4FGIB

Structure of the effector - immunity system tse1 / tsi1 from pseudomonas aeruginosa
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
147
structure length
147
Chain Sequence
b'AFTQLEIVPQFGSPNMFGGEDEHVRVMFSNEDPNDDNPDAFPEPPVYLADRDSGNDCRIEDGGIWSRGGVFLSQDGRRVLMHEFSGSSAELVSYDSATCKVVHREDISGQRWAVDKDGLRLGQKCSGESVDSCAKIVKRSLAPFCQT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tse1
publication title Structural Insights into the Effector - Immunity System Tse1/Tsi1 from Pseudomonas aeruginosa.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/hydrolase inhibitor
total genus 26
structure length 147
sequence length 147
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2012-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.650 Mainly Beta Beta Barrel Lipocalin Lipocalin 4fgiB00
3VPJE 4FQBB 4EQAC 4FGIB
chains in the Genus database with same CATH superfamily
2JGSA 1NP4A 1STRB 4KT5A 4QNIA 3APVA 5DG4A 2M4LA 1X8PA 1OSPO 2Y3EA 3ZW1B 4MVKA 3WBGA 3CQRA 4NV7A 4O9SA 4A1HA 4AYHA 4BX5B 5L8OA 1BSQA 4OMWA 2OY7A 4U9CA 4RUNA 3B2HA 5H9KA 3FLLA 2RN4A 2R56A 3HWDA 3PK2A 2K62A 2Z4HA 3VG3A 2Z4IA 4GZVA 4RUUA 3RDXA 4XMGA 1RSUB 1VWKB 3CBCA 3VU1A 1FTPA 4ML7B 1SLEB 3APUA 2W2AA 3APWA 5D4AA 3DSZA 3ZUIA 4O3ZA 2AT0X 4ZGUA 4BX5A 2OL6O 1Y9TA 1SWRA 2E4JA 2OL8O 1EIIA 3PQSA 5LJHA 3B2JA 3QQ2A 4ON1A 3ZUOA 4U8UM 2BS5A 1JJUA 1VWQB 2NNQA 2VFCA 4MVLA 4AW8A 2IZFB 1ERXA 3OE3A 1FJ1E 3AKNA 3FW5A 4C5PA 4A8ZA 3EW2A 1YIVA 4ZGFA 3D9WA 3G7XA 3RDQA 2OVAA 3C77X 3WJCA 1Y52X 3BU9A 4A60A 1DC9A 2OVEA 5BVTA 2RTPB 2CM9A 4GGTA 4I3CA 4IB8A 3IA8A 4U3QA 3PPTA 1L6MA 5F7GA 3SLTA 2ZAIA 4NLIA 5IRUA 1Y55X 2IFBA 2UZ2A 4M7MA 1AVEA 3FA7A 4IAXA 1OEJA 2IZIA 1Y0GA 1XKIA 1G74A 2FS6A 3C76X 1IKJA 1IFBA 1VWCB 1RXHA 4Z2VA 1N0SA 3VE2A 1QY1A 3F6ZB 1BEBA 2L9CA 2C1QA 2HNXA 2WPUA 4IABA 4U8UO 1G7NA 2IZLB 3RY1A 2IZAA 2RTHB 1ZRYA 4D6AA 2QO6A 2HZQA 2HZRA 1SWJA 3RDSA 4IMOA 2C4IA 2IZCB 3O19A 4LZVA 1OBPA 3HPEA 2FT9A 1UYOX 1OEKA 3P02A 2MWHA 3PH6A 2OYBO 1GT4A 5HCEC 1WUBA 3S26A 4EXZA 4TQ2A 4L1NA 4QYPA 1UYNX 5EEEA 2AL0X 4QGVA 5F6BA 4NW4A 2X55A 1NQNA 1OBUA 4Y59A 5IXGA 4ZR2A 3BSZE 2X56A 5L8NA 4IB6A 1JJXA 3VHIA 1DZMA 3HOEA 5FQ7E 5B5FA 4CPIA 2AT3X 4NNSA 3RZYA 4ALBA 5LJGA 1E02A 1CRBA 1QFVA 5F6ZA 4AZNA 5IRWA 2L67A 5CYBA 4QGXA 1W4TA 3MG5A 1KXOA 1ZNLA 1SLGB 3U9PC 3WZOA 1U18A 4YFRA 2W2BA 4I3DA 1NP1A 4FBRA 1JJJA 5EDBA 3FR4A 1AB0A 2RTFB 1X8OA 2Y32A 1G5WA 5K68A 2QMIA 4IBAA 4DCBA 4L3RA 1PBOA 1QY2A 5F1EA 1SWAA 2HLVA 5HZ5A 4Z28A 3OBLA 3BDRA 1HMRA 3AEHA 3AUMO 1MDCA 1BRPA 1KOIA 2IZDB 4YDBA 2RTCB 1JIWI 4ZFXA 3HWFA 2OFMX 5H9NA 1FENA 5HBSA 1I06A 1K24A 3SLJA 3WJFA 3HTYA 2AT5X 3D97A 2JU3A 2KT4B 2FWVA 1A2DA 2BT9A 3WZQA 1ZNHA 3P6GA 3NX2A 4PJ2A 3UEVA 4CPHA 3STKA 4ZJ0A 1SRFA 4INNA 1SWQA 4FQBB 1ICNA 3RDOA 1SY2A 4DNEA 1RXJA 3PH5A 1MUPA 2GTLN 4M6SA 3FR5A 4CPHB 4AZMA 1N9MA 2CZUA 2WSJA 3NP1A 5D48A 2EU7X 4WBKA 5AJCA 3ELZA 4GJSA 4ODDA 3C78X 4ID2A 1SWUA 1HMTA 2AT6X 4HPBA 3SZHA 4Y0QA 1YWBA 4TKJA 2CM4A 3BLGA 4QQ1A 4YFPA 1ZNEA 5LJKA 1AVDA 3VPJE 3VHHA 3FIQA 2ZAGA 1R0UA 4CV7A 1YP7A 1GX8A 2A0AA 3CBSA 1RBPA 2NP1A 1KFFA 1CJ5A 4I6SA 1EI5A 4QZUA 1LIEA 2VFBA 3NQKA 1VWFB 1KT3A 2A8GA 1JYDA 2RTNB 2XKLA 1GT1A 1QABE 4HPDA 1U0XA 2Q39A 4BOEA 3JS1A 1HXLA 3QKGA 4Y0PA 3UAQA 2X4MA 4I95A 1H91A 3KFIA 4O3XB 1HQQA 1LDOA 2FTBA 4IAWA 4YVBA 3P24A 3VG7A 2GC9A 4DQ4A 5IO5A 2XSTA 2FR2A 3NX1A 4KH8A 2OY5O 5IO7A 2I5VO 2KD2A 4Y0SA 4YKMA 3S60A 3T6LA 2X34A 2BLGA 1IIUA 2MF6A 1KL5A 5BVQA 3FEPA 3VG4A 4GU8A 1JMZA 4YGHA 2F73A 2QOMA 3E3CA 3PEDA 3V8UA 3EM0A 4O49A 4HWMA 1OPAA 3EMMA 1PM1X 2ASNX 1BSYA 2OF9A 1LCWA 1SWDA 1YWCA 4KCAA 1JBHA 1LCZA 1SWCA 3WZPA 3MVFA 3OD9A 5KICA 3BS2A 3B2KA 4COTA 4KIIA 2DJGA 2AT8X 1SY3A 1VWEB 4OS0A 3RBYA 1KQWA 1I78A 2LBVA 2JU8A 5KIDA 1OBQA 1SXXA 2R73A 4I9SA 3SZJA 2X46A 4QRLA 4WHIA 2A5BA 1SY0A 1GX9A 5CSEA 1SY1A 5FFHA 1GKAA 1PTSA 2A2UA 1SWHA 4Y0RA 5IRAA 3TGBA 1XCAA 1BBPA 2P8GA 1TOWA 2G7BA 2BHVA 4BGFA 1JMXA 1VWMB 4GUZA 2BSZA 2Q2MA 1VWRB 4MVIA 3PDFA 4I60A 4YBPA 1A57A 1E5PA 3IFBA 3ZQ3A 1GKAB 1MX8A 2FLJA 1TOUA 5K06A 1TW4A 5CHKA 4AZQA 1YWAA 2LB6A 4XMHA 4EDEA 1SWGA 3I17A 1SWNA 4CDDA 4I9RA 3RE5A 3ZWEA 