4FGFA

Refinement of the structure of human basic fibroblast growth factor at 1.6 angstroms resolution and analysis of presumed heparin binding sites by selenate substitution
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
b'PKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BASIC FIBROBLAST GROWTH FACTOR
publication title Refinement of the structure of human basic fibroblast growth factor at 1.6 A resolution and analysis of presumed heparin binding sites by selenate substitution.
pubmed rcsb
source organism Homo sapiens
molecule tags Growth factor
total genus 31
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 1993-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4fgfA00
4I4OA 1R8NA 5BXSA 3AKHA 3P6IA 2RG9B 1M16A 3FJIA 1DQOA 3AZVA 1W3FA 2Q3NB 3CA1A 3VT1A 2VXRA 4L4IA 1EYLA 2WBCA 3RMXA 2D7IA 1BFFA 1FV2A 4GOVA 3W9TA 3VT0A 3T8SA 4JKXB 4I4SA 3FJ8A 4X37A 3FFZA 3D7WB 2NZ9A 4I37A 3BAOA 1PC8B 4Q91A 4D8HA 3LLPA 4Z9WB 1HCEA 1AFCA 3FJCA 2QN4A 5I1BA 3A23A 1DFCA 3OBTA 2AQZA 1K5VA 2VUAA 3ZC8A 3CRGA 1Q04A 2BEAA 3AZWA 3QR5A 3FJKA 1CVSA 3I2XA 2VU9A 4GAFA 3JUTA 1L2HA 5D62A 1FWVA 4AN6A 3S8KA 1JT5A 3FJJA 1JLYA 2J3PA 2AAIB 2KKIA 3HALA 4GP3A 3BAGA 2Z49A 3RTJB 3AH4A 4I4XA 4ZFUB 1S0DA 2L5XA 1N4KA 3LTQA 4KC3A 5DVHA 3CA4A 3FJEA 1BASA 4QD2B 4ZGRB 8I1BA 3AKFA 4EFPA 3O44A 3O4DA 3VUOA 2E4MA 4IY8A 1TTUA 4L4HA 3VT2A 4A7YA 2FO1A 5BXTA 3UD9A 4JKQA 2RQ9A 1CE7B 3N7LA 3IM7A 4I8MA 1W3GA 1NUNA 21BIA 2FFVA 4I1EA 1HCDA 1IT0A 3BA5A 2P23A 2F8XC 2D7RA 2MIBA 3QYDA 1FQ9A 3FJBA 4OWLA 3BAQA 5DSSB 3PMEA 4LO3A 4J23B 3F1RA 1P63A 3S8JA 2HZ9A 1Z2VA 5G00A 2ERMA 3A22A 3ZXDA 3OGGA 4DCKC 4ZBVB 1HWOB 2D20A 1XHBA 1E0OA 2KI4A 4P0KA 4D0TA 3BRGC 3CA6A 3RSJA 2DRYA 1FGAA 3AH2A 4Q9PA 2D1ZA 4J2KA 5EC5A 4II0A 1YBIA 3HSMA 2Z48A 1WBCA 3A21A 5FNWA 3BA7A 3KMVA 3P6JA 3BA4A 3V0BB 1DZCA 5B2HA 3H6RB 4LO7B 4G1RA 3WO3A 2DRZA 3WO4A 1DFQA 3SNVA 3ZXGA 4XKIA 1PWAA 1S0LA 4IQPA 1JY0A 1TWEA 4QKSA 5BXRA 4I6IA 1AXMA 4LO2A 4DEPA 4GAIA 4ZLBB 1HIBA 4FVVA 5JLVA 1V6XA 3BAHA 4PC4A 4GOYA 4IZEA 2IWTB 1SR4C 3O5WB 4ISQA 3FJDA 3CA0A 4I7IA 1TP0A 4HA2A 4LO7C 5BP5C 1ISYA 1V6UA 3WINA 4ZFWB 31BIA 3FJFA 4GP0A 3N0KA 3CRIA 3IIRA 1JT4A 1BLAA 1ISWA 3UD7A 3I29B 1T4QA 3BRFA 1W3AA 4JPZA 4OW4A 3Q7XA 4I4QA 3PG0A 4I4PA 5DUYA 1HWPB 1XG6A 1F31A 2I1BA 1NZKA 3Q7YA 4LO1A 4IHZA 5EHAA 3VWCA 1G9AA 5DZUA 1IRAX 2YUGA 1AF9A 3VSFA 4KEIA 2QYIB 4WBCA 4OWJA 4EFQA 1QXMA 5HPZA 4KEKA 1ABRB 4ZFYB 5BQUA 1TWMA 3B9UA 3O3QA 4IONA 2RSTA 1DJSB 1WD3A 2AFGA 1R8OA 1YF8B 1TOOA 2ZQOA 3CRHA 3O4CA 2AXMA 1Q1UA 2WRYA 4OWKA 3JRRA 4Z8SB 1HKNA 1BFCA 1MD6A 1D0HA 2KH2A 1ISVA 3N7JA 1WD4A 2BFHA 1V6VA 2LIEA 4HJJA 1XZZA 3V0AB 3NBNA 1VCLA 3H6QA 4USPA 1ISZA 1IOBA 4I4VA 4EFRA 5D63A 4ZKTB 3O49A 1AVAC 2R9KB 4J2YA 4OUJA 4QO3A 3FJ9A 2E4MC 2X2TA 1S0GA 1PUUB 1MC9A 3Q7WA 1S0BA 4X38A 5D61A 1I1EA 2ESUA 1DZDA 3CU1B 1ISXA 1Q03A 2M49A 5F8SA 2FFUA 4XFSA 4ZOTA 4I3NA 3WA1A 1YYNA 2NYYA 1PZZA 1JT7A 4JP0A 3CA5A 2MLLB 1IILA 3F62B 1G82A 1RMLA 2Q9XA 4I4RA 3R4SA 2LIQA 3CA3A 1EPWA 4IY9A 3HOMA 4F34A 3O4BA 1AVUA 1M2TB 41BIA 4P6AA 1AVXB 1I1BA 3IM6A 1BARA 4G9MA 4JRAA 2D23A 3ZX7A 1YXWA 2D24A 3NBEA 4QBVA 3BB2A 4EKXB 4EEEB 5F8YA 3PHZA 2HWMA 4QBCA 3WMUA 2DREA 3NBCA 2BEBA 4I2SA 1TFMB 2ZR1B 1IJTA 1WBAA 6I1BA 1QQLA 4R6UB 4ZA3B 4I96A 2ZQNA 2NTDA 9ILBA 2D44A 1Z0HA 5F90A 3WMVA 2NVHA 2F2FA 1GGPB 3AKGA 5FNXA 4DENA 3BADA 1AVWB 3CAHA 4LO0A 1G9CA 5BXPA 1S0EA 3TC2A 3IAGC 2K43A 2Y9WC 1XYFA 2X2SA 3MALA 4F83A 3NJ5A 3WINC 4QKRA 2Y9XE 2D43A 1Z4SA 4OEEA 3OJVA 3V0BA 3V79C 2FGFA 1SZ6B 3POKA 3R4UA 3H6RA 5BP5A 3VSZA 2VLCA 5FZZA 3OGFA 3BAUA 1T9FA 1IRPA 4LO1C 1HWMB 1RG8A 1RZOB 4FGFA 3RTIB 2DS0A 1YTOA 1S0FA 4JQ0A 4I4UA 4IYBA 3HBWA 4A7KA 5BQUC 4P0JA 1TIEA 1IHKA 3CQAA 1PUMB 4J2SA 3K1XA 5EG6C 4XFUA 3IM5A 3FUOA 3H6SE 3BRDA 2FDBM 4P0LA 4JAWA 1S0CA 3FJHA 2VXTI 4EB2B 3BTAA 4USOA 1A8DA 1DLLA 3FJAA 3N7KA 1G9BA 4KEJA 