4FH0A

Crystal structure of human bincard card, double mutant f16m/l66m semet form
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
95
structure length
95
Chain Sequence
QTYCDRLVQDTPMLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLMSHLQRSGERDCQEFYRALYIHAQPLHSRLPSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of the caspase recruitment domain of BinCARD reveals that all three cysteines can be oxidized.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Bcl10-interacting CARD protein
total genus 33
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 4fh0A00
2BBRA 2N00A 2N83A 4O9LA 4RHWE 4LWDA 4F42A 2L6AA 1NGRA 4I16A 4RHWA 1DGNA 2GF5A 2M5VA 3MOPK 4P4HA 2P1HA 3LQRA 4EWIA 3CRDA 1CWWA 4F44A 4IZ7B 2N80A 4P4HI 2YQFA 4M9ZA 4O9FA 4QOBA 2IB1A 4IZ5E 2N1FA 3YGSP 4N1KA 2NZ7A 2A5YB 4FH0A 4UZ0A 4A2QA 2DO9A 2LWDA 3MOPG 2KN6A 4O6XA 4IZAB 1D2ZB 3QF2A 3EZQB 2N97A 3KATA 4JUPA 1N3KA 4ZBWA 2KM6A 4NQKA 1YGOA 2N7ZA 2F1SA 1WXPA 2D96A 4D8OA 1E3YA 1A1ZA 3J63A 4E9MA 2HM2Q 2NSNA 4JQWA 4A2WA 1CY5A 2G7RA 2LWEA 2DBGA 2DBFA 2MS8A 2YGSA 2YVIA 1C15A 1UCPA 3T6PA 1Z6TA 2MB9A 3LQQA 3EZQA 1DDFA 4O7QA 2YU0A 2BBZA 1A1WA 2MPCA 3J6JA 2DBDA 4N1LA 2VGQA 2L9MA 2OF5A 2MS7A 1PN5A 2OF5H 2O71A 3CL3A 4N1JA 1WH4A 3YGSC 4M9SA 1D2ZA 4M9XA 4DWNA 2MN4A 1WMGA 1E41A 3MOPA 2DBHA 1FADA 2NAQA 2LS7A 2B1WA 2A9IA 1ICHA
chains in the Genus database with same CATH superfamily
2BBRA 2N00A 2N83A 4O9LA 4RHWE 4LWDA 4F42A 2L6AA 1NGRA 4I16A 4RHWA 1DGNA 2GF5A 2M5VA 3MOPK 4P4HA 2P1HA 3LQRA 4EWIA 3CRDA 1CWWA 4F44A 4IZ7B 2N80A 4P4HI 2YQFA 4M9ZA 4O9FA 4QOBA 2IB1A 4IZ5E 2N1FA 3YGSP 4N1KA 2NZ7A 2A5YB 4FH0A 4UZ0A 2MJMA 4A2QA 2DO9A 2LWDA 3MOPG 2KN6A 4O6XA 4IZAB 1D2ZB 3QF2A 3EZQB 2N97A 3KATA 4JUPA 1N3KA 4ZBWA 2KM6A 4NQKA 1YGOA 2N7ZA 2F1SA 1WXPA 2D96A 4D8OA 1E3YA 1A1ZA 3J63A 4E9MA 2HM2Q 2NSNA 4JQWA 4A2WA 1CY5A 2G7RA 2LWEA 2DBGA 2DBFA 2MS8A 2YGSA 2YVIA 1C15A 1UCPA 3T6PA 1Z6TA 2MB9A 3LQQA 3EZQA 1DDFA 4O7QA 2YU0A 2BBZA 1A1WA 2MPCA 3J6JA 2DBDA 4N1LA 2VGQA 2L9MA 2OF5A 2MS7A 1PN5A 2OF5H 2O71A 3CL3A 4N1JA 1WH4A 3YGSC 4M9SA 1D2ZA 4M9XA 4DWNA 2MN4A 1WMGA 1E41A 3MOPA 2XV9A 2DBHA 1FADA 2NAQA 2LS7A 2B1WA 2A9IA 1ICHA
chains in the Genus database with same CATH topology