3TZSA 3X00A 2A13A 3BY0A 1NBXA 2WWPA 2G5LA 1T68X 5B2AO 5AQ6A 1O1UA 3CMPA 3VG2A 3HWGA 5B29A 2CBSA 2K23A 5HZ6A 1X8UA 4YFQA 1IW2A 3WYPA 1CBQA 1SWTA 2OFRX 2RTEB 1MX7A 1ZNGA 3D96A 3NBXX 1RXKA 4ORRA 5CE4A 2OY1O 4D6BA 2IZBA 2BS6A 3EC5A 5B10O 1SXYA 4ZHHA 1STPA 1VWIB 1X89A 2PY1A 3NR3A 2QO5A 4ORSA 3T6FA 2L5PA 3KFFA 3P6HA 4GGZA 4TLJA 3WOVA 4BX7A 3FA6A 3ZW2A 4DQ3A 3B2IA 4MEEA 3LTWA 1A3YA 1IJ8A 1D3SA 2F01A 2HYSA 4YH0A 5BYPA 4BX7B 3VG6A 2ANSA 3Q34A 4ORYA 2YMSA 1EW3A 3LHNA 3UEUA 1DF3A 1FE3A 1IFCA 2RTOB 1SRIA 3HWEA 4UU3A 3K3LA 5EEDA 1HMSA 5B27A 3WJEA 2RTGB 1LKEA 5L8IA 1P6PA 2KTSA 3MX7A 4YGZA 2Y3FA 3FELA 1LCVA 4IB9A 4Z2OA 1HN2A 5HAEA 3BRNA 5EPQA 1DZJA 2OF8A 2A3FX 1DFVA 2POAA 1B0OA 3CKFA 1HXZA 4JNJA 1BJ7A 5JR8A 1KGLA 2L68A 1CBRA 1MOYA 3VGWA 1VWJB 3NQ3A 3PP6A 4HFOA 3SLOA 1GGLA 3ZI8A 1E06A 2MJIA 4I3BA 5HCCC 1I05A 5B11O 3T2WA 2KW1A 1GXAA 1SLDB 1QWDA 5F58A 3D95A 4ORWA 3FDCA 1E2TA 3WJDA 3MBTA 1WBIA 3B2LA 5FQ6E 3FR2A 1ZNKA 4JHQA 1ML7A 1SRHA 1SWFA 2C1SA 1N4JA 1ICMA 1KL4A 1QG5A 2FHNX 1G85A 2IZGB 2MHDA 2RTRB 1O8VA 1QQSA 1W6FA 3F8AA 4FGIB 5B5GA 4O4OA 3KZAA 4OS8A 3JQOA 4LZUA 4CDCA 1DF8A 1FDQA 1VWNB 3T2XA 1IKEA 1ACDA 4OMXA 4CPFA 1N9YA 1VPRA 2RTDB 4U8UN 4YBUA 2X32A 4ZHDA 1QFTA 2IZKA 3FA9A 2QOSC 3PECA 3P6FA 4ZH6A 1KL3A 3FENA 1I04A 1LICA 1SREA 2ALLX 2G79A 1VWPB 1LELA 2IZHB 2LKKA 3FIDA 4OEMA 5LJEA 1YWDA 1LIFA 1PBYA 2JU7A 2WR6A 4JO6A 1NGLA 2NNDA 2MM3A 2R74A 2ACPX 2WQ9A 5H8TA 4XMDA 4OKAA 1ADLA 1KT4A 3L4RA 3D4RA 2FHLA 2RTLA 4EFGA 3BX8A 4MISA 2RCQA 4YCEA 5EDCA 2FGSA 3BU1A 4OS3A 4XMCA 5HZQA 1GM6A 4YMYA 2OY8A 4BBOA 1KT5A 3STNA 4K19A 2CBRA 4GRJA 4BVMA 3CQNA 3RDUA 1VWBB 2F09A 4CDEA 4N7DA 1KT6A 1HY2A 1VWOB 1SRGA 2X8FA 3T1DA 3U03A 5B3MO 1BWYA 4NYRA 1K3BA 3JSQA 3FYFA 1RAVA 5H9LA 4AZRA 2AMMX 5EZ2A 3ZW0B 1Y53X 2JW1A 2LFOA 1S7DA 1GT5A 2QO4A 1Y9LA 5FQ8E 1ALBA 2HMBA 3TF6A 2IZEB 1CBIA 2RA6A 4EEJA 1SLFB 1X8NA 4OELA 2LA7A 4FBVA 1SXUA 4QZTA 2LBAA 2Q2PA 2RTQB 3WJGA 4YGGA 3H3IA 1QY0A 2N93A 4QGWA 2RTAA 1MM9A 1PEEA 1SWPA 3RWXA 3FEKA 4BX6A 1ERBA 3UEXA 5FENA 1EXSA 1VWDB 1DV9A 3KQ0A 1SWBA 2DJFA 3I0AA 3TGAA 5HTEA 5K67A 2RD7C 1RLBE 4O4SA 4BX6B 4BJ8A 1KZXA 1Z24A 1EUOA 1FEMA 1JQPA 3MM0A 2GTLM 4KC8A 2OVSA 3N91A 2OL7A 3P6DA 1JV4A 1KZWA 5HA1A 1S2PA 1SXWA 1UREA 4GDZA 3BX7A 2GJ5A 5D47A 4TKHA 2YG2A 2VDFA 3Q6LA 4NV8A 3EBKA 5KHPA 4B55A 2OZQA 1VYFA 4LKTA 2WUTA 4WFVA 2Q4NA 1HBPA 3NADA 2QM9A 3KVNA 1LIBA 3ELXA 4Y5DA 1EPBA 3UEWA 5LKEA 3SOTA 1BRQA 4NP1A 2AH7X 5FAZA 1MVGA 1I4UA 2Q9SA 3CWKA 3S5XA 1LF7A 4O3WA 3TGCA 5HZ9A 1HBQA 1B8EA 4YCHA 2A2GA 5F2BA 4ZCBA 4MVEA 1AVGI 5HA0A 3RSWA 3CR6A 1GX3A 2UYWA 1DZKA 3NPOA 3U0DA 2RTBB 1GT3A 1LDQA 3OJYC 3APXA 4O4UA 3WVMA 4Z27A 1B4MA 1W5RA 2O62A 4GGRA 1CBSA 1T8VA 1HQPA 1D2UA 2GH7A 2GTLO 2KTDA 5HWZA 1BM5A 3O22A 2FR3A 3KFHA 3O2YA 1LPJA 4XMFA 5HCDC 4EQAC 3PQUA 3KFGA 4R0BA 2RTJA 3SAOA 4U46A 4ES7A 4GETA 4GKCA 4IMNA 3RKGA 1AQBA 4GNYA 4NYQA 5L3YA 4O4XA 1O1VA 1LNMA 1TVQA 3SZIA 3WJBA 2ZSCA 1KQXA 3P6EA 4LQZA 1N7YA 1LUQA 4IB7A 4KC7A 2FS7A 2GTFX 1DZPA 1SWLA 2X8TA 1SRJA 1OPBA 2ACOA 4CPEA 3VHMA 4MIRA 4ZHFA 4GJVA 4GK9A 4GNWA 4NLJA 2FKJA 3CKGA 4ZH9A 2AF5A 3AKMA 3WYQA 2JMBA 5C0NA 1X71A 5D45A 1FELA 1VYGA 1YP6A 2RTMA 3P6CA 1KT7A 3F9DA 3RE6A 3HK1A 3VE1A 3WXQA 1YUPA 2QCBA 1B56A 3GE2A 1U17A 4ALOA 1EQDA 1SWOA 1NQMA 2OVDA 2BC3A 4PSQA 4AZPA 1MK5A 1TXLA 4GD9A 4Z6JA 2HKDA 2MO5A 1JYJA 4ZHGA 1BLRA 4ORXA 1VWLB 2X45A 1SA8A 2OFBA 1EPAA 1VWAB 2RQ0A 4UU2A 4O3YA 5LJDA 3RY2A 5AJBA 4CSBA 1OEEA 4HPAA 1STSB 5HTDA 1ZNDA 5IO6A 1X8QA 4BQUA 4EKVA 4N7CA 1N43A 1A18A 1SMPI 4NNTA 2JN3A 3EW1A 4WFUA 4TJZA 1I9HA 1RSTB 2RCTA 1SWKA 1JZUA 3FA8A 4CK4A 1S44A 2CAMA 4YDAA 2WEWA 3RDMA 5D8JA 1SWEA 2IZJA 3FMZA 5LJCA 4GE1A 4BCSA 1E00A 2DM5A 2G78A 4JGLA 3FW4A 4LKPA 2FKGA 1NC9A 4TKBA 5HZ8A 1EIOA 2WEXA 2AVIA 2RTIB 4ARHA 4AZOA 1VWGB 2RTKA 3GAQA 3DTQA 5H9AA 4IRWA 4XMEA 5BVSA 1SWSA 1UZ2X 4QYNA 4YKOA 4HPCA 4CDFA 2A5CA 1AELA 5LKFA 4GDAA 2G8CO 2I5ZO 2X8SA 4A1YA 5AEOA 3STMX 4FBOA 3VG5A 1VYOA 5JD2A 3ZW0A 1NDJA 3WZNA 2NNEA 1VWHB 2AKQA 5DPQA 1MEPA 3ZZVA 1LFOA 3EYCA 5LJBA 1LIDA 2FRSA 2OFAA 3EBWA 4ORUA 1EALA 4ZHCA 1PMPA 2JOZA 3NQ9A 3S5VA 2PI3O 4GH7A 4Z2PA 3LV4A 1T0VA 2W2FA 3ZW1A 2WQAE 1BSOA 2CZTA 3HOLA 4QAEA 4TNNA