1HWNB 4X39A 4G9NA 4ISRA 4LO8B 4OEFA 1ONKB 3WO2A 1QQKA 1V6WA 5FZUA 3O4AA 2MC2A 2NP0A 4H9WA 2P39A 4I4YA 1ILR1 3BX1C 7I1BA 3OBRA 4Q9GA 3PUBA 1J0SA 2UUSA 1JLXA 5F8WA 5FZYA 1ITBA 4CJMA 4I1BA 1FWUA 3HN1A 1BFBA 4X3AA 3AJ6A 1FMZA 3FGMA 1EVTA 1DIWA 5JMCA 4LO3C 1DQGA 1FMMS 5BVPI 2K4AB 3MPPG 2GZBA 4J2XA 2GO2A 1UPSA 2IHOA 4OEGA 3P53A 3RMYA 3AKIA 3UDAA 3NBDA 3V0AA 2XOAA 1FN0A 4A7ZA 4QD2C 2ET2A 1RY7A 3UJ0A 3BAVA 4IZXA 2VSEA 1BFGA 1EV2A 3UJ4A 5BOWA 5E24E 4G6JA 2KI6B 4AN7B 4KBBA 2HW9A 1G9DA 1FV3A 3FUQA 1JTCA 2KLLA 3N7MA 1II4A 3A07A 4D0ZA 1JT3A 2D22A 2Y9GA 3ZC9A 2VSAA 2HWAA 4LO2C 4YOLA 1OQLB 1KNMA 2F2FC 3C9ZA 4ENDA 3O4OA 3E8LC 3AJ5A 4HR6C 1BA7A 3I2AA 3HMYA 3EF2A 1JQZA 5GAQA 4QC4A 4I0YA 1K5UA 4LO0C 2K8RA 3AH1A 3UD8A 4QALA 1BLDA 2NM1A 2Y9FA 4XFTA 4TLPA 3OJMA 3ILAA 1SR4A 3OJ2A 4H04A 4G6MA 3VEQA
chains in the Genus database with same CATH superfamily
4I4OA 1R8NA 5BXSA 3AKHA 3P6IA 4MZHA 2RG9B 1M16A 3FJIA 1DQOA 3AZVA 1W3FA 2Q3NB 3CA1A 3VT1A 2VXRA 4L4IA 1EYLA 2WBCA 3RMXA 2D7IA 1BFFA 1FV2A 4GOVA 3W9TA 3VT0A 3T8SA 4JKXB 4I4SA 3FJ8A 4X37A 3FFZA 3D7WB 2NZ9A 4I37A 3BAOA 1PC8B 4Q91A 4D8HA 3LLPA 4Z9WB 1HCEA 1AFCA 3FJCA 2QN4A 5I1BA 3A23A 1DFCA 3OBTA 2AQZA 1K5VA 2VUAA 3ZC8A 3CRGA 1Q04A 2BEAA 3AZWA 3QR5A 3FJKA 1CVSA 3I2XA 2VU9A 4GAFA 3JUTA 1L2HA 5D62A 1FWVA 4AN6A 3S8KA 1JT5A 3FJJA 1JLYA 2J3PA 2AAIB 2KKIA 3HALA 4GP3A 3BAGA 2Z49A 3RTJB 3AH4A 4I4XA 4ZFUB 1S0DA 2L5XA 1N4KA 3LTQA 4KC3A 5DVHA 3CA4A 3FJEA 1BASA 4QD2B 4ZGRB 8I1BA 3AKFA 4EFPA 3O44A 3O4DA 3VUOA 2E4MA 4IY8A 1TTUA 4L4HA 3VT2A 4A7YA 2FO1A 5BXTA 3UD9A 4JKQA 2RQ9A 1CE7B 3N7LA 3IM7A 4I8MA 1W3GA 1NUNA 21BIA 2FFVA 4I1EA 1HCDA 1IT0A 3BA5A 2P23A 2F8XC 2D7RA 2MIBA 3QYDA 1FQ9A 3FJBA 4OWLA 3BAQA 5DSSB 3PMEA 4LO3A 4J23B 3F1RA 1P63A 3S8JA 2HZ9A 4UY4A 1Z2VA 5G00A 2ERMA 3A22A 3ZXDA 3OGGA 4DCKC 4ZBVB 1HWOB 2D20A 1XHBA 1E0OA 2KI4A 4P0KA 4D0TA 3BRGC 3CA6A 3RSJA 2DRYA 1FGAA 3AH2A 4Q9PA 2D1ZA 4J2KA 5EC5A 4II0A 1YBIA 3HSMA 2Z48A 1WBCA 3A21A 5FNWA 3BA7A 3KMVA 3P6JA 4MZGB 3BA4A 3V0BB 1DZCA 5B2HA 3H6RB 4LO7B 4G1RA 3WO3A 2DRZA 3WO4A 1DFQA 3SNVA 3ZXGA 4XKIA 1PWAA 1S0LA 4IQPA 1JY0A 1TWEA 4QKSA 5BXRA 4I6IA 1AXMA 4LO2A 4DEPA 4GAIA 4ZLBB 1HIBA 4FVVA 5JLVA 1V6XA 3BAHA 4PC4A 4GOYA 4IZEA 2IWTB 1SR4C 3O5WB 4ISQA 3FJDA 3CA0A 4I7IA 1TP0A 4HA2A 4LO7C 5BP5C 1ISYA 1V6UA 3WINA 4ZFWB 31BIA 3FJFA 4GP0A 3N0KA 3CRIA 3IIRA 1JT4A 1BLAA 1ISWA 3UD7A 3I29B 1T4QA 3BRFA 1W3AA 4JPZA 4OW4A 3Q7XA 2NS2A 4I4QA 3PG0A 4I4PA 5DUYA 1HWPB 1XG6A 1F31A 2I1BA 1NZKA 3Q7YA 4LO1A 4IHZA 5EHAA 3VWCA 1G9AA 5DZUA 1IRAX 2YUGA 1AF9A 3VSFA 4KEIA 2QYIB 4WBCA 4OWJA 4EFQA 1QXMA 5HPZA 4KEKA 1ABRB 4ZFYB 5BQUA 1TWMA 3B9UA 3O3QA 4IONA 2RSTA 1DJSB 1WD3A 2AFGA 1R8OA 1YF8B 1TOOA 2ZQOA 3CRHA 3O4CA 2AXMA 1Q1UA 2WRYA 4OWKA 3JRRA 4Z8SB 1HKNA 1BFCA 1MD6A 1D0HA 2KH2A 1ISVA 3N7JA 1WD4A 2BFHA 1V6VA 2LIEA 4HJJA 1XZZA 3V0AB 3NBNA 1VCLA 3H6QA 4USPA 1ISZA 1IOBA 4I4VA 4EFRA 5D63A 4ZKTB 3O49A 1AVAC 2R9KB 4J2YA 4OUJA 4QO3A 3FJ9A 2E4MC 2X2TA 1S0GA 1PUUB 1MC9A 3Q7WA 1S0BA 4X38A 5D61A 1I1EA 2ESUA 1DZDA 3CU1B 1ISXA 1Q03A 2M49A 5F8SA 2FFUA 4XFSA 4ZOTA 4I3NA 3WA1A 1YYNA 2NYYA 1PZZA 1JT7A 4JP0A 3CA5A 2MLLB 1IILA 3F62B 1G82A 1RMLA 2Q9XA 4I4RA 3R4SA 2LIQA 3CA3A 1EPWA 4IY9A 3HOMA 4F34A 3O4BA 1AVUA 1M2TB 41BIA 4P6AA 1AVXB 1I1BA 3IM6A 1BARA 4G9MA 4JRAA 2D23A 3ZX7A 1YXWA 2D24A 3NBEA 4QBVA 3BB2A 4EKXB 4EEEB 5F8YA 3PHZA 2HWMA 4QBCA 3WMUA 2DREA 3NBCA 2BEBA 4I2SA 1TFMB 2ZR1B 1IJTA 1WBAA 6I1BA 1QQLA 4R6UB 4ZA3B 4I96A 2ZQNA 2NTDA 9ILBA 2D44A 1Z0HA 5F90A 3WMVA 2NVHA 2F2FA 1GGPB 3AKGA 5FNXA 4DENA 3BADA 1AVWB 3CAHA 4LO0A 1G9CA 5BXPA 1S0EA 3TC2A 3IAGC 2K43A 2Y9WC 1XYFA 2X2SA 3MALA 4F83A 3NJ5A 3WINC 4QKRA 2Y9XE 2D43A 1Z4SA 4OEEA 3OJVA 3V0BA 3V79C 2FGFA 1SZ6B 3POKA 3R4UA 4MZFB 3H6RA 5BP5A 3VSZA 2VLCA 5FZZA 3OGFA 3BAUA 1T9FA 1IRPA 4LO1C 1HWMB 1RG8A 1RZOB 4FGFA 3RTIB 2DS0A 1YTOA 1S0FA 4JQ0A 4I4UA 4IYBA 3HBWA 4A7KA 