2BBRA 2N00A 2N83A 4O9LA 4RHWE 4LWDA 4F42A 2L6AA 1NGRA 4I16A 4RHWA 1DGNA 2GF5A 2M5VA 3MOPK 4P4HA 2P1HA 3LQRA 4EWIA 3CRDA 1CWWA 4F44A 4IZ7B 2N80A 4P4HI 2YQFA 4M9ZA 4O9FA 4QOBA 2IB1A 4IZ5E 2N1FA 3YGSP 4N1KA 2NZ7A 2A5YB 4FH0A 4UZ0A 2MJMA 4A2QA 2DO9A 2LWDA 3MOPG 2KN6A 4O6XA 4IZAB 1D2ZB 3QF2A 3EZQB 2N97A 3KATA 4JUPA 1N3KA 4ZBWA 2KM6A 4NQKA 1YGOA 2N7ZA 2F1SA 1WXPA 2D96A 4D8OA 1E3YA 1A1ZA 3J63A 4E9MA 2HM2Q 2NSNA 4JQWA 4A2WA 1CY5A 2G7RA 2LWEA 2DBGA 2DBFA 2MS8A 2YGSA 2YVIA 1C15A 1UCPA 3T6PA 1Z6TA 2MB9A 3LQQA 3EZQA 1DDFA 4O7QA 2YU0A 2BBZA 1A1WA 2MPCA 3J6JA 2DBDA 4N1LA 2VGQA 2L9MA 2OF5A 2MS7A 1PN5A 2OF5H 2O71A 3CL3A 4N1JA 1WH4A 3YGSC 4M9SA 1D2ZA 4M9XA 4DWNA 2MN4A 1WMGA 1E41A 3MOPA 2XV9A 2DBHA 1FADA 2NAQA 2LS7A 2B1WA 2A9IA 1ICHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBR A;  2N00 A;  2N83 A;  4O9L A;  4RHW E;  4LWD A;  4F42 A;  2L6A A;  1NGR A;  4I16 A;  4RHW A;  1DGN A;  2GF5 A;  2M5V A;  3MOP K;  4P4H A;  2P1H A;  3LQR A;  4EWI A;  3CRD A;  1CWW A;  4F44 A;  4IZ7 B;  2N80 A;  4P4H I;  2YQF A;  4M9Z A;  4O9F A;  4QOB A;  2IB1 A;  4IZ5 E;  2N1F A;  3YGS P;  4N1K A;  2NZ7 A;  2A5Y B;  4FH0 A;  4UZ0 A;  4A2Q A;  2DO9 A;  2LWD A;  3MOP G;  2KN6 A;  4O6X A;  4IZA B;  1D2Z B;  3QF2 A;  3EZQ B;  2N97 A;  3KAT A;  4JUP A;  1N3K A;  4ZBW A;  2KM6 A;  4NQK A;  1YGO A;  2N7Z A;  2F1S A;  1WXP A;  2D96 A;  4D8O A;  1E3Y A;  1A1Z A;  3J63 A;  4E9M A;  2HM2 Q;  2NSN A;  4JQW A;  4A2W A;  1CY5 A;  2G7R A;  2LWE A;  2DBG A;  2DBF A;  2MS8 A;  2YGS A;  2YVI A;  1C15 A;  1UCP A;  3T6P A;  1Z6T A;  2MB9 A;  3LQQ A;  3EZQ A;  1DDF A;  4O7Q A;  2YU0 A;  2BBZ A;  1A1W A;  2MPC A;  3J6J A;  2DBD A;  4N1L A;  2VGQ A;  2L9M A;  2OF5 A;  2MS7 A;  1PN5 A;  2OF5 H;  2O71 A;  3CL3 A;  4N1J A;  1WH4 A;  3YGS C;  4M9S A;  1D2Z A;  4M9X A;  4DWN A;  2MN4 A;  1WMG A;  1E41 A;  3MOP A;  2DBH A;  1FAD A;  2NAQ A;  2LS7 A;  2B1W A;  2A9I A;  1ICH A; 
#chains in the Genus database with same CATH topology