chains in the Genus database with same CATH topology
1NP4A 4KT5A 4QNIA 3APVA 5DG4A 2M4LA 1X8PA 3ZW1B 4MVKA 3WBGA 3CQRA 4O9SA 4A1HA 4AYHA 5L8OA 1BSQA 4OMWA 4U9CA 4RUNA 3B2HA 5H9KA 3FLLA 2RN4A 2R56A 3HWDA 2K62A 2Z4HA 2Z4IA 4GZVA 4RUUA 4XMGA 3VU1A 3CBCA 1FTPA 4ML7B 3APUA 2W2AA 3APWA 5D4AA 3DSZA 3ZUIA 4O3ZA 2AT0X 4ZGUA 1Y9TA 1EIIA 2E4JA 3PQSA 5LJHA 3B2JA 4ON1A 3ZUOA 4U8UM 2BS5A 2NNQA 4MVLA 4AW8A 1ERXA 3OE3A 3AKNA 3FW5A 4A8ZA 1YIVA 4ZGFA 3G7XA 2OVAA 3C77X 3WJCA 4A60A 3BU9A 1DC9A 2OVEA 5BVTA 2CM9A 4I3CA 4IB8A 3IA8A 4U3QA 3PPTA 1L6MA 5F7GA 2ZAIA 4NLIA 2IFBA 4M7MA 3FA7A 4IAXA 1OEJA 1XKIA 1G74A 2FS6A 3C76X 1IKJA 1IFBA 1N0SA 3VE2A 1QY1A 3F6ZB 1BEBA 2L9CA 4IABA 2HNXA 4U8UO 1G7NA 1ZRYA 4D6AA 2QO6A 2HZQA 2HZRA 4IMOA 3O19A 4LZVA 1OBPA 2FT9A 3P02A 1OEKA 3PH6A 2MWHA 3S26A 4EXZA 1GT4A 5HCEC 4TQ2A 5L8NA 5LJEA 4L1NA 4QYPA 5EEEA 4QGVA 2AL0X 5F6BA 4NW4A 1OBUA 4ZR2A 3BSZE 4IB6A 1JJXA 1DZMA 3HOEA 5FQ7E 2AT3X 4NNSA 3RZYA 4ALBA 5LJGA 1E02A 1CRBA 1QFVA 5F6ZA 4AZNA 2L67A 5CYBA 4QGXA 1KXOA 1ZNLA 3U9PC 4YFRA 1U18A 2W2BA 4I3DA 1NP1A 4FBRA 1JJJA 5EDBA 3FR4A 1AB0A 1X8OA 1G5WA 2QMIA 4IBAA 4L3RA 1PBOA 1QY2A 5F1EA 2HLVA 5HZ5A 3OBLA 3BDRA 1HMRA 1MDCA 1BRPA 1KOIA 4YDBA 4ZFXA 1JIWI 3HWFA 2OFMX 5H9NA 1FENA 5HBSA 1I06A 3WJFA 3HTYA 2AT5X 3D97A 2JU3A 2KT4B 2FWVA 2BT9A 1A2DA 1ZNHA 3P6GA 3NX2A 4PJ2A 3UEVA 4ZJ0A 3STKA 4INNA 4FQBB 1ICNA 1SY2A 3PH5A 1MUPA 2GTLN 4M6SA 3FR5A 4AZMA 2CZUA 2WSJA 3NP1A 5D48A 2EU7X 4WBKA 5AJCA 3ELZA 4ODDA 3C78X 4ID2A 1HMTA 2AT6X 4HPBA 4Y0QA 1YWBA 4TKJA 2CM4A 3BLGA 4QQ1A 4YFPA 1ZNEA 5LJKA 3VPJE 3FIQA 2ZAGA 1R0UA 4CV7A 1YP7A 1GX8A 2A0AA 3CBSA 1RBPA 2NP1A 1CJ5A 4I6SA 1EI5A 4QZUA 1LIEA 3NQKA 1KT3A 1JYDA 2XKLA 1GT1A 1QABE 4HPDA 1U0XA 2Q39A 4BOEA 3JS1A 3QKGA 4Y0PA 3UAQA 4I95A 1H91A 3KFIA 4O3XB 2FTBA 4IAWA 3P24A 3VG7A 2GC9A 4DQ4A 5IO5A 2XSTA 2FR2A 3NX1A 4KH8A 5IO7A 4YKMA 2KD2A 4Y0SA 3S60A 2BLGA 1IIUA 5BVQA 3FEPA 3VG4A 4GU8A 4YGHA 3V8UA 2F73A 3E3CA 3PEDA 3EM0A 4O49A 4HWMA 1OPAA 3EMMA 1PM1X 2ASNX 1BSYA 1YWCA 4KCAA 1JBHA 3MVFA 3OD9A 5KICA 3BS2A 3B2KA 4COTA 4KIIA 2AT8X 1SY3A 4OS0A 3RBYA 1KQWA 2LBVA 5KIDA 2JU8A 1OBQA 1SXXA 2R73A 4I9SA 2X46A 4QRLA 4WHIA 1SY0A 1GX9A 1SY1A 5FFHA 1GKAA 2A2UA 4Y0RA 3TGBA 1XCAA 1BBPA 2P8GA 1TOWA 2G7BA 2BHVA 2Q2MA 4MVIA 4YBPA 1A57A 1E5PA 3IFBA 3ZQ3A 1GKAB 1MX8A 2FLJA 1TOUA 1TW4A 4AZQA 1YWAA 2LB6A 4XMHA 4EDEA 3I17A 3TZSA 4I9RA 3ZWEA 2A13A 3BY0A 2WWPA 1T68X 5AQ6A 1O1UA 3CMPA 3VG2A 3HWGA 5B29A 2CBSA 2K23A 5HZ6A 1X8UA 4YFQA 1IW2A 1CBQA 2OFRX 3NBXX 1MX7A 1ZNGA 3D96A 4ORRA 5CE4A 4D6BA 2BS6A 1SXYA 4ZHHA 3NR3A 1X89A 2PY1A 4ORSA 2QO5A 2L5PA 3KFFA 3P6HA 4TLJA 3WOVA 3FA6A 3ZW2A 4DQ3A 3B2IA 1A3YA 1D3SA 2HYSA 4YH0A 5BYPA 3VG6A 2ANSA 4ORYA 2YMSA 1EW3A 3LHNA 3UEUA 1DF3A 1FE3A 1IFCA 4UU3A 5EEDA 3HWEA 5B27A 3K3LA 3WJEA 1HMSA 4BVMA 1LKEA 5L8IA 1P6PA 2KTSA 3MX7A 4YGZA 3FELA 4IB9A 1HN2A 5HAEA 3BRNA 5EPQA 1DZJA 2A3FX 1DFVA 2POAA 1B0OA 1BJ7A 5JR8A 1KGLA 2L68A 1CBRA 3NQ3A 3PP6A 4HFOA 1GGLA 3ZI8A 1E06A 2MJIA 4I3BA 5HCCC 1I05A 2KW1A 1GXAA 1QWDA 5F58A 3D95A 4ORWA 3WJDA 3MBTA 3B2LA 5FQ6E 3FR2A 1ZNKA 1ML7A 2R74A 1ICMA 1QG5A 1G85A 2MHDA 3F8AA 4FGIB 1O8VA 1QQSA 4O4OA 3KZAA 4OS8A 3JQOA 4LZUA 1FDQA 1IKEA 1ACDA 4OMXA 1VPRA 4U8UN 4YBUA 4ZHDA 1QFTA 3FA9A 2QOSC 3PECA 3P6FA 4ZH6A 3FENA 1I04A 1LICA 2ALLX 2LKKA 2G79A 5K06A 1YWDA 1LIFA 2WR6A 2JU7A 3VG3A 3WJGA 1NGLA 2NNDA 2MM3A 5H8TA 2ACPX 2WQ9A 4XMDA 1ADLA 1KT4A 3L4RA 3D4RA 4EFGA 3BX8A 4MISA 2RCQA 4YCEA 5EDCA 3BU1A 4OS3A 4XMCA 5HZQA 1GM6A 4YMYA 1KT5A 3STNA 4K19A 2CBRA 4GRJA 3CQNA 2F09A 4N7DA 1KT6A 1BWYA 2X8FA 3T1DA 3U03A 4NYRA 3JSQA 3FYFA 5H9LA 4AZRA 2AMMX 5EZ2A 3ZW0B 2LFOA 2JW1A 1S7DA 1GT5A 2QO4A 1Y9LA 5FQ8E 1ALBA 2HMBA 3TF6A 1CBIA 2RA6A 4EEJA 1X8NA 2LA7A 4FBVA 1SXUA 4QZTA 2LBAA 2Q2PA 4YGGA 3H3IA 1QY0A 2N93A 4QGWA 3RWXA 1PEEA 3FEKA 1ERBA 3UEXA 5FENA 1EXSA 1DV9A 3KQ0A 3I0AA 3TGAA 5HTEA 2RD7C 1RLBE 4O4SA 1KZXA 1Z24A 1EUOA 1FEMA 4KC8A 2GTLM 2OVSA 3N91A 3P6DA 1KZWA 1JV4A 5HA1A 1S2PA 1SXWA 1UREA 4GDZA 3BX7A 2GJ5A 5D47A 4TKHA 2YG2A 3Q6LA 3EBKA 5KHPA 2OZQA 1VYFA 4LKTA 2WUTA 4WFVA 2Q4NA 1HBPA 3NADA 2QM9A 1LIBA 3ELXA 