4FH5A

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - mgutp bound
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 111
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fh5A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fh5A02
4MFFA 3JPQA 4M9NA 4ATBB 5J2CA 4KLEA 3H3AA 7ICUA 5J29A 1OU5A 1BPZA 4X4PA 9ICHA 9ICSA 9ICPA 4X4QA 3JPTA 1WOTA 4I2CA 4RQ2A 3C2MA 2BCRA 4I2FA 4K4GA 4I27A 1ZQJA 3WFPA 5DBCA 4GXIA 9ICNA 2BE3A 4KLGA 1ZJMA 4M9HA 5DB6A 8ICLA 2ZH6A 2ZH2A 4NKUA 2FMQA 4UBCA 3C5GA 3PMNA 1BPDA 4I2IA 5DKWA 4NXZA 5J0OA 4JWMA 2ZH7A 9ICJA 4JWNA 4PGXA 4FH5A 1ZJNA 3UXNA 5IINA 4MF2A 1ZQPA 2O1PA 5CR0A 2FMSA 1ZQZA 3UPQA 4EBKA 4LT6A 3RJKA 4DOCA 4X4VA 4MFAA 1ZQNA 1ZQRA 1ZQKA 2B4VA 7ICRA 4NKTA 4E80A 5J2HA 5J0PA 4YN4A 4IQTA 4X0BA 4X4NA 4UD5A 4Z6EA 4Z6FA 1TFWA 2O5AA 1JN3A 4RPXA 3RJFA 5J2GA 2ZH9A 5HRKA 4UBBA 3UQ0A 4QZHA 3OUYA 4QZBA 4IQVA 4RQ4A 4AT8B 2HHPA 4DO9A 3OUYB 4YMNA 5DEDA 3HW8A 1R89A 2B56A 2PFNA 5CJ7A 3UXPA 3UQ2A 4WC4A 4YMOA 2DRBA 5IIOA 1JMSA 2PBEA 4YMMA 1RZTA 4NM2A 4XRHA 3H39A 4X4OA 4F5NA 3V72A 4R63A 4QZGA 2ZH8A 5DB8A 1TVAA 9ICVA 4IQUA 4RWPA 3AQNA 2ID1A 3B0XA 1ZQXA 2BCQA 1FA0A 3B0YA 3MDCA 8ICSA 1UEVA 5IIMA 4UD4A 4LZGA 1BPEA 5DDMA 4R64A 4GXJA 3RJJA 4I2AA 8ICYA 4FHVA 2M2VA 3RH4A 5CWRA 5J2KA 2DR5A 7ICOA 4FHYA 3HJ1A 4ATBA 1BPYA 4MFCA 5J2BA 5D49A 1XSLA 5J0SA 2ZHBA 4RWOA 4K4IA 7ICQA 1ZQOA 4O5CA 4PGQA 3RJIA 1JQRA 2M2UA 3H38A 2ZHAA 4RQ5A 4XA5A 1KNYA 4YD1A 4AT9B 8ICOA 1ZQTA 4UB2A 4KLDA 5IIJA 4FH3A 1TFYA 4RQ8A 1ZQWA 4PGYA 4WC0A 5HRHA 4QZFA 4TUQA 8ICWA 7ICIA 8ICIA 4QZEA 5HRLA 3ISBA 4E8FA 7ICTA 3MGIA 8ICEA 1ZQDA 4WBZA 3C2LA 4E7XA 5D46A 4UB4A 4AT7B 9ICXA 3H37A 