5BQUC 4P0JA 1TIEA 1IHKA 3CQAA 1PUMB 4J2SA 3K1XA 5EG6C 4XFUA 3IM5A 3FUOA 3H6SE 3BRDA 2FDBM 4P0LA 4JAWA 1S0CA 3FJHA 2VXTI 4EB2B 3BTAA 4USOA 1A8DA 1DLLA 3FJAA 3N7KA 1G9BA 4KEJA 1HWNB 4X39A 4G9NA 4ISRA 4LO8B 4OEFA 1ONKB 3WO2A 1QQKA 1V6WA 5FZUA 3O4AA 2MC2A 2NP0A 4H9WA 2P39A 4I4YA 1ILR1 3BX1C 7I1BA 3OBRA 4Q9GA 3PUBA 1J0SA 2UUSA 1JLXA 5F8WA 5FZYA 1ITBA 4CJMA 4I1BA 1FWUA 3HN1A 1BFBA 4X3AA 3AJ6A 1FMZA 3FGMA 1EVTA 1DIWA 5JMCA 4LO3C 1DQGA 1FMMS 5BVPI 2K4AB 3MPPG 2GZBA 4J2XA 2GO2A 1UPSA 2IHOA 4H75A 4OEGA 3P53A 3RMYA 3AKIA 3UDAA 3NBDA 3V0AA 2XOAA 1FN0A 4A7ZA 4QD2C 2ET2A 1RY7A 3UJ0A 3BAVA 4IZXA 2VSEA 1BFGA 1EV2A 3UJ4A 5BOWA 5E24E 4G6JA 2KI6B 4AN7B 4KBBA 2HW9A 1G9DA 1FV3A 3FUQA 1JTCA 2KLLA 3N7MA 1II4A 3A07A 4D0ZA 1JT3A 2D22A 2Y9GA 3ZC9A 2VSAA 2HWAA 4LO2C 4YOLA 1OQLB 1KNMA 2F2FC 3C9ZA 4ENDA 3O4OA 3E8LC 3AJ5A 4HR6C 1BA7A 3I2AA 3HMYA 3EF2A 1JQZA 5GAQA 4QC4A 4I0YA 1K5UA 4LO0C 2K8RA 3AH1A 3UD8A 4QALA 1BLDA 2NM1A 2Y9FA 4XFTA 4TLPA 3OJMA 3ILAA 1SR4A 3OJ2A 4H04A 4G6MA 3VEQA
chains in the Genus database with same CATH topology
4I4OA 1R8NA 5BXSA 3AKHA 3P6IA 4MZHA 2RG9B 1M16A 3FJIA 1DQOA 3AZVA 1W3FA 2Q3NB 3CA1A 3VT1A 2VXRA 4L4IA 1EYLA 2WBCA 3RMXA 2D7IA 1BFFA 1FV2A 4GOVA 3W9TA 3VT0A 3T8SA 4JKXB 4I4SA 3FJ8A 4X37A 3FFZA 3D7WB 2NZ9A 4I37A 3BAOA 1PC8B 4Q91A 4D8HA 3LLPA 4Z9WB 1HCEA 1AFCA 3FJCA 2QN4A 5I1BA 3A23A 1DFCA 3OBTA 2AQZA 1K5VA 2VUAA 3ZC8A 3CRGA 1Q04A 2BEAA 3AZWA 3QR5A 3FJKA 1CVSA 3I2XA 2VU9A 4GAFA 3JUTA 1L2HA 5D62A 1FWVA 4AN6A 3S8KA 1JT5A 3FJJA 1JLYA 2J3PA 2AAIB 2KKIA 3HALA 4GP3A 3BAGA 2Z49A 3RTJB 3AH4A 4I4XA 4ZFUB 1S0DA 2L5XA 1N4KA 3LTQA 4KC3A 5DVHA 3CA4A 3FJEA 1BASA 4QD2B 4ZGRB 8I1BA 3AKFA 4EFPA 3O44A 3O4DA 3VUOA 2E4MA 4IY8A 1TTUA 4L4HA 3VT2A 4A7YA 2FO1A 5BXTA 3UD9A 4JKQA 2RQ9A 1CE7B 3N7LA 3IM7A 4I8MA 1W3GA 1NUNA 21BIA 2FFVA 4I1EA 1HCDA 1IT0A 3BA5A 2P23A 2F8XC 2D7RA 2MIBA 3QYDA 1FQ9A 3FJBA 4OWLA 3BAQA 5DSSB 3PMEA 4LO3A 4J23B 3F1RA 1P63A 3S8JA 2HZ9A 4UY4A 1Z2VA 5G00A 2ERMA 3A22A 3ZXDA 3OGGA 4DCKC 4ZBVB 1HWOB 2D20A 1XHBA 1E0OA 2KI4A 4P0KA 4D0TA 3BRGC 3CA6A 3RSJA 2DRYA 1FGAA 3AH2A 4Q9PA 2D1ZA 4J2KA 5EC5A 4II0A 1YBIA 3HSMA 2Z48A 1WBCA 3A21A 5FNWA 3BA7A 3KMVA 3P6JA 4MZGB 3BA4A 3V0BB 1DZCA 5B2HA 3H6RB 4LO7B 4G1RA 3WO3A 2DRZA 3WO4A 1DFQA 3SNVA 3ZXGA 4XKIA 1PWAA 1S0LA 4IQPA 1JY0A 1TWEA 4QKSA 5BXRA 4I6IA 1AXMA 4LO2A 4DEPA 4GAIA 4ZLBB 1HIBA 4FVVA 5JLVA 1V6XA 3BAHA 4PC4A 4GOYA 4IZEA 2IWTB 1SR4C 3O5WB 4ISQA 3FJDA 3CA0A 4I7IA 1TP0A 4HA2A 4LO7C 5BP5C 1ISYA 1V6UA 3WINA 4ZFWB 31BIA 3FJFA 4GP0A 3N0KA 3CRIA 3IIRA 1JT4A 1BLAA 1ISWA 3UD7A 3I29B 1T4QA 3BRFA 1W3AA 4JPZA 4OW4A 3Q7XA 2NS2A 4I4QA 3PG0A 4I4PA 5DUYA 1HWPB 1XG6A 1F31A 2I1BA 1NZKA 3Q7YA 4LO1A 4IHZA 5EHAA 3VWCA 1G9AA 5DZUA 1IRAX 2YUGA 1AF9A 3VSFA 4KEIA 2QYIB 4WBCA 4OWJA 4EFQA 1QXMA 5HPZA 4KEKA 1ABRB 4ZFYB 5BQUA 1TWMA 3B9UA 3O3QA 4IONA 2RSTA 1DJSB 1WD3A 2AFGA 1R8OA 1YF8B 1TOOA 2ZQOA 3CRHA 3O4CA 2AXMA 1Q1UA 2WRYA 4OWKA 3JRRA 4Z8SB 1HKNA 1BFCA 1MD6A 1D0HA 2KH2A 1ISVA 3N7JA 1WD4A 2BFHA 1V6VA 2LIEA 4HJJA 1XZZA 3V0AB 3NBNA 1VCLA 3H6QA 4USPA 1ISZA 1IOBA 4I4VA 4EFRA 5D63A 4ZKTB 3O49A 1AVAC 2R9KB 4J2YA 4OUJA 4QO3A 3FJ9A 2E4MC 2X2TA 1S0GA 1PUUB 1MC9A 3Q7WA 1S0BA 4X38A 5D61A 1I1EA 2ESUA 1DZDA 3CU1B 1ISXA 1Q03A 2M49A 5F8SA 2FFUA 4XFSA 4ZOTA 4I3NA 3WA1A 1YYNA 2NYYA 1PZZA 1JT7A 4JP0A 3CA5A 2MLLB 1IILA 3F62B 1G82A 1RMLA 2Q9XA 4I4RA 3R4SA 2LIQA 3CA3A 1EPWA 4IY9A 3HOMA 4F34A 3O4BA 1AVUA 1M2TB 41BIA 4P6AA 1AVXB 1I1BA 3IM6A 1BARA 4G9MA 4JRAA 2D23A 3ZX7A 1YXWA 2D24A 3NBEA 4QBVA 3BB2A 4EKXB 4EEEB 5F8YA 3PHZA 2HWMA 4QBCA 3WMUA 2DREA 3NBCA 2BEBA 4I2SA 1TFMB 2ZR1B 1IJTA 1WBAA 6I1BA 1QQLA 4R6UB 4ZA3B 4I96A 2ZQNA 2NTDA 9ILBA 2D44A 1Z0HA 5F90A 3WMVA 2NVHA 2F2FA 1GGPB 3AKGA 5FNXA 4DENA 3BADA 1AVWB 3CAHA 4LO0A 1G9CA 5BXPA 1S0EA 3TC2A 3IAGC 2K43A 2Y9WC 1XYFA 2X2SA 3MALA 4F83A 3NJ5A 3WINC 4QKRA 2Y9XE 2D43A 1Z4SA 4OEEA 3OJVA 3V0BA 