 2BBR A;  2N00 A;  2N83 A;  4O9L A;  4RHW E;  4LWD A;  4F42 A;  2L6A A;  1NGR A;  4I16 A;  4RHW A;  1DGN A;  2GF5 A;  2M5V A;  3MOP K;  4P4H A;  2P1H A;  3LQR A;  4EWI A;  3CRD A;  1CWW A;  4F44 A;  4IZ7 B;  2N80 A;  4P4H I;  2YQF A;  4M9Z A;  4O9F A;  4QOB A;  2IB1 A;  4IZ5 E;  2N1F A;  3YGS P;  4N1K A;  2NZ7 A;  2A5Y B;  4FH0 A;  4UZ0 A;  2MJM A;  4A2Q A;  2DO9 A;  2LWD A;  3MOP G;  2KN6 A;  4O6X A;  4IZA B;  1D2Z B;  3QF2 A;  3EZQ B;  2N97 A;  3KAT A;  4JUP A;  1N3K A;  4ZBW A;  2KM6 A;  4NQK A;  1YGO A;  2N7Z A;  2F1S A;  1WXP A;  2D96 A;  4D8O A;  1E3Y A;  1A1Z A;  3J63 A;  4E9M A;  2HM2 Q;  2NSN A;  4JQW A;  4A2W A;  1CY5 A;  2G7R A;  2LWE A;  2DBG A;  2DBF A;  2MS8 A;  2YGS A;  2YVI A;  1C15 A;  1UCP A;  3T6P A;  1Z6T A;  2MB9 A;  3LQQ A;  3EZQ A;  1DDF A;  4O7Q A;  2YU0 A;  2BBZ A;  1A1W A;  2MPC A;  3J6J A;  2DBD A;  4N1L A;  2VGQ A;  2L9M A;  2OF5 A;  2MS7 A;  1PN5 A;  2OF5 H;  2O71 A;  3CL3 A;  4N1J A;  1WH4 A;  3YGS C;  4M9S A;  1D2Z A;  4M9X A;  4DWN A;  2MN4 A;  1WMG A;  1E41 A;  3MOP A;  2XV9 A;  2DBH A;  1FAD A;  2NAQ A;  2LS7 A;  2B1W A;  2A9I A;  1ICH A; 
#chains in the Genus database with same CATH homology
 2BBR A;  2N00 A;  2N83 A;  4O9L A;  4RHW E;  4LWD A;  4F42 A;  2L6A A;  1NGR A;  4I16 A;  4RHW A;  1DGN A;  2GF5 A;  2M5V A;  3MOP K;  4P4H A;  2P1H A;  3LQR A;  4EWI A;  3CRD A;  1CWW A;  4F44 A;  4IZ7 B;  2N80 A;  4P4H I;  2YQF A;  4M9Z A;  4O9F A;  4QOB A;  2IB1 A;  4IZ5 E;  2N1F A;  3YGS P;  4N1K A;  2NZ7 A;  2A5Y B;  4FH0 A;  4UZ0 A;  2MJM A;  4A2Q A;  2DO9 A;  2LWD A;  3MOP G;  2KN6 A;  4O6X A;  4IZA B;  1D2Z B;  3QF2 A;  3EZQ B;  2N97 A;  3KAT A;  4JUP A;  1N3K A;  4ZBW A;  2KM6 A;  4NQK A;  1YGO A;  2N7Z A;  2F1S A;  1WXP A;  2D96 A;  4D8O A;  1E3Y A;  1A1Z A;  3J63 A;  4E9M A;  2HM2 Q;  2NSN A;  4JQW A;  4A2W A;  1CY5 A;  2G7R A;  2LWE A;  2DBG A;  2DBF A;  2MS8 A;  2YGS A;  2YVI A;  1C15 A;  1UCP A;  3T6P A;  1Z6T A;  2MB9 A;  3LQQ A;  3EZQ A;  1DDF A;  4O7Q A;  2YU0 A;  2BBZ A;  1A1W A;  2MPC A;  3J6J A;  2DBD A;  4N1L A;  2VGQ A;  2L9M A;  2OF5 A;  2MS7 A;  1PN5 A;  2OF5 H;  2O71 A;  3CL3 A;  4N1J A;  1WH4 A;  3YGS C;  4M9S A;  1D2Z A;  4M9X A;  4DWN A;  2MN4 A;  1WMG A;  1E41 A;  3MOP A;  2XV9 A;  2DBH A;  1FAD A;  2NAQ A;  2LS7 A;  2B1W A;  2A9I A;  1ICH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...