4WC5A 1ZQLA 4PPXA 1ZQHA 2BPGA 9ICEA 9ICFA 1ZQUA 4I2JA 2W9MA 3WFSC 4UB5A 4K4HA 4LVSA 1MIYA 9ICRA 1HUOA 1JAJA 2B51A 4WC7A 5J0XA 5J0QA 4RWQA 7ICFA 9ICCA 3OVSA 1ZQGA 8ICTA 2M2TA 4RPYA 1R8BA 5HRFA 5DBAA 9ICMA 2ISPA 3V7JA 4NLKA 4F5QA 3AUOA 8ICBA 4P4PA 5EOZA 5J0WA 4M2YA 9ICOA 4NY8A 5IIIA 4RQ0A 2DVIA 1HUZA 2DR8A 4AT8A 5HC9A 1ZQYA 4WC1A 4X4RA 4FHXA 4DOAA 3HX0A 5J0YA 1BPXA 3RJEA 4I2EA 9ICWA 3ISDA 1ZQIA 2M2WA 4PHPA 4TURA 4PHEA 7ICMA 4YD2A 3LK9A 1XSPA 8ICRA 1KDHA 1MQ2A 4Z6DA 5J2AA 2DR7A 4M0AA 3PNCA 3JPOA 4TUSA 3OVBA 5F2VO 4IQWA 4X4UA 4WC3A 4KLJA 4I28A 3AU6A 8ICUA 3AU2A 1V4AA 4QZ8A 4X4TA 4WCWA 4F5RA 4RT3A 4R66A 5HHIA 5IILA 3V7KA 2BPFA 4RQ1A 1R8AA 3WFRE 2DR9A 4F5OA 1ZQFA 3OVAA 1MQ3A 4FO6A 8ICVA 3JPPA 4UB1A 5CB1A 4QZDA 3C18A 4O9MA 1VJ7A 3JPRA 1KEJA 1ZQQA 5DECA 4QZCA 1MIWA 3MBYA 2IHMA 3AQLA 3NYBA 7ICNA 4X0AA 5CP2A 7ICPA 3HJ4A 4KLLA 5DB7A 9ICBA 8ICXA 4UAZA 4M9LA 5J0RA 4AT9A 4UAWA 8ICQA 4QZ9A 9ICGA 4M04A 4KLQA 4KLUA 1BPBA 8ICNA 4RT2A 4S3NA 4GXKA 5HHHA 3C2KA 5HRBA 5J2JA 4X5VA 2PFPA 4RQ3A 2ZH4A 4MF8A 4LZDA 5DDYA 4KLIA 4M5DA 2BCSA 4KLOA 7ICLA 2I9GA 4AT7A 3JYYA 3RJGA 5J2EA 4P4MA 4NLNA 4UB3A 7ICEA 8ICJA 4WBYA 5HREA 3PMLA 2BCUA 9ICUA 2Q66A 1MIVA 5J2FA 1YLQA 4XQ7A 4UAYA 2DRAA 3RH6A 3HIYA 4QZIA 5HRGA 1ZQVA 5TZVA 4XQ8A 4RQ7A 4IG8A 2NRKA 5J0UA 4DOBA 3L9DA 4EBJA 2P66A 4I2HA 5DB9A 4XUSA 5BOMA 2BPCA 5HRIA 3ISCA 4YCXA 3MDAA 5IIKA 3AQMA 5HR9A 4KLMA 8ICGA 7ICSA 5J2DA 2PFQA 1RPLA 3JPSA 5J0TA 4I2DA 4R65A 9ICQA 4RQ6A 9ICAA 1ZQAA 7ICKA 1ZQSA 4KLSA 8ICFA 4PHAA 4I2GA 1Q79A 1ZQBA 2FMPA 1Q78A 1NO5A 5HRDA 8ICAA 4I2BA 8ICZA 4WC6A 3LQCB 4X4SA 7ICGA 7ICVA 4M9JA 1NOMA 1PX5A 4TUPA 9ICTA 9ICLA 1UETA 