3V79C 2FGFA 1SZ6B 3POKA 3R4UA 4MZFB 3H6RA 5BP5A 3VSZA 2VLCA 5FZZA 3OGFA 3BAUA 1T9FA 1IRPA 4LO1C 1HWMB 1RG8A 1RZOB 4FGFA 3RTIB 2DS0A 1YTOA 1S0FA 4JQ0A 4I4UA 4IYBA 3HBWA 4A7KA 5BQUC 4P0JA 1TIEA 1IHKA 3CQAA 1PUMB 4J2SA 3K1XA 5EG6C 4XFUA 3IM5A 3FUOA 3H6SE 3BRDA 2FDBM 4P0LA 4JAWA 1S0CA 3FJHA 2VXTI 4EB2B 3BTAA 4USOA 1A8DA 1DLLA 3FJAA 3N7KA 1G9BA 4KEJA 1HWNB 4X39A 4G9NA 4ISRA 4LO8B 4OEFA 1ONKB 3WO2A 1QQKA 1V6WA 5FZUA 3O4AA 2MC2A 2NP0A 4H9WA 2P39A 4I4YA 1ILR1 3BX1C 7I1BA 3OBRA 4Q9GA 3PUBA 1J0SA 2UUSA 1JLXA 5F8WA 5FZYA 1ITBA 4CJMA 4I1BA 1FWUA 3HN1A 1BFBA 4X3AA 3AJ6A 1FMZA 3FGMA 1EVTA 1DIWA 5JMCA 4LO3C 1DQGA 1FMMS 5BVPI 2K4AB 3MPPG 2GZBA 4J2XA 2GO2A 1UPSA 2IHOA 4H75A 4OEGA 3P53A 3RMYA 3AKIA 3UDAA 3NBDA 3V0AA 2XOAA 1FN0A 4A7ZA 4QD2C 2ET2A 1RY7A 3UJ0A 3BAVA 4IZXA 2VSEA 1BFGA 1EV2A 3UJ4A 5BOWA 5E24E 4G6JA 2KI6B 4AN7B 4KBBA 2HW9A 1G9DA 1FV3A 3FUQA 1JTCA 2KLLA 3N7MA 1II4A 3A07A 4D0ZA 1JT3A 2D22A 2Y9GA 3ZC9A 2VSAA 2HWAA 4LO2C 4YOLA 1OQLB 1KNMA 2F2FC 3C9ZA 4ENDA 3O4OA 3E8LC 3AJ5A 4HR6C 1BA7A 3I2AA 3HMYA 3EF2A 1JQZA 5GAQA 4QC4A 4I0YA 1K5UA 4LO0C 2K8RA 3AH1A 3UD8A 4QALA 1BLDA 2NM1A 2Y9FA 4XFTA 4TLPA 3OJMA 3ILAA 1SR4A 3OJ2A 4H04A 4G6MA 3VEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I4O A;  1R8N A;  5BXS A;  3AKH A;  3P6I A;  2RG9 B;  1M16 A;  3FJI A;  1DQO A;  3AZV A;  1W3F A;  2Q3N B;  3CA1 A;  3VT1 A;  2VXR A;  4L4I A;  1EYL A;  2WBC A;  3RMX A;  2D7I A;  1BFF A;  1FV2 A;  4GOV A;  3W9T A;  3VT0 A;  3T8S A;  4JKX B;  4I4S A;  3FJ8 A;  4X37 A;  3FFZ A;  3D7W B;  2NZ9 A;  4I37 A;  3BAO A;  1PC8 B;  4Q91 A;  4D8H A;  3LLP A;  4Z9W B;  1HCE A;  1AFC A;  3FJC A;  2QN4 A;  5I1B A;  3A23 A;  1DFC A;  3OBT A;  2AQZ A;  1K5V A;  2VUA A;  3ZC8 A;  3CRG A;  1Q04 A;  2BEA A;  3AZW A;  3QR5 A;  3FJK A;  1CVS A;  3I2X A;  2VU9 A;  4GAF A;  3JUT A;  1L2H A;  5D62 A;  1FWV A;  4AN6 A;  3S8K A;  1JT5 A;  3FJJ A;  1JLY A;  2J3P A;  2AAI B;  2KKI A;  3HAL A;  4GP3 A;  3BAG A;  2Z49 A;  3RTJ B;  3AH4 A;  4I4X A;  4ZFU B;  1S0D A;  2L5X A;  1N4K A;  3LTQ A;  4KC3 A;  5DVH A;  3CA4 A;  3FJE A;  1BAS A;  4QD2 B;  4ZGR B;  8I1B A;  3AKF A;  4EFP A;  3O44 A;  3O4D A;  3VUO A;  2E4M A;  4IY8 A;  1TTU A;  4L4H A;  3VT2 A;  4A7Y A;  2FO1 A;  5BXT A;  3UD9 A;  4JKQ A;  2RQ9 A;  1CE7 B;  3N7L A;  3IM7 A;  4I8M A;  1W3G A;  1NUN A;  21BI A;  2FFV A;  4I1E A;  1HCD A;  1IT0 A;  3BA5 A;  2P23 A;  2F8X C;  2D7R A;  2MIB A;  3QYD A;  1FQ9 A;  3FJB A;  4OWL A;  3BAQ A;  5DSS B;  3PME A;  4LO3 A;  4J23 B;  3F1R A;  1P63 A;  3S8J A;  2HZ9 A;  1Z2V A;  5G00 A;  2ERM A;  3A22 A;  3ZXD A;  3OGG A;  4DCK C;  4ZBV B;  1HWO B;  2D20 A;  1XHB A;  1E0O A;  2KI4 A;  4P0K A;  4D0T A;  3BRG C;  3CA6 A;  3RSJ A;  2DRY A;  1FGA A;  3AH2 A;  4Q9P A;  2D1Z A;  4J2K A;  5EC5 A;  4II0 A;  1YBI A;  3HSM A;  2Z48 A;  1WBC A;  3A21 A;  5FNW A;  3BA7 A;  3KMV A;  3P6J A;  3BA4 A;  3V0B B;  1DZC A;  5B2H A;  3H6R B;  4LO7 B;  4G1R A;  3WO3 A;  2DRZ A;  3WO4 A;  1DFQ A;  3SNV A;  3ZXG A;  4XKI A;  1PWA A;  1S0L A;  4IQP A;  1JY0 A;  1TWE A;  4QKS A;  5BXR A;  4I6I A;  1AXM A;  4LO2 A;  4DEP A;  4GAI A;  4ZLB B;  1HIB A;  4FVV A;  5JLV A;  1V6X A;  3BAH A;  4PC4 A;  4GOY A;  4IZE A;  2IWT B;  1SR4 C;  3O5W B;  4ISQ A;  3FJD A;  3CA0 A;  4I7I A;  1TP0 A;  4HA2 A;  4LO7 C;  5BP5 C;  1ISY A;  1V6U A;  3WIN A;  4ZFW B;  31BI A;  3FJF A;  4GP0 A;  3N0K A;  3CRI A;  3IIR A;  1JT4 A;  1BLA A;  1ISW A;  3UD7 A;  3I29 B;  1T4Q A;  3BRF A;  1W3A A;  4JPZ A;  4OW4 A;  3Q7X A;  4I4Q A;  3PG0 A;  4I4P A;  5DUY A;  1HWP B;  1XG6 A;  1F31 A;  2I1B A;  1NZK A;  3Q7Y A;  4LO1 A;  4IHZ A;  5EHA A;  3VWC A;  1G9A A;  5DZU A;  1IRA X;  2YUG A;  1AF9 A;  3VSF A;  4KEI A;  2QYI B;  4WBC A;  4OWJ A;  4EFQ A;  1QXM A;  5HPZ A;  4KEK A;  1ABR B;  4ZFY B;  5BQU A;  1TWM A;  3B9U A;  3O3Q A;  4ION A;  2RST A;  