  31BI A;  4JRA A;  4I4V A;  4LO2 C;  4ZOT A;  1J0S A;  3FJC A;  2MC2 A;  4IHZ A;  1TWE A;  3H6S E;  1S0E A;  3BRG C;  1T9F A;  4J2Y A;  2VSA A;  1ONK B;  1A8D A;  1CE7 B;  4KEI A;  4D8H A;  3RMX A;  5BXS A;  3OJM A;  3O4O A;  3EF2 A;  4LO0 C;  3RTI B;  3HAL A;  3FJ8 A;  3N7M A;  1AXM A;  1YF8 B;  3NBE A;  1QQK A;  1PC8 B;  2D44 A;  3FJJ A;  1W3A A;  1JLX A;  3CA3 A;  4X39 A;  4ION A;  4IY9 A;  1ISY A;  2NTD A;  4JP0 A;  4END A;  3BRD A;  3PME A;  4I4P A;  5E24 E;  3WO3 A;  1PUU B;  1Z4S A;  4LO3 C;  3W9T A;  3V0A A;  1I1E A;  5BP5 A;  3CA5 A;  4I1B A;  3BAU A;  1TTU A;  5BXR A;  1ISX A;  1IT0 A;  3E8L C;  3CA1 A;  1S0C A;  4I0Y A;  4X3A A;  4Q91 A;  3OGF A;  3RMY A;  2DRY A;  3RTJ B;  4DEN A;  4DEP A;  3IM7 A;  2X2S A;  4P0L A;  1DZD A;  2ERM A;  1HWN B;  3OJ2 A;  2RG9 B;  3NBN A;  4X37 A;  2X2T A;  4X38 A;  4EFQ A;  3OBR A;  1XYF A;  3VT1 A;  1DFQ A;  1WBA A;  5BQU C;  3HMY A;  3BAH A;  1ITB A;  3BAD A;  3FJB A;  3I2X A;  2HWA A;  3K1X A;  1JLY A;  4P0K A;  4P6A A;  2KI6 B;  4QBC A;  4KC3 A;  4G1R A;  1CVS A;  1DFC A;  4FVV A;  1E0O A;  4KBB A;  3AJ6 A;  4GP0 A;  3BA7 A;  3HN1 A;  5EG6 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...