4O5KA 2ZH1A 4M9GA 2ISOA 8ICKA 4FHPA 5BPCA 4NM1A 3C66A 1XSNA 3OGUA 4KLFA 3RJHA 3UPSA 5CA7A 4QZAA 4Z6CA 3TFRA 3C5FA 4WC2A 1VFGA 2GWSA 4I29A 4O5EA 4NLZA 1F5AA 4PHDA 7ICJA 1ZQEA 2PXIA 1UEUA 9ICIA 2RFFA 2ZH5A 2ZH3A 5BOLA 3UXOA 5CHGA 4KLHA 3OV7A 2VANA 3K75D 4KLTA 8ICCA 8ICMA 7ICHA 3MGHA 4P2HA 8ICHA 3RH5A 4EP7A 5DBBA 4F5PA 1ZQCA 4RPZA 9ICKA 4PH5A 3WFOA 3WFQE 3HWTA 4FHWA 3GDXA 1R8CA 2PFOA 5J2IA 8ICPA 3AQKA 2BCVA 1ZQMA 4RWNA 3V7LA 5D4BA 1TV9A 3JPNA 4M47A 3TFSA 4P4OA 3JZ0A
chains in the Genus database with same CATH superfamily
4MFFA 3JPQA 3ERCC 4M9NA 4ATBB 5J2CA 4KLEA 3H3AA 7ICUA 5J29A 4NXWA 1OU5A 1BPZA 4X4PA 9ICHA 9ICSA 9ICPA 4X4QA 3JPTA 1WOTA 4I2CA 4RQ2A 4HX0A 3C2MA 2BCRA 4I2FA 4K4GA 4I27A 1ZQJA 3WFPA 5DBCA 2BBHA 4GXIA 9ICNA 2BE3A 4KLGA 1ZJMA 4MKPA 4M9HA 5DB6A 8ICLA 2ZH6A 2ZH2A 4NKUA 2FMQA 4UBCA 3C5GA 2BBJA 3PMNA 1BPDA 4I2IA 5DKWA 4NXZA 5J0OA 4JWMA 2ZH7A 9ICJA 4K9AA 4JWNA 4PGXA 4FH5A 1ZJNA 4LEYA 3UXNA 5IINA 4MF2A 1ZQPA 2O1PA 5CR0A 2FMSA 1ZQZA 4EEBA 3UPQA 4EBKA 4LT6A 3RJKA 4DOCA 4X4VA 4MFAA 1ZQNA 1ZQRA 1ZQKA 2B4VA 7ICRA 4NKTA 4E80A 5J2HA 5J0PA 4YN4A 4IQTA 4X0BA 4X4NA 4UD5A 4Z6EA 4Z6FA 1TFWA 2O5AA 1JN3A 4RPXA 3RJFA 5J2GA 2ZH9A 5HRKA 4UBBA 3UQ0A 4QZHA 3OUYA 4QZBA 4IQVA 4NXUA 4RQ4A 4AT8B 2HHPA 4DO9A 3OUYB 4YMNA 5DEDA 3HW8A 1R89A 2B56A 2PFNA 5CJ7A 3UXPA 3CK6A 3UQ2A 4WC4A 4YMOA 5D63A 2DRBA 5IIOA 1JMSA 2PBEA 4YMMA 1RZTA 4X4OA 4XRHA 3H39A 4NM2A 4NXTA 4F5NA 3V72A 4R63A 2ZH8A 4QZGA 5DB8A 1TVAA 9ICVA 4IQUA 4RWPA 3AQNA 2HN1A 2ID1A 3B0XA 5B3PA 3JCFA 2FCLA 1ZQXA 4K9BA 2BCQA 1FA0A 3B0YA 3MDCA 8ICSA 1UEVA 5IIMA 4UD4A 4LZGA 1BPEA 5DDMA 4WOYA 4R64A 4GXJA 3OWGA 3RJJA 4I2AA 8ICYA 