1EPBA 3UEWA 5LKEA 3SOTA 1BRQA 4NP1A 2AH7X 5FAZA 1MVGA 1I4UA 2Q9SA 3CWKA 3S5XA 1LF7A 4O3WA 3TGCA 5HZ9A 1HBQA 1B8EA 4YCHA 2A2GA 4ZCBA 4MVEA 1AVGI 5HA0A 3RSWA 3CR6A 1DZKA 3NPOA 3U0DA 1GT3A 3OJYC 3WVMA 3APXA 4O4UA 1B4MA 2O62A 1CBSA 1T8VA 1HQPA 1D2UA 2KTDA 2GTLO 5HWZA 1BM5A 3O22A 2FR3A 3KFHA 3O2YA 1LPJA 4XMFA 5HCDC 4EQAC 3PQUA 3KFGA 4R0BA 3SAOA 4ES7A 4GETA 4GKCA 4IMNA 3RKGA 1AQBA 4GNYA 4NYQA 4O4XA 1O1VA 1LNMA 1TVQA 3WJBA 3P6EA 1KQXA 4LQZA 4IB7A 4KC7A 2FS7A 2GTFX 1DZPA 2X8TA 4ZHFA 1OPBA 2ACOA 4MIRA 4GK9A 4GNWA 4NLJA 4ZH9A 3AKMA 2JMBA 5C0NA 1X71A 5D45A 1FELA 1VYGA 1YP6A 3P6CA 1KT7A 3F9DA 3HK1A 3VE1A 3WXQA 1YUPA 1B56A 3GE2A 1U17A 4ALOA 1EQDA 2OVDA 4PSQA 4AZPA 1TXLA 1BLRA 4ZHGA 2MO5A 1JYJA 4ORXA 2X45A 1SA8A 4UU2A 1EPAA 2RQ0A 5LJDA 4O3YA 5AJBA 4CSBA 1OEEA 4HPAA 5HTDA 1ZNDA 5IO6A 1X8QA 4BQUA 4N7CA 1A18A 1SMPI 4NNTA 2JN3A 4WFUA 4TJZA 2RCTA 1JZUA 3FA8A 4CK4A 1S44A 4YDAA 2WEWA 5D8JA 3FMZA 5LJCA 4GE1A 1E00A 2DM5A 2G78A 4JGLA 3FW4A 4LKPA 4TKBA 5HZ8A 1EIOA 2WEXA 4ARHA 4AZOA 3GAQA 3DTQA 5H9AA 4XMEA 5BVSA 1UZ2X 4QYNA 4YKOA 4HPCA 1AELA 5LKFA 2X8SA 4A1YA 5AEOA 3STMX 4FBOA 3VG5A 3ZW0A 2NNEA 2AKQA 5DPQA 3ZZVA 1LFOA 3EYCA 5LJBA 1LIDA 2FRSA 3EBWA 4ORUA 1EALA 4ZHCA 1PMPA 2JOZA 3NQ9A 3S5VA 4GH7A 3LV4A 1T0VA 2W2FA 3ZW1A 2WQAE 1BSOA 2CZTA 3HOLA 4QAEA 4TNNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VPJ E;  4FQB B;  4EQA C;  4FGI B; 
#chains in the Genus database with same CATH topology
 2JGS A;  1NP4 A;  1STR B;  4KT5 A;  4QNI A;  3APV A;  5DG4 A;  2M4L A;  1X8P A;  1OSP O;  2Y3E A;  3ZW1 B;  4MVK A;  3WBG A;  3CQR A;  4NV7 A;  4O9S A;  4A1H A;  4AYH A;  4BX5 B;  5L8O A;  1BSQ A;  4OMW A;  2OY7 A;  4U9C A;  4RUN A;  3B2H A;  5H9K A;  3FLL A;  2RN4 A;  2R56 A;  3HWD A;  3PK2 A;  2K62 A;  2Z4H A;  3VG3 A;  2Z4I A;  4GZV A;  4RUU A;  3RDX A;  4XMG A;  1RSU B;  1VWK B;  3CBC A;  3VU1 A;  1FTP A;  4ML7 B;  1SLE B;  3APU A;  2W2A A;  3APW A;  5D4A A;  3DSZ A;  3ZUI A;  4O3Z A;  2AT0 X;  4ZGU A;  4BX5 A;  2OL6 O;  1Y9T A;  1SWR A;  2E4J A;  2OL8 O;  1EII A;  3PQS A;  5LJH A;  3B2J A;  3QQ2 A;  4ON1 A;  3ZUO A;  4U8U M;  2BS5 A;  1JJU A;  1VWQ B;  2NNQ A;  2VFC A;  4MVL A;  4AW8 A;  2IZF B;  1ERX A;  3OE3 A;  1FJ1 E;  3AKN A;  3FW5 A;  4C5P A;  4A8Z A;  3EW2 A;  1YIV A;  4ZGF A;  3D9W A;  3G7X A;  3RDQ A;  2OVA A;  3C77 X;  3WJC A;  1Y52 X;  3BU9 A;  4A60 A;  1DC9 A;  2OVE A;  5BVT A;  2RTP B;  2CM9 A;  4GGT A;  4I3C A;  4IB8 A;  3IA8 A;  4U3Q A;  3PPT A;  1L6M A;  5F7G A;  3SLT A;  2ZAI A;  4NLI A;  5IRU A;  1Y55 X;  2IFB A;  2UZ2 A;  4M7M A;  1AVE A;  3FA7 A;  4IAX A;  1OEJ A;  2IZI A;  1Y0G A;  1XKI A;  1G74 A;  2FS6 A;  3C76 X;  1IKJ A;  1IFB A;  1VWC B;  1RXH A;  4Z2V A;  1N0S A;  3VE2 A;  1QY1 A;  3F6Z B;  1BEB A;  2L9C A;  2C1Q A;  2HNX A;  2WPU A;  4IAB A;  4U8U O;  1G7N A;  2IZL B;  3RY1 A;  2IZA A;  2RTH B;  1ZRY A;  4D6A A;  2QO6 A;  2HZQ A;  2HZR A;  1SWJ A;  3RDS A;  4IMO A;  2C4I A;  2IZC B;  3O19 A;  4LZV A;  1OBP A;  3HPE A;  2FT9 A;  1UYO X;  1OEK A;  3P02 A;  2MWH A;  3PH6 A;  2OYB O;  1GT4 A;  5HCE C;  1WUB A;  3S26 A;  4EXZ A;  4TQ2 A;  4L1N A;  4QYP A;  1UYN X;  5EEE A;  2AL0 X;  4QGV A;  5F6B A;  4NW4 A;  2X55 A;  1NQN A;  1OBU A;  4Y59 A;  5IXG A;  4ZR2 A;  3BSZ E;  2X56 A;  5L8N A;  4IB6 A;  1JJX A;  3VHI A;  1DZM A;  3HOE A;  5FQ7 E;  5B5F A;  4CPI A;  2AT3 X;  4NNS A;  3RZY A;  4ALB A;  5LJG A;  1E02 A;  1CRB A;  1QFV A;  5F6Z A;  4AZN A;  5IRW A;  2L67 A;  5CYB A;  4QGX A;  1W4T A;  3MG5 A;  1KXO A;  1ZNL A;  1SLG B;  3U9P C;  3WZO A;  1U18 A;  4YFR A;  2W2B A;  4I3D A;  1NP1 A;  4FBR A;  1JJJ A;  5EDB A;  3FR4 A;  1AB0 A;  2RTF B;  1X8O A;  2Y32 A;  1G5W A;  5K68 A;  2QMI A;  4IBA A;  4DCB A;  4L3R A;  1PBO A;  1QY2 A;  5F1E A;  1SWA A;  2HLV A;  5HZ5 A;  4Z28 A;  3OBL A;  3BDR A;  1HMR A;  3AEH A;  3AUM O;  1MDC A;  1BRP A;  1KOI A;  2IZD B;  4YDB A;  2RTC B;  1JIW I;  4ZFX A;  3HWF A;  2OFM X;  5H9N A;  1FEN A;  5HBS A;  1I06 A;  1K24 A;  3SLJ A;  3WJF A;  3HTY A;  2AT5 X;  3D97 A;  2JU3 A;  2KT4 B;  2FWV A;  1A2D A;  2BT9 A;  3WZQ A;  1ZNH A;  3P6G A;  