1DJS B;  1WD3 A;  2AFG A;  1R8O A;  1YF8 B;  1TOO A;  2ZQO A;  3CRH A;  3O4C A;  2AXM A;  1Q1U A;  2WRY A;  4OWK A;  3JRR A;  4Z8S B;  1HKN A;  1BFC A;  1MD6 A;  1D0H A;  2KH2 A;  1ISV A;  3N7J A;  1WD4 A;  2BFH A;  1V6V A;  2LIE A;  4HJJ A;  1XZZ A;  3V0A B;  3NBN A;  1VCL A;  3H6Q A;  4USP A;  1ISZ A;  1IOB A;  4I4V A;  4EFR A;  5D63 A;  4ZKT B;  3O49 A;  1AVA C;  2R9K B;  4J2Y A;  4OUJ A;  4QO3 A;  3FJ9 A;  2E4M C;  2X2T A;  1S0G A;  1PUU B;  1MC9 A;  3Q7W A;  1S0B A;  4X38 A;  5D61 A;  1I1E A;  2ESU A;  1DZD A;  3CU1 B;  1ISX A;  1Q03 A;  2M49 A;  5F8S A;  2FFU A;  4XFS A;  4ZOT A;  4I3N A;  3WA1 A;  1YYN A;  2NYY A;  1PZZ A;  1JT7 A;  4JP0 A;  3CA5 A;  2MLL B;  1IIL A;  3F62 B;  1G82 A;  1RML A;  2Q9X A;  4I4R A;  3R4S A;  2LIQ A;  3CA3 A;  1EPW A;  4IY9 A;  3HOM A;  4F34 A;  3O4B A;  1AVU A;  1M2T B;  41BI A;  4P6A A;  1AVX B;  1I1B A;  3IM6 A;  1BAR A;  4G9M A;  4JRA A;  2D23 A;  3ZX7 A;  1YXW A;  2D24 A;  3NBE A;  4QBV A;  3BB2 A;  4EKX B;  4EEE B;  5F8Y A;  3PHZ A;  2HWM A;  4QBC A;  3WMU A;  2DRE A;  3NBC A;  2BEB A;  4I2S A;  1TFM B;  2ZR1 B;  1IJT A;  1WBA A;  6I1B A;  1QQL A;  4R6U B;  4ZA3 B;  4I96 A;  2ZQN A;  2NTD A;  9ILB A;  2D44 A;  1Z0H A;  5F90 A;  3WMV A;  2NVH A;  2F2F A;  1GGP B;  3AKG A;  5FNX A;  4DEN A;  3BAD A;  1AVW B;  3CAH A;  4LO0 A;  1G9C A;  5BXP A;  1S0E A;  3TC2 A;  3IAG C;  2K43 A;  2Y9W C;  1XYF A;  2X2S A;  3MAL A;  4F83 A;  3NJ5 A;  3WIN C;  4QKR A;  2Y9X E;  2D43 A;  1Z4S A;  4OEE A;  3OJV A;  3V0B A;  3V79 C;  2FGF A;  1SZ6 B;  3POK A;  3R4U A;  3H6R A;  5BP5 A;  3VSZ A;  2VLC A;  5FZZ A;  3OGF A;  3BAU A;  1T9F A;  1IRP A;  4LO1 C;  1HWM B;  1RG8 A;  1RZO B;  4FGF A;  3RTI B;  2DS0 A;  1YTO A;  1S0F A;  4JQ0 A;  4I4U A;  4IYB A;  3HBW A;  4A7K A;  5BQU C;  4P0J A;  1TIE A;  1IHK A;  3CQA A;  1PUM B;  4J2S A;  3K1X A;  5EG6 C;  4XFU A;  3IM5 A;  3FUO A;  3H6S E;  3BRD A;  2FDB M;  4P0L A;  4JAW A;  1S0C A;  3FJH A;  2VXT I;  4EB2 B;  3BTA A;  4USO A;  1A8D A;  1DLL A;  3FJA A;  3N7K A;  1G9B A;  4KEJ A;  1HWN B;  4X39 A;  4G9N A;  4ISR A;  4LO8 B;  4OEF A;  1ONK B;  3WO2 A;  1QQK A;  1V6W A;  5FZU A;  3O4A A;  2MC2 A;  2NP0 A;  4H9W A;  2P39 A;  4I4Y A;  1ILR 1;  3BX1 C;  7I1B A;  3OBR A;  4Q9G A;  3PUB A;  1J0S A;  2UUS A;  1JLX A;  5F8W A;  5FZY A;  1ITB A;  4CJM A;  4I1B A;  1FWU A;  3HN1 A;  1BFB A;  4X3A A;  3AJ6 A;  1FMZ A;  3FGM A;  1EVT A;  1DIW A;  5JMC A;  4LO3 C;  1DQG A;  1FMM S;  5BVP I;  2K4A B;  3MPP G;  2GZB A;  4J2X A;  2GO2 A;  1UPS A;  2IHO A;  4OEG A;  3P53 A;  3RMY A;  3AKI A;  3UDA A;  3NBD A;  3V0A A;  2XOA A;  1FN0 A;  4A7Z A;  4QD2 C;  2ET2 A;  1RY7 A;  3UJ0 A;  3BAV A;  4IZX A;  2VSE A;  1BFG A;  1EV2 A;  3UJ4 A;  5BOW A;  5E24 E;  4G6J A;  2KI6 B;  4AN7 B;  4KBB A;  2HW9 A;  1G9D A;  1FV3 A;  3FUQ A;  1JTC A;  2KLL A;  3N7M A;  1II4 A;  3A07 A;  4D0Z A;  1JT3 A;  2D22 A;  2Y9G A;  3ZC9 A;  2VSA A;  2HWA A;  4LO2 C;  4YOL A;  1OQL B;  1KNM A;  2F2F C;  3C9Z A;  4END A;  3O4O A;  3E8L C;  3AJ5 A;  4HR6 C;  1BA7 A;  3I2A A;  3HMY A;  3EF2 A;  1JQZ A;  5GAQ A;  4QC4 A;  4I0Y A;  1K5U A;  4LO0 C;  2K8R A;  3AH1 A;  3UD8 A;  4QAL A;  1BLD A;  2NM1 A;  2Y9F A;  4XFT A;  4TLP A;  3OJM A;  3ILA A;  1SR4 A;  3OJ2 A;  4H04 A;  4G6M A;  3VEQ A; 
#chains in the Genus database with same CATH topology
