4FH0A

Crystal structure of human bincard card, double mutant f16m/l66m semet form
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
95
structure length
95
Chain Sequence
QTYCDRLVQDTPMLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLMSHLQRSGERDCQEFYRALYIHAQPLHSRLPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the caspase recruitment domain of BinCARD reveals that all three cysteines can be oxidized.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Bcl10-interacting CARD protein
total genus 33
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4fh0A00
2N83A 4O9LA 1Z6TA 1YGOA 2MPCA 4NQKA 4I16A 1E3YA 4A2QA 2YU0A 2OF5H 2YQFA 1CY5A 2KM6A 1E41A 2A9IA 4O7QA 2N80A 4N1LA 2DBGA 4RHWE 2N1FA 1PN5A 2OF5A 2DBHA 3J6JA 2N00A 4M9SA 2G7RA 1A1WA 2M5VA 4P4HA 4O6XA 4ZBWA 1DDFA 2L9MA 1FADA 2YVIA 4UZ0A 3MOPK 3MOPA 1D2ZA 1ICHA 1CWWA 2VGQA 2YGSA 2L6AA 4E9MA 2DO9A 2O71A 2B1WA 4DWNA 4F44A 1WH4A 3CL3A 2LS7A 4JQWA 4M9ZA 2HM2Q 2DBDA 3EZQB 4LWDA 2NSNA 3CRDA 4IZAB 4M9XA 3YGSP 2LWEA 4EWIA 4N1JA 2MS7A 4P4HI 4QOBA 4FH0A 2A5YB 4D8OA 2MS8A 4N1KA 3T6PA 1C15A 3YGSC 2D96A 3EZQA 2IB1A 1DGNA 1UCPA 1WXPA 2KN6A 2DBFA 1D2ZB 3QF2A 4IZ7B 2MB9A 2NAQA 2NZ7A 3J63A 2P1HA 4RHWA 1A1ZA 3MOPG 1WMGA 3KATA 2F1SA 4O9FA 2N7ZA 4F42A 2BBZA 4A2WA 4IZ5E 2N97A 2MN4A 3LQRA 1N3KA 1NGRA 2BBRA 4JUPA 2GF5A 2LWDA 3LQQA
chains in the Genus database with same CATH superfamily
2N83A 4O9LA 1Z6TA 1YGOA 2MPCA 4NQKA 4I16A 1E3YA 4A2QA 2YU0A 2OF5H 2YQFA 1CY5A 2KM6A 1E41A 2A9IA 4O7QA 2N80A 4N1LA 2DBGA 4RHWE 2N1FA 1PN5A 2OF5A 2DBHA 3J6JA 2N00A 4M9SA 2G7RA 1A1WA 2M5VA 4P4HA 4O6XA 4ZBWA 1DDFA 2L9MA 2MJMA 1FADA 2YVIA 4UZ0A 3MOPK 3MOPA 1D2ZA 1ICHA 1CWWA 2VGQA 2YGSA 2L6AA 4E9MA 2DO9A 2O71A 2B1WA 4DWNA 4F44A 1WH4A 3CL3A 2LS7A 4JQWA 4M9ZA 2HM2Q 2DBDA 3EZQB 4LWDA 2NSNA 3CRDA 4IZAB 4M9XA 3YGSP 2LWEA 4EWIA 4N1JA 2MS7A 4P4HI 4QOBA 4FH0A 2A5YB 4D8OA 2MS8A 4N1KA 3T6PA 1C15A 3YGSC 2D96A 3EZQA 2IB1A 1DGNA 1UCPA 1WXPA 2KN6A 2DBFA 1D2ZB 3QF2A 4IZ7B 2MB9A 2NAQA 2NZ7A 3J63A 2P1HA 4RHWA 1A1ZA 3MOPG 1WMGA 3KATA 2F1SA 4O9FA 2N7ZA 4F42A 2BBZA 4A2WA 4IZ5E 2N97A 2MN4A 3LQRA 1N3KA 2XV9A 1NGRA 2BBRA 4JUPA 2GF5A 2LWDA 3LQQA
chains in the Genus database with same CATH topology