3NX2 A;  4PJ2 A;  3UEV A;  4CPH A;  3STK A;  4ZJ0 A;  1SRF A;  4INN A;  1SWQ A;  4FQB B;  1ICN A;  3RDO A;  1SY2 A;  4DNE A;  1RXJ A;  3PH5 A;  1MUP A;  2GTL N;  4M6S A;  3FR5 A;  4CPH B;  4AZM A;  1N9M A;  2CZU A;  2WSJ A;  3NP1 A;  5D48 A;  2EU7 X;  4WBK A;  5AJC A;  3ELZ A;  4GJS A;  4ODD A;  3C78 X;  4ID2 A;  1SWU A;  1HMT A;  2AT6 X;  4HPB A;  3SZH A;  4Y0Q A;  1YWB A;  4TKJ A;  2CM4 A;  3BLG A;  4QQ1 A;  4YFP A;  1ZNE A;  5LJK A;  1AVD A;  3VPJ E;  3VHH A;  3FIQ A;  2ZAG A;  1R0U A;  4CV7 A;  1YP7 A;  1GX8 A;  2A0A A;  3CBS A;  1RBP A;  2NP1 A;  1KFF A;  1CJ5 A;  4I6S A;  1EI5 A;  4QZU A;  1LIE A;  2VFB A;  3NQK A;  1VWF B;  1KT3 A;  2A8G A;  1JYD A;  2RTN B;  2XKL A;  1GT1 A;  1QAB E;  4HPD A;  1U0X A;  2Q39 A;  4BOE A;  3JS1 A;  1HXL A;  3QKG A;  4Y0P A;  3UAQ A;  2X4M A;  4I95 A;  1H91 A;  3KFI A;  4O3X B;  1HQQ A;  1LDO A;  2FTB A;  4IAW A;  4YVB A;  3P24 A;  3VG7 A;  2GC9 A;  4DQ4 A;  5IO5 A;  2XST A;  2FR2 A;  3NX1 A;  4KH8 A;  2OY5 O;  5IO7 A;  2I5V O;  2KD2 A;  4Y0S A;  4YKM A;  3S60 A;  3T6L A;  2X34 A;  2BLG A;  1IIU A;  2MF6 A;  1KL5 A;  5BVQ A;  3FEP A;  3VG4 A;  4GU8 A;  1JMZ A;  4YGH A;  2F73 A;  2QOM A;  3E3C A;  3PED A;  3V8U A;  3EM0 A;  4O49 A;  4HWM A;  1OPA A;  3EMM A;  1PM1 X;  2ASN X;  1BSY A;  2OF9 A;  1LCW A;  1SWD A;  1YWC A;  4KCA A;  1JBH A;  1LCZ A;  1SWC A;  3WZP A;  3MVF A;  3OD9 A;  5KIC A;  3BS2 A;  3B2K A;  4COT A;  4KII A;  2DJG A;  2AT8 X;  1SY3 A;  1VWE B;  4OS0 A;  3RBY A;  1KQW A;  1I78 A;  2LBV A;  2JU8 A;  5KID A;  1OBQ A;  1SXX A;  2R73 A;  4I9S A;  3SZJ A;  2X46 A;  4QRL A;  4WHI A;  2A5B A;  1SY0 A;  1GX9 A;  5CSE A;  1SY1 A;  5FFH A;  1GKA A;  1PTS A;  2A2U A;  1SWH A;  4Y0R A;  5IRA A;  3TGB A;  1XCA A;  1BBP A;  2P8G A;  1TOW A;  2G7B A;  2BHV A;  4BGF A;  1JMX A;  1VWM B;  4GUZ A;  2BSZ A;  2Q2M A;  1VWR B;  4MVI A;  3PDF A;  4I60 A;  4YBP A;  1A57 A;  1E5P A;  3IFB A;  3ZQ3 A;  1GKA B;  1MX8 A;  2FLJ A;  1TOU A;  5K06 A;  1TW4 A;  5CHK A;  4AZQ A;  1YWA A;  2LB6 A;  4XMH A;  4EDE A;  1SWG A;  3I17 A;  1SWN A;  4CDD A;  4I9R A;  3RE5 A;  3ZWE A;  3TZS A;  3X00 A;  2A13 A;  3BY0 A;  1NBX A;  2WWP A;  2G5L A;  1T68 X;  5B2A O;  5AQ6 A;  1O1U A;  3CMP A;  3VG2 A;  3HWG A;  5B29 A;  2CBS A;  2K23 A;  5HZ6 A;  1X8U A;  4YFQ A;  1IW2 A;  3WYP A;  1CBQ A;  1SWT A;  2OFR X;  2RTE B;  1MX7 A;  1ZNG A;  3D96 A;  3NBX X;  1RXK A;  4ORR A;  5CE4 A;  2OY1 O;  4D6B A;  2IZB A;  2BS6 A;  3EC5 A;  5B10 O;  1SXY A;  4ZHH A;  1STP A;  1VWI B;  1X89 A;  2PY1 A;  3NR3 A;  2QO5 A;  4ORS A;  3T6F A;  2L5P A;  3KFF A;  3P6H A;  4GGZ A;  4TLJ A;  3WOV A;  4BX7 A;  3FA6 A;  3ZW2 A;  4DQ3 A;  3B2I A;  4MEE A;  3LTW A;  1A3Y A;  1IJ8 A;  1D3S A;  2F01 A;  2HYS A;  4YH0 A;  5BYP A;  4BX7 B;  3VG6 A;  2ANS A;  3Q34 A;  4ORY A;  2YMS A;  1EW3 A;  3LHN A;  3UEU A;  1DF3 A;  1FE3 A;  1IFC A;  2RTO B;  1SRI A;  3HWE A;  4UU3 A;  3K3L A;  5EED A;  1HMS A;  5B27 A;  3WJE A;  2RTG B;  1LKE A;  5L8I A;  1P6P A;  2KTS A;  3MX7 A;  4YGZ A;  2Y3F A;  3FEL A;  1LCV A;  4IB9 A;  4Z2O A;  1HN2 A;  5HAE A;  3BRN A;  5EPQ A;  1DZJ A;  2OF8 A;  2A3F X;  1DFV A;  2POA A;  1B0O A;  3CKF A;  1HXZ A;  4JNJ A;  1BJ7 A;  5JR8 A;  1KGL A;  2L68 A;  1CBR A;  1MOY A;  3VGW A;  1VWJ B;  3NQ3 A;  3PP6 A;  4HFO A;  3SLO A;  1GGL A;  3ZI8 A;  1E06 A;  2MJI A;  4I3B A;  5HCC C;  1I05 A;  5B11 O;  3T2W A;  2KW1 A;  1GXA A;  1SLD B;  1QWD A;  5F58 A;  3D95 A;  4ORW A;  3FDC A;  1E2T A;  3WJD A;  3MBT A;  1WBI A;  3B2L A;  5FQ6 E;  3FR2 A;  1ZNK A;  4JHQ A;  1ML7 A;  1SRH A;  1SWF A;  2C1S A;  1N4J A;  1ICM A;  1KL4 A;  1QG5 A;  2FHN X;  1G85 A;  2IZG B;  2MHD A;  2RTR B;  1O8V A;  1QQS A;  1W6F A;  3F8A A;  4FGI B;  5B5G A;  4O4O A;  3KZA A;  4OS8 A;  3JQO A;  4LZU A;  4CDC A;  1DF8 A;  1FDQ A;  1VWN B;  3T2X A;  1IKE A;  1ACD A;  4OMX A;  4CPF A;  1N9Y A;  1VPR A;  2RTD B;  4U8U N;  4YBU A;  2X32 A;  4ZHD A;  1QFT A;  2IZK A;  3FA9 A;  2QOS C;  3PEC A;  3P6F A;  4ZH6 A;  1KL3 A;  3FEN A;  1I04 A;  1LIC A;  1SRE A;  2ALL X;  2G79 A;  1VWP B;  1LEL A;  2IZH B;  2LKK