 4I4O A;  1R8N A;  5BXS A;  3AKH A;  3P6I A;  4MZH A;  2RG9 B;  1M16 A;  3FJI A;  1DQO A;  3AZV A;  1W3F A;  2Q3N B;  3CA1 A;  3VT1 A;  2VXR A;  4L4I A;  1EYL A;  2WBC A;  3RMX A;  2D7I A;  1BFF A;  1FV2 A;  4GOV A;  3W9T A;  3VT0 A;  3T8S A;  4JKX B;  4I4S A;  3FJ8 A;  4X37 A;  3FFZ A;  3D7W B;  2NZ9 A;  4I37 A;  3BAO A;  1PC8 B;  4Q91 A;  4D8H A;  3LLP A;  4Z9W B;  1HCE A;  1AFC A;  3FJC A;  2QN4 A;  5I1B A;  3A23 A;  1DFC A;  3OBT A;  2AQZ A;  1K5V A;  2VUA A;  3ZC8 A;  3CRG A;  1Q04 A;  2BEA A;  3AZW A;  3QR5 A;  3FJK A;  1CVS A;  3I2X A;  2VU9 A;  4GAF A;  3JUT A;  1L2H A;  5D62 A;  1FWV A;  4AN6 A;  3S8K A;  1JT5 A;  3FJJ A;  1JLY A;  2J3P A;  2AAI B;  2KKI A;  3HAL A;  4GP3 A;  3BAG A;  2Z49 A;  3RTJ B;  3AH4 A;  4I4X A;  4ZFU B;  1S0D A;  2L5X A;  1N4K A;  3LTQ A;  4KC3 A;  5DVH A;  3CA4 A;  3FJE A;  1BAS A;  4QD2 B;  4ZGR B;  8I1B A;  3AKF A;  4EFP A;  3O44 A;  3O4D A;  3VUO A;  2E4M A;  4IY8 A;  1TTU A;  4L4H A;  3VT2 A;  4A7Y A;  2FO1 A;  5BXT A;  3UD9 A;  4JKQ A;  2RQ9 A;  1CE7 B;  3N7L A;  3IM7 A;  4I8M A;  1W3G A;  1NUN A;  21BI A;  2FFV A;  4I1E A;  1HCD A;  1IT0 A;  3BA5 A;  2P23 A;  2F8X C;  2D7R A;  2MIB A;  3QYD A;  1FQ9 A;  3FJB A;  4OWL A;  3BAQ A;  5DSS B;  3PME A;  4LO3 A;  4J23 B;  3F1R A;  1P63 A;  3S8J A;  2HZ9 A;  4UY4 A;  1Z2V A;  5G00 A;  2ERM A;  3A22 A;  3ZXD A;  3OGG A;  4DCK C;  4ZBV B;  1HWO B;  2D20 A;  1XHB A;  1E0O A;  2KI4 A;  4P0K A;  4D0T A;  3BRG C;  3CA6 A;  3RSJ A;  2DRY A;  1FGA A;  3AH2 A;  4Q9P A;  2D1Z A;  4J2K A;  5EC5 A;  4II0 A;  1YBI A;  3HSM A;  2Z48 A;  1WBC A;  3A21 A;  5FNW A;  3BA7 A;  3KMV A;  3P6J A;  4MZG B;  3BA4 A;  3V0B B;  1DZC A;  5B2H A;  3H6R B;  4LO7 B;  4G1R A;  3WO3 A;  2DRZ A;  3WO4 A;  1DFQ A;  3SNV A;  3ZXG A;  4XKI A;  1PWA A;  1S0L A;  4IQP A;  1JY0 A;  1TWE A;  4QKS A;  5BXR A;  4I6I A;  1AXM A;  4LO2 A;  4DEP A;  4GAI A;  4ZLB B;  1HIB A;  4FVV A;  5JLV A;  1V6X A;  3BAH A;  4PC4 A;  4GOY A;  4IZE A;  2IWT B;  1SR4 C;  3O5W B;  4ISQ A;  3FJD A;  3CA0 A;  4I7I A;  1TP0 A;  4HA2 A;  4LO7 C;  5BP5 C;  1ISY A;  1V6U A;  3WIN A;  4ZFW B;  31BI A;  3FJF A;  4GP0 A;  3N0K A;  3CRI A;  3IIR A;  1JT4 A;  1BLA A;  1ISW A;  3UD7 A;  3I29 B;  1T4Q A;  3BRF A;  1W3A A;  4JPZ A;  4OW4 A;  3Q7X A;  2NS2 A;  4I4Q A;  3PG0 A;  4I4P A;  5DUY A;  1HWP B;  1XG6 A;  1F31 A;  2I1B A;  1NZK A;  3Q7Y A;  4LO1 A;  4IHZ A;  5EHA A;  3VWC A;  1G9A A;  5DZU A;  1IRA X;  2YUG A;  1AF9 A;  3VSF A;  4KEI A;  2QYI B;  4WBC A;  4OWJ A;  4EFQ A;  1QXM A;  5HPZ A;  4KEK A;  1ABR B;  4ZFY B;  5BQU A;  1TWM A;  3B9U A;  3O3Q A;  4ION A;  2RST A;  1DJS B;  1WD3 A;  2AFG A;  1R8O A;  1YF8 B;  1TOO A;  2ZQO A;  3CRH A;  3O4C A;  2AXM A;  1Q1U A;  2WRY A;  4OWK A;  3JRR A;  4Z8S B;  1HKN A;  1BFC A;  1MD6 A;  1D0H A;  2KH2 A;  1ISV A;  3N7J A;  1WD4 A;  2BFH A;  1V6V A;  2LIE A;  4HJJ A;  1XZZ A;  3V0A B;  3NBN A;  1VCL A;  3H6Q A;  4USP A;  1ISZ A;  1IOB A;  4I4V A;  4EFR A;  5D63 A;  4ZKT B;  3O49 A;  1AVA C;  2R9K B;  4J2Y A;  4OUJ A;  4QO3 A;  3FJ9 A;  2E4M C;  2X2T A;  1S0G A;  1PUU B;  1MC9 A;  3Q7W A;  1S0B A;  4X38 A;  5D61 A;  1I1E A;  2ESU A;  1DZD A;  3CU1 B;  1ISX A;  1Q03 A;  2M49 A;  5F8S A;  2FFU A;  4XFS A;  4ZOT A;  4I3N A;  3WA1 A;  1YYN A;  2NYY A;  1PZZ A;  1JT7 A;  4JP0 A;  3CA5 A;  2MLL B;  1IIL A;  3F62 B;  1G82 A;  1RML A;  2Q9X A;  4I4R A;  3R4S A;  2LIQ A;  3CA3 A;  1EPW A;  4IY9 A;  3HOM A;  4F34 A;  3O4B A;  1AVU A;  1M2T B;  41BI A;  4P6A A;  1AVX B;  1I1B A;  3IM6 A;  1BAR A;  4G9M A;  4JRA A;  2D23 A;  3ZX7 A;  1YXW A;  2D24 A;  3NBE A;  4QBV A;  3BB2 A;  4EKX B;  4EEE B;  5F8Y A;  3PHZ A;  2HWM A;  4QBC A;  3WMU A;  2DRE A;  3NBC A;  2BEB A;  4I2S A;  1TFM B;  2ZR1 B;  1IJT A;  1WBA A;  6I1B A;  1QQL A;  4R6U B;  4ZA3 B;  4I96 A;  2ZQN A;  2NTD A;  9ILB A;  2D44 A;  1Z0H A;  5F90 A;  3WMV A;  2NVH A;  2F2F A;  1GGP B;  3AKG A;  5FNX A;  4DEN A;  3BAD A;  1AVW B;  3CAH A;  4LO0 A;  1G9C A;  5BXP A;  1S0E A;  3TC2 A;  3IAG C;  2K43 A;  2Y9W C;  1XYF A;  2X2S A;  3MAL A;  4F83 A;  3NJ5 A;  3WIN C;  4QKR A;  2Y9X E;  2D43 A;  1Z4S A;  4OEE A;  3OJV A;  3V0B A;  3V79 C;  2FGF A;  1SZ6 B;  3POK A;  3R4U A;  4MZF B;  3H6R A;  5BP5 A;  3VSZ A;  2VLC A;  5FZZ A;  3OGF A;  3BAU A;  1T9F A;  1IRP A;  4LO1 C;  1HWM B;  1RG8 