4FHVA 2M2VA 4WQKA 3RH4A 5CWRA 5J2KA 2DR5A 7ICOA 4FHYA 3HJ1A 4EV6A 4ATBA 1BPYA 4MFCA 5J2BA 5D49A 1XSLA 5J0SA 2ZHBA 4RWOA 4K4IA 7ICQA 1ZQOA 4O5CA 4PGQA 3RJIA 1JQRA 3EF2A 2M2UA 4I0UA 3H38A 2ZHAA 4RQ5A 4XA5A 1KNYA 4YD1A 4AT9B 8ICOA 4K99A 4UB2A 1ZQTA 4KLDA 5IIJA 4FH3A 1TFYA 4RQ8A 1ZQWA 4PGYA 4WC0A 5HRHA 4QZFA 4TUQA 4O67A 8ICWA 7ICIA 8ICIA 4QZEA 5HRLA 3ISBA 4E8FA 7ICTA 3MGIA 8ICEA 1ZQDA 4WBZA 3C2LA 4E7XA 5D46A 4UB4A 4AT7B 9ICXA 5CFSA 3H37A 4O68A 4WC5A 2GAFD 1ZQLA 4PPXA 1ZQHA 4OAGA 2BPGA 9ICEA 9ICFA 1ZQUA 4I2JA 2W9MA 3WFSC 4UB5A 4K4HA 4LVSA 1MIYA 9ICRA 2IUBA 1HUOA 1JAJA 2B51A 4K8VA 4WC7A 5J0XA 5J0QA 4RWQA 7ICFA 9ICCA 3OVSA 1ZQGA 8ICTA 2M2TA 4RPYA 1R8BA 5HRFA 5DBAA 9ICMA 2ISPA 3V7JA 4NLKA 4F5QA 3AUOA 8ICBA 4P4PA 5EOZA 5J0WA 5D61A 4M2YA 9ICOA 4NY8A 5IIIA 4RQ0A 2DVIA 2DR8A 2GA9D 1HUZA 4AT8A 5HC9A 2EWRA 1ZQYA 4WC1A 4X4RA 4WQLA 4FHXA 4DOAA 3HX0A 5J0YA 1BPXA 3RJEA 4I2EA 9ICWA 3ISDA 1ZQIA 5CFTA 2M2WA 4PHPA 4TURA 4PHEA 7ICMA 4YD2A 3LK9A 1XSPA 8ICRA 1KDHA 1MQ2A 4Z6DA 5J2AA 2DR7A 4M0AA 3PNCA 3JPOA 4TUSA 3OVBA 5F2VO 4IQWA 4X4UA 4WC3A 4KLJA 4I28A 3AU6A 8ICUA 3AU2A 1V4AA 4N7RA 4K98A 1GPJA 4QZ8A 4X4TA 4WCWA 4F5RA 4RT3A 4R66A 5HHIA 5IILA 3V7KA 2BPFA 4RQ1A 1R8AA 3WFRE 2DR9A 4F5OA 1ZQFA 3OVAA 1MQ3A 4FO6A 3ER8C 8ICVA 3JPPA 4UB1A 5CB1A 4QZDA 4OAHA 3C18A 1VJ7A 4O9MA 3JPRA 1KEJA 1ZQQA 5DECA 4QZCA 1MIWA 3MBYA 2IHMA 3AQLA 3PHZA 3NYBA 3MCRA 7ICNA 4X0AA 5CP2A 7ICPA 3HJ4A 5B3QA 4KLLA 5DB7A 9ICBA 4O6AA 4UAZA 4M9LA 8ICXA 5J0RA 4AT9A 4UAWA 8ICQA 4QZ9A 9ICGA 4M04A 4KLQA 4KLUA 1BPBA 3NKUA 4S3NA 4RT2A 8ICNA 4GXKA 5HHHA 3C2KA 5HRBA 5J2JA 4X5VA 2HN2A 2PFPA 2ZH4A 4RQ3A 4MF8A 4LZDA 4KM5A 5DDYA 