A;  3FID A;  4OEM A;  5LJE A;  1YWD A;  1LIF A;  1PBY A;  2JU7 A;  2WR6 A;  4JO6 A;  1NGL A;  2NND A;  2MM3 A;  2R74 A;  2ACP X;  2WQ9 A;  5H8T A;  4XMD A;  4OKA A;  1ADL A;  1KT4 A;  3L4R A;  3D4R A;  2FHL A;  2RTL A;  4EFG A;  3BX8 A;  4MIS A;  2RCQ A;  4YCE A;  5EDC A;  2FGS A;  3BU1 A;  4OS3 A;  4XMC A;  5HZQ A;  1GM6 A;  4YMY A;  2OY8 A;  4BBO A;  1KT5 A;  3STN A;  4K19 A;  2CBR A;  4GRJ A;  4BVM A;  3CQN A;  3RDU A;  1VWB B;  2F09 A;  4CDE A;  4N7D A;  1KT6 A;  1HY2 A;  1VWO B;  1SRG A;  2X8F A;  3T1D A;  3U03 A;  5B3M O;  1BWY A;  4NYR A;  1K3B A;  3JSQ A;  3FYF A;  1RAV A;  5H9L A;  4AZR A;  2AMM X;  5EZ2 A;  3ZW0 B;  1Y53 X;  2JW1 A;  2LFO A;  1S7D A;  1GT5 A;  2QO4 A;  1Y9L A;  5FQ8 E;  1ALB A;  2HMB A;  3TF6 A;  2IZE B;  1CBI A;  2RA6 A;  4EEJ A;  1SLF B;  1X8N A;  4OEL A;  2LA7 A;  4FBV A;  1SXU A;  4QZT A;  2LBA A;  2Q2P A;  2RTQ B;  3WJG A;  4YGG A;  3H3I A;  1QY0 A;  2N93 A;  4QGW A;  2RTA A;  1MM9 A;  1PEE A;  1SWP A;  3RWX A;  3FEK A;  4BX6 A;  1ERB A;  3UEX A;  5FEN A;  1EXS A;  1VWD B;  1DV9 A;  3KQ0 A;  1SWB A;  2DJF A;  3I0A A;  3TGA A;  5HTE A;  5K67 A;  2RD7 C;  1RLB E;  4O4S A;  4BX6 B;  4BJ8 A;  1KZX A;  1Z24 A;  1EUO A;  1FEM A;  1JQP A;  3MM0 A;  2GTL M;  4KC8 A;  2OVS A;  3N91 A;  2OL7 A;  3P6D A;  1JV4 A;  1KZW A;  5HA1 A;  1S2P A;  1SXW A;  1URE A;  4GDZ A;  3BX7 A;  2GJ5 A;  5D47 A;  4TKH A;  2YG2 A;  2VDF A;  3Q6L A;  4NV8 A;  3EBK A;  5KHP A;  4B55 A;  2OZQ A;  1VYF A;  4LKT A;  2WUT A;  4WFV A;  2Q4N A;  1HBP A;  3NAD A;  2QM9 A;  3KVN A;  1LIB A;  3ELX A;  4Y5D A;  1EPB A;  3UEW A;  5LKE A;  3SOT A;  1BRQ A;  4NP1 A;  2AH7 X;  5FAZ A;  1MVG A;  1I4U A;  2Q9S A;  3CWK A;  3S5X A;  1LF7 A;  4O3W A;  3TGC A;  5HZ9 A;  1HBQ A;  1B8E A;  4YCH A;  2A2G A;  5F2B A;  4ZCB A;  4MVE A;  1AVG I;  5HA0 A;  3RSW A;  3CR6 A;  1GX3 A;  2UYW A;  1DZK A;  3NPO A;  3U0D A;  2RTB B;  1GT3 A;  1LDQ A;  3OJY C;  3APX A;  4O4U A;  3WVM A;  4Z27 A;  1B4M A;  1W5R A;  2O62 A;  4GGR A;  1CBS A;  1T8V A;  1HQP A;  1D2U A;  2GH7 A;  2GTL O;  2KTD A;  5HWZ A;  1BM5 A;  3O22 A;  2FR3 A;  3KFH A;  3O2Y A;  1LPJ A;  4XMF A;  5HCD C;  4EQA C;  3PQU A;  3KFG A;  4R0B A;  2RTJ A;  3SAO A;  4U46 A;  4ES7 A;  4GET A;  4GKC A;  4IMN A;  3RKG A;  1AQB A;  4GNY A;  4NYQ A;  5L3Y A;  4O4X A;  1O1V A;  1LNM A;  1TVQ A;  3SZI A;  3WJB A;  2ZSC A;  1KQX A;  3P6E A;  4LQZ A;  1N7Y A;  1LUQ A;  4IB7 A;  4KC7 A;  2FS7 A;  2GTF X;  1DZP A;  1SWL A;  2X8T A;  1SRJ A;  1OPB A;  2ACO A;  4CPE A;  3VHM A;  4MIR A;  4ZHF A;  4GJV A;  4GK9 A;  4GNW A;  4NLJ A;  2FKJ A;  3CKG A;  4ZH9 A;  2AF5 A;  3AKM A;  3WYQ A;  2JMB A;  5C0N A;  1X71 A;  5D45 A;  1FEL A;  1VYG A;  1YP6 A;  2RTM A;  3P6C A;  1KT7 A;  3F9D A;  3RE6 A;  3HK1 A;  3VE1 A;  3WXQ A;  1YUP A;  2QCB A;  1B56 A;  3GE2 A;  1U17 A;  4ALO A;  1EQD A;  1SWO A;  1NQM A;  2OVD A;  2BC3 A;  4PSQ A;  4AZP A;  1MK5 A;  1TXL A;  4GD9 A;  4Z6J A;  2HKD A;  2MO5 A;  1JYJ A;  4ZHG A;  1BLR A;  4ORX A;  1VWL B;  2X45 A;  1SA8 A;  2OFB A;  1EPA A;  1VWA B;  2RQ0 A;  4UU2 A;  4O3Y A;  5LJD A;  3RY2 A;  5AJB A;  4CSB A;  1OEE A;  4HPA A;  1STS B;  5HTD A;  1ZND A;  5IO6 A;  1X8Q A;  4BQU A;  4EKV A;  4N7C A;  1N43 A;  1A18 A;  1SMP I;  4NNT A;  2JN3 A;  3EW1 A;  4WFU A;  4TJZ A;  1I9H A;  1RST B;  2RCT A;  1SWK A;  1JZU A;  3FA8 A;  4CK4 A;  1S44 A;  2CAM A;  4YDA A;  2WEW A;  3RDM A;  5D8J A;  1SWE A;  2IZJ A;  3FMZ A;  5LJC A;  4GE1 A;  4BCS A;  1E00 A;  2DM5 A;  2G78 A;  4JGL A;  3FW4 A;  4LKP A;  2FKG A;  1NC9 A;  4TKB A;  5HZ8 A;  1EIO A;  2WEX A;  2AVI A;  2RTI B;  4ARH A;  4AZO A;  1VWG B;  2RTK A;  3GAQ A;  3DTQ A;  5H9A A;  4IRW A;  4XME A;  5BVS A;  1SWS A;  1UZ2 X;  4QYN A;  4YKO A;  4HPC A;  4CDF A;  2A5C A;  1AEL A;  5LKF A;  4GDA A;  2G8C O;  2I5Z O;  2X8S A;  4A1Y A;  5AEO A;  3STM X;  4FBO A;  3VG5 A;  1VYO A;  5JD2 A;  3ZW0 A;  1NDJ A;  3WZN A;  2NNE A;  1VWH B;  2AKQ A;  5DPQ A;  1MEP A;  3ZZV A;  1LFO A;  3EYC A;  5LJB A;  1LID A;  2FRS A;  2OFA A;  3EBW A;  4ORU A;  1EAL A;  4ZHC A;  1PMP A;  2JOZ A;  3NQ9 A;  3S5V A;  2PI3 O;  4GH7 A;  4Z2P A;  3LV4 A;  1T0V A;  2W2F A;  3ZW1 A;  2WQA E;  1BSO A;  2CZT A;  3HOL A;  4QAE A;  4TNN A; 