A;  1RZO B;  4FGF A;  3RTI B;  2DS0 A;  1YTO A;  1S0F A;  4JQ0 A;  4I4U A;  4IYB A;  3HBW A;  4A7K A;  5BQU C;  4P0J A;  1TIE A;  1IHK A;  3CQA A;  1PUM B;  4J2S A;  3K1X A;  5EG6 C;  4XFU A;  3IM5 A;  3FUO A;  3H6S E;  3BRD A;  2FDB M;  4P0L A;  4JAW A;  1S0C A;  3FJH A;  2VXT I;  4EB2 B;  3BTA A;  4USO A;  1A8D A;  1DLL A;  3FJA A;  3N7K A;  1G9B A;  4KEJ A;  1HWN B;  4X39 A;  4G9N A;  4ISR A;  4LO8 B;  4OEF A;  1ONK B;  3WO2 A;  1QQK A;  1V6W A;  5FZU A;  3O4A A;  2MC2 A;  2NP0 A;  4H9W A;  2P39 A;  4I4Y A;  1ILR 1;  3BX1 C;  7I1B A;  3OBR A;  4Q9G A;  3PUB A;  1J0S A;  2UUS A;  1JLX A;  5F8W A;  5FZY A;  1ITB A;  4CJM A;  4I1B A;  1FWU A;  3HN1 A;  1BFB A;  4X3A A;  3AJ6 A;  1FMZ A;  3FGM A;  1EVT A;  1DIW A;  5JMC A;  4LO3 C;  1DQG A;  1FMM S;  5BVP I;  2K4A B;  3MPP G;  2GZB A;  4J2X A;  2GO2 A;  1UPS A;  2IHO A;  4H75 A;  4OEG A;  3P53 A;  3RMY A;  3AKI A;  3UDA A;  3NBD A;  3V0A A;  2XOA A;  1FN0 A;  4A7Z A;  4QD2 C;  2ET2 A;  1RY7 A;  3UJ0 A;  3BAV A;  4IZX A;  2VSE A;  1BFG A;  1EV2 A;  3UJ4 A;  5BOW A;  5E24 E;  4G6J A;  2KI6 B;  4AN7 B;  4KBB A;  2HW9 A;  1G9D A;  1FV3 A;  3FUQ A;  1JTC A;  2KLL A;  3N7M A;  1II4 A;  3A07 A;  4D0Z A;  1JT3 A;  2D22 A;  2Y9G A;  3ZC9 A;  2VSA A;  2HWA A;  4LO2 C;  4YOL A;  1OQL B;  1KNM A;  2F2F C;  3C9Z A;  4END A;  3O4O A;  3E8L C;  3AJ5 A;  4HR6 C;  1BA7 A;  3I2A A;  3HMY A;  3EF2 A;  1JQZ A;  5GAQ A;  4QC4 A;  4I0Y A;  1K5U A;  4LO0 C;  2K8R A;  3AH1 A;  3UD8 A;  4QAL A;  1BLD A;  2NM1 A;  2Y9F A;  4XFT A;  4TLP A;  3OJM A;  3ILA A;  1SR4 A;  3OJ2 A;  4H04 A;  4G6M A;  3VEQ A; 
#chains in the Genus database with same CATH homology
 4I4O A;  1R8N A;  5BXS A;  3AKH A;  3P6I A;  4MZH A;  2RG9 B;  1M16 A;  3FJI A;  1DQO A;  3AZV A;  1W3F A;  2Q3N B;  3CA1 A;  3VT1 A;  2VXR A;  4L4I A;  1EYL A;  2WBC A;  3RMX A;  2D7I A;  1BFF A;  1FV2 A;  4GOV A;  3W9T A;  3VT0 A;  3T8S A;  4JKX B;  4I4S A;  3FJ8 A;  4X37 A;  3FFZ A;  3D7W B;  2NZ9 A;  4I37 A;  3BAO A;  1PC8 B;  4Q91 A;  4D8H A;  3LLP A;  4Z9W B;  1HCE A;  1AFC A;  3FJC A;  2QN4 A;  5I1B A;  3A23 A;  1DFC A;  3OBT A;  2AQZ A;  1K5V A;  2VUA A;  3ZC8 A;  3CRG A;  1Q04 A;  2BEA A;  3AZW A;  3QR5 A;  3FJK A;  1CVS A;  3I2X A;  2VU9 A;  4GAF A;  3JUT A;  1L2H A;  5D62 A;  1FWV A;  4AN6 A;  3S8K A;  1JT5 A;  3FJJ A;  1JLY A;  2J3P A;  2AAI B;  2KKI A;  3HAL A;  4GP3 A;  3BAG A;  2Z49 A;  3RTJ B;  3AH4 A;  4I4X A;  4ZFU B;  1S0D A;  2L5X A;  1N4K A;  3LTQ A;  4KC3 A;  5DVH A;  3CA4 A;  3FJE A;  1BAS A;  4QD2 B;  4ZGR B;  8I1B A;  3AKF A;  4EFP A;  3O44 A;  3O4D A;  3VUO A;  2E4M A;  4IY8 A;  1TTU A;  4L4H A;  3VT2 A;  4A7Y A;  2FO1 A;  5BXT A;  3UD9 A;  4JKQ A;  2RQ9 A;  1CE7 B;  3N7L A;  3IM7 A;  4I8M A;  1W3G A;  1NUN A;  21BI A;  2FFV A;  4I1E A;  1HCD A;  1IT0 A;  3BA5 A;  2P23 A;  2F8X C;  2D7R A;  2MIB A;  3QYD A;  1FQ9 A;  3FJB A;  4OWL A;  3BAQ A;  5DSS B;  3PME A;  4LO3 A;  4J23 B;  3F1R A;  1P63 A;  3S8J A;  2HZ9 A;  4UY4 A;  1Z2V A;  5G00 A;  2ERM A;  3A22 A;  3ZXD A;  3OGG A;  4DCK C;  4ZBV B;  1HWO B;  2D20 A;  1XHB A;  1E0O A;  2KI4 A;  4P0K A;  4D0T A;  3BRG C;  3CA6 A;  3RSJ A;  2DRY A;  1FGA A;  3AH2 A;  4Q9P A;  2D1Z A;  4J2K A;  5EC5 A;  4II0 A;  1YBI A;  3HSM A;  2Z48 A;  1WBC A;  3A21 A;  5FNW A;  3BA7 A;  3KMV A;  3P6J A;  4MZG B;  3BA4 A;  3V0B B;  1DZC A;  5B2H A;  3H6R B;  4LO7 B;  4G1R A;  3WO3 A;  2DRZ A;  3WO4 A;  1DFQ A;  3SNV A;  3ZXG A;  4XKI A;  1PWA A;  1S0L A;  4IQP A;  1JY0 A;  1TWE A;  4QKS A;  5BXR A;  4I6I A;  1AXM A;  4LO2 A;  4DEP A;  4GAI A;  4ZLB B;  1HIB A;  4FVV A;  5JLV A;  1V6X A;  3BAH A;  4PC4 A;  4GOY A;  4IZE A;  2IWT B;  1SR4 C;  3O5W B;  4ISQ A;  3FJD A;  3CA0 A;  4I7I A;  1TP0 A;  4HA2 A;  4LO7 C;  5BP5 C;  1ISY A;  1V6U A;  3WIN A;  4ZFW B;  31BI A;  3FJF A;  4GP0 A;  3N0K