4KLIA 4M5DA 2BCSA 4KLOA 7ICLA 2I9GA 4LEWA 4AT7A 4O69A 3JYYA 3RJGA 4NXVA 5J2EA 4P4MA 4NLNA 4UB3A 7ICEA 8ICJA 4WBYA 5HREA 3PMLA 2BCUA 5CFUA 3ER9B 9ICUA 2Q66A 1MIVA 5D62A 5J2FA 4XQ7A 1YLQA 4UAYA 2DRAA 3RH6A 3HIYA 4QZIA 5HRGA 1ZQVA 5TZVA 4XQ8A 4RQ7A 4IG8A 2NRKA 5J0UA 4DOBA 3L9DA 4EBJA 2P66A 4I2HA 5DB9A 4WH5A 4XUSA 5JTGA 5BOMA 2BPCA 5HRIA 3ISCA 4YCXA 3MDAA 5IIKA 3AQMA 5HR9A 4KLMA 8ICGA 7ICSA 5J2DA 2PFQA 1RPLA 3JPSA 4JLXA 5J0TA 4I2DA 4KB6A 4R65A 9ICQA 4RQ6A 9ICAA 1ZQAA 7ICKA 1ZQSA 4KLSA 8ICFA 4PHAA 4K97A 4I2GA 1Q79A 1ZQBA 2FMPA 1Q78A 1NO5A 5HRDA 8ICAA 4OAFA 4I2BA 8ICZA 4WC6A 3K7DA 3LQCB 4X4SA 7ICGA 7ICVA 4JLZA 4M9JA 1PX5A 1NOMA 4TUPA 4LEZA 9ICLA 9ICTA 1UETA 4NXXA 4O5KA 2ZH1A 4M9GA 2ISOA 8ICKA 4FHPA 5BPCA 4NM1A 3NWIA 3C66A 4OAIZ 1XSNA 3OGUA 4KLFA 3RJHA 3UPSA 5CA7A 4QZAA 4Z6CA 3TFRA 3C5FA 4WC2A 1VFGA 2GWSA 4K96A 4I29A 4O5EA 4NLZA 1F5AA 4PHDA 4EEDA 7ICJA 1ZQEA 5CHEA 2PXIA 1UEUA 9ICIA 2RFFA 2ZH5A 2ZH3A 5BOLA 3UXOA 5CHGA 4KLHA 3OV7A 2VANA 3K75D 2IHOA 4LEVA 4KLTA 8ICCA 8ICMA 3MGHA 7ICHA 4P2HA 8ICHA 3RH5A 4EGWA 4EP7A 5DBBA 4XJEA 4F5PA 1ZQCA 4RPZA 9ICKA 3NVOA 4PH5A 3WFOA 3WFQE 3HWTA 1R8CA 4FHWA 3GDXA 2PFOA 5J2IA 8ICPA 3AQKA 2BCVA 4RWNA 1ZQMA 3V7LA 4FO1A 5D4BA 1TV9A 3JPNA 4M47A 3TFSA 4P4OA 3JZ0A
chains in the Genus database with same CATH topology
4MFFA 3JPQA 4M9NA 4ATBB 5J2CA 4KLEA 3H3AA 7ICUA 5J29A 4NXWA 1OU5A 1BPZA 4X4PA 9ICHA 9ICSA 9ICPA 4X4QA 3JPTA 1WOTA 4I2CA 4RQ2A 3C2MA 2BCRA 4I2FA 4K4GA 4I27A 1ZQJA 3WFPA 5DBCA 4GXIA 9ICNA 2BE3A 4KLGA 1ZJMA 4MKPA 4M9HA 5DB6A 8ICLA 2ZH6A 2ZH2A 4NKUA 2FMQA 4UBCA 3C5GA 3PMNA 1BPDA 4I2IA 5DKWA 4NXZA 5J0OA 4JWMA 2ZH7A 9ICJA 4K9AA 4JWNA 