#chains in the Genus database with same CATH homology
 1NP4 A;  4KT5 A;  4QNI A;  3APV A;  5DG4 A;  2M4L A;  1X8P A;  3ZW1 B;  4MVK A;  3WBG A;  3CQR A;  4O9S A;  4A1H A;  4AYH A;  5L8O A;  1BSQ A;  4OMW A;  4U9C A;  4RUN A;  3B2H A;  5H9K A;  3FLL A;  2RN4 A;  2R56 A;  3HWD A;  2K62 A;  2Z4H A;  2Z4I A;  4GZV A;  4RUU A;  4XMG A;  3VU1 A;  3CBC A;  1FTP A;  4ML7 B;  3APU A;  2W2A A;  3APW A;  5D4A A;  3DSZ A;  3ZUI A;  4O3Z A;  2AT0 X;  4ZGU A;  1Y9T A;  1EII A;  2E4J A;  3PQS A;  5LJH A;  3B2J A;  4ON1 A;  3ZUO A;  4U8U M;  2BS5 A;  2NNQ A;  4MVL A;  4AW8 A;  1ERX A;  3OE3 A;  3AKN A;  3FW5 A;  4A8Z A;  1YIV A;  4ZGF A;  3G7X A;  2OVA A;  3C77 X;  3WJC A;  4A60 A;  3BU9 A;  1DC9 A;  2OVE A;  5BVT A;  2CM9 A;  4I3C A;  4IB8 A;  3IA8 A;  4U3Q A;  3PPT A;  1L6M A;  5F7G A;  2ZAI A;  4NLI A;  2IFB A;  4M7M A;  3FA7 A;  4IAX A;  1OEJ A;  1XKI A;  1G74 A;  2FS6 A;  3C76 X;  1IKJ A;  1IFB A;  1N0S A;  3VE2 A;  1QY1 A;  3F6Z B;  1BEB A;  2L9C A;  4IAB A;  2HNX A;  4U8U O;  1G7N A;  1ZRY A;  4D6A A;  2QO6 A;  2HZQ A;  2HZR A;  4IMO A;  3O19 A;  4LZV A;  1OBP A;  2FT9 A;  3P02 A;  1OEK A;  3PH6 A;  2MWH A;  3S26 A;  4EXZ A;  1GT4 A;  5HCE C;  4TQ2 A;  5L8N A;  5LJE A;  4L1N A;  4QYP A;  5EEE A;  4QGV A;  2AL0 X;  5F6B A;  4NW4 A;  1OBU A;  4ZR2 A;  3BSZ E;  4IB6 A;  1JJX A;  1DZM A;  3HOE A;  5FQ7 E;  2AT3 X;  4NNS A;  3RZY A;  4ALB A;  5LJG A;  1E02 A;  1CRB A;  1QFV A;  5F6Z A;  4AZN A;  2L67 A;  5CYB A;  4QGX A;  1KXO A;  1ZNL A;  3U9P C;  4YFR A;  1U18 A;  2W2B A;  4I3D A;  1NP1 A;  4FBR A;  1JJJ A;  5EDB A;  3FR4 A;  1AB0 A;  1X8O A;  1G5W A;  2QMI A;  4IBA A;  4L3R A;  1PBO A;  1QY2 A;  5F1E A;  2HLV A;  5HZ5 A;  3OBL A;  3BDR A;  1HMR A;  1MDC A;  1BRP A;  1KOI A;  4YDB A;  4ZFX A;  1JIW I;  3HWF A;  2OFM X;  5H9N A;  1FEN A;  5HBS A;  1I06 A;  3WJF A;  3HTY A;  2AT5 X;  3D97 A;  2JU3 A;  2KT4 B;  2FWV A;  2BT9 A;  1A2D A;  1ZNH A;  3P6G A;  3NX2 A;  4PJ2 A;  3UEV A;  4ZJ0 A;  3STK A;  4INN A;  4FQB B;  1ICN A;  1SY2 A;  3PH5 A;  1MUP A;  2GTL N;  4M6S A;  3FR5 A;  4AZM A;  2CZU A;  2WSJ A;  3NP1 A;  5D48 A;  2EU7 X;  4WBK A;  5AJC A;  3ELZ A;  4ODD A;  3C78 X;  4ID2 A;  1HMT A;  2AT6 X;  4HPB A;  4Y0Q A;  1YWB A;  4TKJ A;  2CM4 A;  3BLG A;  4QQ1 A;  4YFP A;  1ZNE A;  5LJK A;  3VPJ E;  3FIQ A;  2ZAG A;  1R0U A;  4CV7 A;  1YP7 A;  1GX8 A;  2A0A A;  3CBS A;  1RBP A;  2NP1 A;  1CJ5 A;  4I6S A;  1EI5 A;  4QZU A;  1LIE A;  3NQK A;  1KT3 A;  1JYD A;  2XKL A;  1GT1 A;  1QAB E;  4HPD A;  1U0X A;  2Q39 A;  4BOE A;  3JS1 A;  3QKG A;  4Y0P A;  3UAQ A;  4I95 A;  1H91 A;  3KFI A;  4O3X B;  2FTB A;  4IAW A;  3P24 A;  3VG7 A;  2GC9 A;  4DQ4 A;  5IO5 A;  2XST A;  2FR2 A;  3NX1 A;  4KH8 A;  5IO7 A;  4YKM A;  2KD2 A;  4Y0S A;  3S60 A;  2BLG A;  1IIU A;  5BVQ A;  3FEP A;  3VG4 A;  4GU8 A;  4YGH A;  3V8U A;  2F73 A;  3E3C A;  3PED A;  3EM0 A;  4O49 A;  4HWM A;  1OPA A;  3EMM A;  1PM1 X;  2ASN X;  1BSY A;  1YWC A;  4KCA A;  1JBH A;  3MVF A;  3OD9 A;  5KIC A;  3BS2 A;  3B2K A;  4COT A;  4KII A;  2AT8 X;  1SY3 A;  4OS0 A;  3RBY A;  1KQW A;  2LBV A;  5KID A;  2JU8 A;  1OBQ A;  1SXX A;  2R73 A;  4I9S A;  2X46 A;  4QRL A;  4WHI A;  1SY0 A;  1GX9 A;  1SY1 A;  5FFH A;  1GKA A;  2A2U A;  4Y0R A;  3TGB A;  1XCA A;  1BBP A;  2P8G A;  1TOW A;  2G7B A;  2BHV A;  2Q2M A;  4MVI A;  4YBP A;  1A57 A;  1E5P A;  3IFB A;  3ZQ3 A;  1GKA B;  1MX8 A;  2FLJ A;  1TOU A;  1TW4 A;  4AZQ A;  1YWA A;  2LB6 A;  4XMH A;  4EDE A;  3I17 A;  3TZS A;  4I9R A;  3ZWE A;  2A13 A;  3BY0 A;  2WWP A;  1T68 X;  5AQ6 A;  1O1U A;  3CMP A;  3VG2 A;  3HWG A;  5B29 A;  2CBS A;  2K23 A;  5HZ6 A;  1X8U A;  4YFQ A;  1IW2 A;  1CBQ A;  2OFR X;  3NBX X;  1MX7 A;  1ZNG A;  3D96 A;  4ORR A;  5CE4 A;  4D6B A;  2BS6 A;  1SXY A;  4ZHH A;  3NR3 A;  1X89 A;  2PY1 A;  4ORS A;  2QO5 A;  2L5P A;  3KFF A;  3P6H A;  4TLJ A;  3WOV A;  3FA6 A;  3ZW2 A;  4DQ3 A;  3B2I A;  1A3Y A;  1D3S A;  2HYS A;  4YH0 A;  5BYP A;  