A;  3CRI A;  3IIR A;  1JT4 A;  1BLA A;  1ISW A;  3UD7 A;  3I29 B;  1T4Q A;  3BRF A;  1W3A A;  4JPZ A;  4OW4 A;  3Q7X A;  2NS2 A;  4I4Q A;  3PG0 A;  4I4P A;  5DUY A;  1HWP B;  1XG6 A;  1F31 A;  2I1B A;  1NZK A;  3Q7Y A;  4LO1 A;  4IHZ A;  5EHA A;  3VWC A;  1G9A A;  5DZU A;  1IRA X;  2YUG A;  1AF9 A;  3VSF A;  4KEI A;  2QYI B;  4WBC A;  4OWJ A;  4EFQ A;  1QXM A;  5HPZ A;  4KEK A;  1ABR B;  4ZFY B;  5BQU A;  1TWM A;  3B9U A;  3O3Q A;  4ION A;  2RST A;  1DJS B;  1WD3 A;  2AFG A;  1R8O A;  1YF8 B;  1TOO A;  2ZQO A;  3CRH A;  3O4C A;  2AXM A;  1Q1U A;  2WRY A;  4OWK A;  3JRR A;  4Z8S B;  1HKN A;  1BFC A;  1MD6 A;  1D0H A;  2KH2 A;  1ISV A;  3N7J A;  1WD4 A;  2BFH A;  1V6V A;  2LIE A;  4HJJ A;  1XZZ A;  3V0A B;  3NBN A;  1VCL A;  3H6Q A;  4USP A;  1ISZ A;  1IOB A;  4I4V A;  4EFR A;  5D63 A;  4ZKT B;  3O49 A;  1AVA C;  2R9K B;  4J2Y A;  4OUJ A;  4QO3 A;  3FJ9 A;  2E4M C;  2X2T A;  1S0G A;  1PUU B;  1MC9 A;  3Q7W A;  1S0B A;  4X38 A;  5D61 A;  1I1E A;  2ESU A;  1DZD A;  3CU1 B;  1ISX A;  1Q03 A;  2M49 A;  5F8S A;  2FFU A;  4XFS A;  4ZOT A;  4I3N A;  3WA1 A;  1YYN A;  2NYY A;  1PZZ A;  1JT7 A;  4JP0 A;  3CA5 A;  2MLL B;  1IIL A;  3F62 B;  1G82 A;  1RML A;  2Q9X A;  4I4R A;  3R4S A;  2LIQ A;  3CA3 A;  1EPW A;  4IY9 A;  3HOM A;  4F34 A;  3O4B A;  1AVU A;  1M2T B;  41BI A;  4P6A A;  1AVX B;  1I1B A;  3IM6 A;  1BAR A;  4G9M A;  4JRA A;  2D23 A;  3ZX7 A;  1YXW A;  2D24 A;  3NBE A;  4QBV A;  3BB2 A;  4EKX B;  4EEE B;  5F8Y A;  3PHZ A;  2HWM A;  4QBC A;  3WMU A;  2DRE A;  3NBC A;  2BEB A;  4I2S A;  1TFM B;  2ZR1 B;  1IJT A;  1WBA A;  6I1B A;  1QQL A;  4R6U B;  4ZA3 B;  4I96 A;  2ZQN A;  2NTD A;  9ILB A;  2D44 A;  1Z0H A;  5F90 A;  3WMV A;  2NVH A;  2F2F A;  1GGP B;  3AKG A;  5FNX A;  4DEN A;  3BAD A;  1AVW B;  3CAH A;  4LO0 A;  1G9C A;  5BXP A;  1S0E A;  3TC2 A;  3IAG C;  2K43 A;  2Y9W C;  1XYF A;  2X2S A;  3MAL A;  4F83 A;  3NJ5 A;  3WIN C;  4QKR A;  2Y9X E;  2D43 A;  1Z4S A;  4OEE A;  3OJV A;  3V0B A;  3V79 C;  2FGF A;  1SZ6 B;  3POK A;  3R4U A;  4MZF B;  3H6R A;  5BP5 A;  3VSZ A;  2VLC A;  5FZZ A;  3OGF A;  3BAU A;  1T9F A;  1IRP A;  4LO1 C;  1HWM B;  1RG8 A;  1RZO B;  4FGF A;  3RTI B;  2DS0 A;  1YTO A;  1S0F A;  4JQ0 A;  4I4U A;  4IYB A;  3HBW A;  4A7K A;  5BQU C;  4P0J A;  1TIE A;  1IHK A;  3CQA A;  1PUM B;  4J2S A;  3K1X A;  5EG6 C;  4XFU A;  3IM5 A;  3FUO A;  3H6S E;  3BRD A;  2FDB M;  4P0L A;  4JAW A;  1S0C A;  3FJH A;  2VXT I;  4EB2 B;  3BTA A;  4USO A;  1A8D A;  1DLL A;  3FJA A;  3N7K A;  1G9B A;  4KEJ A;  1HWN B;  4X39 A;  4G9N A;  4ISR A;  4LO8 B;  4OEF A;  1ONK B;  3WO2 A;  1QQK A;  1V6W A;  5FZU A;  3O4A A;  2MC2 A;  2NP0 A;  4H9W A;  2P39 A;  4I4Y A;  1ILR 1;  3BX1 C;  7I1B A;  3OBR A;  4Q9G A;  3PUB A;  1J0S A;  2UUS A;  1JLX A;  5F8W A;  5FZY A;  1ITB A;  4CJM A;  4I1B A;  1FWU A;  3HN1 A;  1BFB A;  4X3A A;  3AJ6 A;  1FMZ A;  3FGM A;  1EVT A;  1DIW A;  5JMC A;  4LO3 C;  1DQG A;  1FMM S;  5BVP I;  2K4A B;  3MPP G;  2GZB A;  4J2X A;  2GO2 A;  1UPS A;  2IHO A;  4H75 A;  4OEG A;  3P53 A;  3RMY A;  3AKI A;  3UDA A;  3NBD A;  3V0A A;  2XOA A;  1FN0 A;  4A7Z A;  4QD2 C;  2ET2 A;  1RY7 A;  3UJ0 A;  3BAV A;  4IZX A;  2VSE A;  1BFG A;  1EV2 A;  3UJ4 A;  5BOW A;  5E24 E;  4G6J A;  2KI6 B;  4AN7 B;  4KBB A;  2HW9 A;  1G9D A;  1FV3 A;  3FUQ A;  1JTC A;  2KLL A;  3N7M A;  1II4 A;  3A07 A;  4D0Z A;  1JT3 A;  2D22 A;  2Y9G A;  3ZC9 A;  2VSA A;  2HWA A;  4LO2 C;  4YOL A;  1OQL B;  1KNM A;  2F2F C;  3C9Z A;  4END A;  3O4O A;  3E8L C;  3AJ5 A;  4HR6 C;  1BA7 A;  3I2A A;  3HMY A;  3EF2 A;  1JQZ A;  5GAQ A;  4QC4 A;  4I0Y A;  1K5U A;  4LO0 C;  2K8R A;  3AH1 A;  3UD8 A;  4QAL A;  1BLD A;  2NM1 A;  2Y9F A;  4XFT A;  4TLP A;  3OJM A;  3ILA A;  1SR4 A;  3OJ2 A;  4H04 A;  4G6M A;  3VEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...