4PGXA 4FH5A 1ZJNA 4LEYA 3UXNA 5IINA 4MF2A 1ZQPA 2O1PA 5CR0A 2FMSA 1ZQZA 3UPQA 4EBKA 4LT6A 3RJKA 4DOCA 4X4VA 4MFAA 1ZQNA 1ZQRA 1ZQKA 2B4VA 7ICRA 4NKTA 4E80A 5J2HA 5J0PA 4YN4A 4IQTA 4X0BA 4X4NA 4UD5A 4Z6EA 4Z6FA 1TFWA 2O5AA 1JN3A 4RPXA 3RJFA 5J2GA 2ZH9A 5HRKA 4UBBA 3UQ0A 4QZHA 3OUYA 4QZBA 4IQVA 4NXUA 4RQ4A 4AT8B 2HHPA 4DO9A 3OUYB 4YMNA 5DEDA 3HW8A 1R89A 2B56A 2PFNA 5CJ7A 3UXPA 3UQ2A 4WC4A 4YMOA 2DRBA 5IIOA 1JMSA 2PBEA 4YMMA 1RZTA 4X4OA 4XRHA 3H39A 4NM2A 4NXTA 4F5NA 3V72A 4R63A 2ZH8A 4QZGA 5DB8A 1TVAA 9ICVA 4IQUA 4RWPA 3AQNA 2ID1A 3B0XA 1ZQXA 4K9BA 2BCQA 1FA0A 3B0YA 3MDCA 8ICSA 1UEVA 5IIMA 4UD4A 4LZGA 1BPEA 5DDMA 4WOYA 4R64A 4GXJA 3RJJA 4I2AA 8ICYA 4FHVA 2M2VA 3RH4A 5CWRA 5J2KA 2DR5A 7ICOA 4FHYA 3HJ1A 4ATBA 1BPYA 4MFCA 5J2BA 5D49A 1XSLA 5J0SA 2ZHBA 4RWOA 4K4IA 7ICQA 1ZQOA 4O5CA 4PGQA 3RJIA 1JQRA 2M2UA 3H38A 2ZHAA 4RQ5A 4XA5A 1KNYA 4YD1A 4AT9B 8ICOA 4K99A 4UB2A 1ZQTA 4KLDA 5IIJA 4FH3A 1TFYA 4RQ8A 1ZQWA 4PGYA 4WC0A 5HRHA 4QZFA 4TUQA 4O67A 8ICWA 7ICIA 8ICIA 4QZEA 5HRLA 3ISBA 4E8FA 7ICTA 3MGIA 8ICEA 1ZQDA 4WBZA 3C2LA 4E7XA 5D46A 4UB4A 4AT7B 9ICXA 3H37A 4O68A 4WC5A 1ZQLA 4PPXA 1ZQHA 4OAGA 2BPGA 9ICEA 9ICFA 1ZQUA 4I2JA 2W9MA 3WFSC 4UB5A 4K4HA 4LVSA 1MIYA 9ICRA 1HUOA 1JAJA 2B51A 4WC7A 4K8VA 5J0XA 5J0QA 4RWQA 7ICFA 9ICCA 3OVSA 1ZQGA 8ICTA 2M2TA 4RPYA 1R8BA 5HRFA 5DBAA 9ICMA 2ISPA 3V7JA 4NLKA 4F5QA 3AUOA 8ICBA 4P4PA 5EOZA 5J0WA 4M2YA 9ICOA 4NY8A 5IIIA 4RQ0A 2DVIA 2DR8A 1HUZA 4AT8A 5HC9A 1ZQYA 4WC1A 4X4RA 4FHXA 4DOAA 3HX0A 5J0YA 1BPXA 3RJEA 4I2EA 9ICWA 3ISDA 1ZQIA 2M2WA 4PHPA 4TURA 4PHEA 7ICMA 4YD2A 3LK9A 1XSPA 8ICRA 1KDHA 1MQ2A 4Z6DA 5J2AA 2DR7A 4M0AA 3PNCA 3JPOA 