3VG6 A;  2ANS A;  4ORY A;  2YMS A;  1EW3 A;  3LHN A;  3UEU A;  1DF3 A;  1FE3 A;  1IFC A;  4UU3 A;  5EED A;  3HWE A;  5B27 A;  3K3L A;  3WJE A;  1HMS A;  4BVM A;  1LKE A;  5L8I A;  1P6P A;  2KTS A;  3MX7 A;  4YGZ A;  3FEL A;  4IB9 A;  1HN2 A;  5HAE A;  3BRN A;  5EPQ A;  1DZJ A;  2A3F X;  1DFV A;  2POA A;  1B0O A;  1BJ7 A;  5JR8 A;  1KGL A;  2L68 A;  1CBR A;  3NQ3 A;  3PP6 A;  4HFO A;  1GGL A;  3ZI8 A;  1E06 A;  2MJI A;  4I3B A;  5HCC C;  1I05 A;  2KW1 A;  1GXA A;  1QWD A;  5F58 A;  3D95 A;  4ORW A;  3WJD A;  3MBT A;  3B2L A;  5FQ6 E;  3FR2 A;  1ZNK A;  1ML7 A;  2R74 A;  1ICM A;  1QG5 A;  1G85 A;  2MHD A;  3F8A A;  4FGI B;  1O8V A;  1QQS A;  4O4O A;  3KZA A;  4OS8 A;  3JQO A;  4LZU A;  1FDQ A;  1IKE A;  1ACD A;  4OMX A;  1VPR A;  4U8U N;  4YBU A;  4ZHD A;  1QFT A;  3FA9 A;  2QOS C;  3PEC A;  3P6F A;  4ZH6 A;  3FEN A;  1I04 A;  1LIC A;  2ALL X;  2LKK A;  2G79 A;  5K06 A;  1YWD A;  1LIF A;  2WR6 A;  2JU7 A;  3VG3 A;  3WJG A;  1NGL A;  2NND A;  2MM3 A;  5H8T A;  2ACP X;  2WQ9 A;  4XMD A;  1ADL A;  1KT4 A;  3L4R A;  3D4R A;  4EFG A;  3BX8 A;  4MIS A;  2RCQ A;  4YCE A;  5EDC A;  3BU1 A;  4OS3 A;  4XMC A;  5HZQ A;  1GM6 A;  4YMY A;  1KT5 A;  3STN A;  4K19 A;  2CBR A;  4GRJ A;  3CQN A;  2F09 A;  4N7D A;  1KT6 A;  1BWY A;  2X8F A;  3T1D A;  3U03 A;  4NYR A;  3JSQ A;  3FYF A;  5H9L A;  4AZR A;  2AMM X;  5EZ2 A;  3ZW0 B;  2LFO A;  2JW1 A;  1S7D A;  1GT5 A;  2QO4 A;  1Y9L A;  5FQ8 E;  1ALB A;  2HMB A;  3TF6 A;  1CBI A;  2RA6 A;  4EEJ A;  1X8N A;  2LA7 A;  4FBV A;  1SXU A;  4QZT A;  2LBA A;  2Q2P A;  4YGG A;  3H3I A;  1QY0 A;  2N93 A;  4QGW A;  3RWX A;  1PEE A;  3FEK A;  1ERB A;  3UEX A;  5FEN A;  1EXS A;  1DV9 A;  3KQ0 A;  3I0A A;  3TGA A;  5HTE A;  2RD7 C;  1RLB E;  4O4S A;  1KZX A;  1Z24 A;  1EUO A;  1FEM A;  4KC8 A;  2GTL M;  2OVS A;  3N91 A;  3P6D A;  1KZW A;  1JV4 A;  5HA1 A;  1S2P A;  1SXW A;  1URE A;  4GDZ A;  3BX7 A;  2GJ5 A;  5D47 A;  4TKH A;  2YG2 A;  3Q6L A;  3EBK A;  5KHP A;  2OZQ A;  1VYF A;  4LKT A;  2WUT A;  4WFV A;  2Q4N A;  1HBP A;  3NAD A;  2QM9 A;  1LIB A;  3ELX A;  1EPB A;  3UEW A;  5LKE A;  3SOT A;  1BRQ A;  4NP1 A;  2AH7 X;  5FAZ A;  1MVG A;  1I4U A;  2Q9S A;  3CWK A;  3S5X A;  1LF7 A;  4O3W A;  3TGC A;  5HZ9 A;  1HBQ A;  1B8E A;  4YCH A;  2A2G A;  4ZCB A;  4MVE A;  1AVG I;  5HA0 A;  3RSW A;  3CR6 A;  1DZK A;  3NPO A;  3U0D A;  1GT3 A;  3OJY C;  3WVM A;  3APX A;  4O4U A;  1B4M A;  2O62 A;  1CBS A;  1T8V A;  1HQP A;  1D2U A;  2KTD A;  2GTL O;  5HWZ A;  1BM5 A;  3O22 A;  2FR3 A;  3KFH A;  3O2Y A;  1LPJ A;  4XMF A;  5HCD C;  4EQA C;  3PQU A;  3KFG A;  4R0B A;  3SAO A;  4ES7 A;  4GET A;  4GKC A;  4IMN A;  3RKG A;  1AQB A;  4GNY A;  4NYQ A;  4O4X A;  1O1V A;  1LNM A;  1TVQ A;  3WJB A;  3P6E A;  1KQX A;  4LQZ A;  4IB7 A;  4KC7 A;  2FS7 A;  2GTF X;  1DZP A;  2X8T A;  4ZHF A;  1OPB A;  2ACO A;  4MIR A;  4GK9 A;  4GNW A;  4NLJ A;  4ZH9 A;  3AKM A;  2JMB A;  5C0N A;  1X71 A;  5D45 A;  1FEL A;  1VYG A;  1YP6 A;  3P6C A;  1KT7 A;  3F9D A;  3HK1 A;  3VE1 A;  3WXQ A;  1YUP A;  1B56 A;  3GE2 A;  1U17 A;  4ALO A;  1EQD A;  2OVD A;  4PSQ A;  4AZP A;  1TXL A;  1BLR A;  4ZHG A;  2MO5 A;  1JYJ A;  4ORX A;  2X45 A;  1SA8 A;  4UU2 A;  1EPA A;  2RQ0 A;  5LJD A;  4O3Y A;  5AJB A;  4CSB A;  1OEE A;  4HPA A;  5HTD A;  1ZND A;  5IO6 A;  1X8Q A;  4BQU A;  4N7C A;  1A18 A;  1SMP I;  4NNT A;  2JN3 A;  4WFU A;  4TJZ A;  2RCT A;  1JZU A;  3FA8 A;  4CK4 A;  1S44 A;  4YDA A;  2WEW A;  5D8J A;  3FMZ A;  5LJC A;  4GE1 A;  1E00 A;  2DM5 A;  2G78 A;  4JGL A;  3FW4 A;  4LKP A;  4TKB A;  5HZ8 A;  1EIO A;  2WEX A;  4ARH A;  4AZO A;  3GAQ A;  3DTQ A;  5H9A A;  4XME A;  5BVS A;  1UZ2 X;  4QYN A;  4YKO A;  4HPC A;  1AEL A;  5LKF A;  2X8S A;  4A1Y A;  5AEO A;  3STM X;  4FBO A;  3VG5 A;  3ZW0 A;  2NNE A;  2AKQ A;  5DPQ A;  3ZZV A;  1LFO A;  3EYC A;  5LJB A;  1LID A;  2FRS A;  3EBW A;  4ORU A;  1EAL A;  4ZHC A;  1PMP A;  2JOZ A;  3NQ9 A;  3S5V A;  4GH7 A;  3LV4 A;  1T0V A;  2W2F A;  3ZW1 A;  2WQA E;  1BSO A;  2CZT A;  3HOL A;  4QAE A;  4TNN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...