2N83A 4O9LA 1Z6TA 1YGOA 2MPCA 4NQKA 4I16A 1E3YA 4A2QA 2YU0A 2OF5H 2YQFA 1CY5A 2KM6A 1E41A 2A9IA 4O7QA 2N80A 4N1LA 2DBGA 4RHWE 2N1FA 1PN5A 2OF5A 2DBHA 3J6JA 2N00A 4M9SA 2G7RA 1A1WA 2M5VA 4P4HA 4O6XA 4ZBWA 1DDFA 2L9MA 2MJMA 1FADA 2YVIA 4UZ0A 3MOPK 3MOPA 1D2ZA 1ICHA 1CWWA 2VGQA 2YGSA 2L6AA 4E9MA 2DO9A 2O71A 2B1WA 4DWNA 4F44A 1WH4A 3CL3A 2LS7A 4JQWA 4M9ZA 2HM2Q 2DBDA 3EZQB 4LWDA 2NSNA 3CRDA 4IZAB 4M9XA 3YGSP 2LWEA 4EWIA 4N1JA 2MS7A 4P4HI 4QOBA 4FH0A 2A5YB 4D8OA 2MS8A 4N1KA 3T6PA 1C15A 3YGSC 2D96A 3EZQA 2IB1A 1DGNA 1UCPA 1WXPA 2KN6A 2DBFA 1D2ZB 3QF2A 4IZ7B 2MB9A 2NAQA 2NZ7A 3J63A 2P1HA 4RHWA 1A1ZA 3MOPG 1WMGA 3KATA 2F1SA 4O9FA 2N7ZA 4F42A 2BBZA 4A2WA 4IZ5E 2N97A 2MN4A 3LQRA 1N3KA 2XV9A 1NGRA 2BBRA 4JUPA 2GF5A 2LWDA 3LQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N83 A;  4O9L A;  1Z6T A;  1YGO A;  2MPC A;  4NQK A;  4I16 A;  1E3Y A;  4A2Q A;  2YU0 A;  2OF5 H;  2YQF A;  1CY5 A;  2KM6 A;  1E41 A;  2A9I A;  4O7Q A;  2N80 A;  4N1L A;  2DBG A;  4RHW E;  2N1F A;  1PN5 A;  2OF5 A;  2DBH A;  3J6J A;  2N00 A;  4M9S A;  2G7R A;  1A1W A;  2M5V A;  4P4H A;  4O6X A;  4ZBW A;  1DDF A;  2L9M A;  1FAD A;  2YVI A;  4UZ0 A;  3MOP K;  3MOP A;  1D2Z A;  1ICH A;  1CWW A;  2VGQ A;  2YGS A;  2L6A A;  4E9M A;  2DO9 A;  2O71 A;  2B1W A;  4DWN A;  4F44 A;  1WH4 A;  3CL3 A;  2LS7 A;  4JQW A;  4M9Z A;  2HM2 Q;  2DBD A;  3EZQ B;  4LWD A;  2NSN A;  3CRD A;  4IZA B;  4M9X A;  3YGS P;  2LWE A;  4EWI A;  4N1J A;  2MS7 A;  4P4H I;  4QOB A;  4FH0 A;  2A5Y B;  4D8O A;  2MS8 A;  4N1K A;  3T6P A;  1C15 A;  3YGS C;  2D96 A;  3EZQ A;  2IB1 A;  1DGN A;  1UCP A;  1WXP A;  2KN6 A;  2DBF A;  1D2Z B;  3QF2 A;  4IZ7 B;  2MB9 A;  2NAQ A;  2NZ7 A;  3J63 A;  2P1H A;  4RHW A;  1A1Z A;  3MOP G;  1WMG A;  3KAT A;  2F1S A;  4O9F A;  2N7Z A;  4F42 A;  2BBZ A;  4A2W A;  4IZ5 E;  2N97 A;  2MN4 A;  3LQR A;  1N3K A;  1NGR A;  2BBR A;  4JUP A;  2GF5 A;  2LWD A;  3LQQ A; 
#chains in the Genus database with same CATH topology
 2N83 A;  4O9L A;  1Z6T A;  1YGO A;  2MPC A;  4NQK A;  4I16 A;  1E3Y A;  4A2Q A;  2YU0 A;  2OF5 H;  2YQF A;  1CY5 A;  2KM6 A;  1E41 A;  2A9I A;  4O7Q A;  2N80 A;  4N1L A;  2DBG A;  4RHW E;  2N1F A;  1PN5 A;  2OF5 A;  2DBH A;  3J6J A;  2N00 A;  4M9S A;  2G7R A;  1A1W A;  2M5V A;  4P4H A;  4O6X A;  4ZBW A;  1DDF A;  2L9M A;  2MJM A;  1FAD A;  2YVI A;  4UZ0 A;  3MOP K;  3MOP A;  1D2Z A;  1ICH A;  1CWW A;  2VGQ A;  2YGS A;  2L6A A;  4E9M A;  2DO9 A;  2O71 A;  2B1W A;  4DWN A;  4F44 A;  1WH4 A;  3CL3 A;  2LS7 A;  4JQW A;  4M9Z A;  2HM2 Q;  2DBD A;  3EZQ B;  4LWD A;  2NSN A;  3CRD A;  4IZA B;  4M9X A;  3YGS P;  2LWE A;  4EWI A;  4N1J A;  2MS7 A;  4P4H I;  4QOB A;  4FH0 A;  2A5Y B;  4D8O A;  2MS8 A;  4N1K A;  3T6P A;  1C15 A;  3YGS C;  2D96 A;  3EZQ A;  2IB1 A;  1DGN A;  1UCP A;  1WXP A;  2KN6 A;  2DBF A;  1D2Z B;  3QF2 A;  4IZ7 B;  2MB9 A;  2NAQ A;  2NZ7 A;  3J63 A;  2P1H A;  4RHW A;  1A1Z A;  3MOP G;  1WMG A;  3KAT A;  2F1S A;  4O9F A;  2N7Z A;  4F42 A;  2BBZ A;  4A2W A;  4IZ5 E;  2N97 A;  2MN4 A;  3LQR A;  1N3K A;  2XV9 A;  1NGR A;  2BBR A;  4JUP A;  2GF5 A;  2LWD A;  3LQQ A; 
#chains in the Genus database with same CATH homology
 2N83 A;  4O9L A;  1Z6T A;  1YGO A;  2MPC A;  4NQK A;  4I16 A;  1E3Y A;  4A2Q A;  2YU0 A;  2OF5 H;  2YQF A;  1CY5 A;  2KM6 A;  1E41 A;  2A9I A;  4O7Q A;  2N80 A;  4N1L A;  2DBG A;  4RHW E;  2N1F A;  1PN5 A;  2OF5 A;  2DBH A;  3J6J A;  2N00 A;  4M9S A;  2G7R A;  1A1W A;  2M5V A;  4P4H A;  4O6X A;  4ZBW A;  1DDF A;  2L9M A;  2MJM A;  1FAD A;  2YVI A;  4UZ0 A;  3MOP K;  3MOP A;  1D2Z A;  1ICH A;  1CWW A;  2VGQ A;  2YGS A;  2L6A A;  4E9M A;  2DO9 A;  2O71 A;  2B1W A;  4DWN A;  4F44 A;  1WH4 A;  3CL3 A;  2LS7 A;  4JQW A;  4M9Z A;  2HM2 Q;  2DBD A;  3EZQ B;  4LWD A;  2NSN A;  3CRD A;  4IZA B;  4M9X A;  3YGS P;  2LWE A;  4EWI A;  4N1J A;  2MS7 A;  4P4H I;  4QOB A;  4FH0 A;  2A5Y B;  4D8O A;  2MS8 A;  4N1K A;  3T6P A;  1C15 A;  3YGS C;  2D96 A;  3EZQ A;  2IB1 A;  1DGN A;  1UCP A;  1WXP A;  2KN6 A;  2DBF A;  1D2Z B;  3QF2 A;  4IZ7 B;  2MB9 A;  2NAQ A;  2NZ7 A;  3J63 A;  2P1H A;  4RHW A;  1A1Z A;  3MOP G;  1WMG A;  3KAT A;  2F1S A;  4O9F A;  2N7Z A;  4F42 A;  2BBZ A;  4A2W A;  4IZ5 E;  2N97 A;  2MN4 A;  3LQR A;  1N3K A;  2XV9 A;  1NGR A;  2BBR A;  4JUP A;  2GF5 A;  2LWD A;  3LQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...