4TUSA 3OVBA 5F2VO 4IQWA 4X4UA 4WC3A 4KLJA 4I28A 3AU6A 8ICUA 3AU2A 1V4AA 4K98A 4QZ8A 4X4TA 4WCWA 4F5RA 4RT3A 4R66A 5HHIA 5IILA 3V7KA 2BPFA 4RQ1A 1R8AA 3WFRE 2DR9A 4F5OA 1ZQFA 3OVAA 1MQ3A 4FO6A 8ICVA 3JPPA 4UB1A 5CB1A 4QZDA 4OAHA 3C18A 1VJ7A 4O9MA 3JPRA 1KEJA 1ZQQA 5DECA 4QZCA 1MIWA 3MBYA 2IHMA 3AQLA 3NYBA 7ICNA 4X0AA 5CP2A 7ICPA 3HJ4A 4KLLA 5DB7A 9ICBA 4O6AA 4UAZA 4M9LA 8ICXA 5J0RA 4AT9A 4UAWA 8ICQA 4QZ9A 9ICGA 4M04A 4KLQA 4KLUA 1BPBA 8ICNA 4RT2A 4S3NA 4GXKA 5HHHA 3C2KA 5HRBA 5J2JA 4X5VA 2PFPA 2ZH4A 4RQ3A 4MF8A 4LZDA 4KM5A 5DDYA 4KLIA 4M5DA 2BCSA 4KLOA 7ICLA 2I9GA 4LEWA 4AT7A 4O69A 3JYYA 3RJGA 4NXVA 5J2EA 4P4MA 4NLNA 4UB3A 7ICEA 8ICJA 4WBYA 5HREA 3PMLA 2BCUA 9ICUA 2Q66A 1MIVA 5J2FA 1YLQA 4XQ7A 4UAYA 2DRAA 3RH6A 3HIYA 4QZIA 5HRGA 1ZQVA 5TZVA 4XQ8A 4RQ7A 4IG8A 2NRKA 5J0UA 4DOBA 3L9DA 4EBJA 2P66A 4I2HA 5DB9A 4XUSA 5BOMA 2BPCA 5HRIA 3ISCA 4YCXA 3MDAA 5IIKA 3AQMA 5HR9A 4KLMA 8ICGA 7ICSA 5J2DA 2PFQA 1RPLA 3JPSA 4JLXA 5J0TA 4I2DA 4KB6A 4R65A 9ICQA 4RQ6A 9ICAA 1ZQAA 7ICKA 1ZQSA 4KLSA 8ICFA 4PHAA 4K97A 4I2GA 1Q79A 1ZQBA 2FMPA 1Q78A 1NO5A 5HRDA 8ICAA 4OAFA 4I2BA 8ICZA 4WC6A 3LQCB 4X4SA 7ICGA 7ICVA 4JLZA 4M9JA 1NOMA 1PX5A 4TUPA 4LEZA 9ICLA 9ICTA 1UETA 4NXXA 4O5KA 2ZH1A 4M9GA 2ISOA 8ICKA 4FHPA 5BPCA 4NM1A 3C66A 4OAIZ 1XSNA 3OGUA 4KLFA 3RJHA 3UPSA 5CA7A 4QZAA 4Z6CA 3TFRA 3C5FA 4WC2A 1VFGA 2GWSA 4K96A 4I29A 4O5EA 4NLZA 1F5AA 4PHDA 7ICJA 1ZQEA 2PXIA 1UEUA 9ICIA 2RFFA 2ZH5A 2ZH3A 5BOLA 3UXOA 5CHGA 4KLHA 3OV7A 2VANA 3K75D 4LEVA 4KLTA 8ICCA 8ICMA 3MGHA 7ICHA 4P2HA 8ICHA 3RH5A 4EP7A 5DBBA 4F5PA 1ZQCA 4RPZA 9ICKA 4PH5A 3WFOA 3WFQE 3HWTA 1R8CA 4FHWA 3GDXA 2PFOA 5J2IA 8ICPA 3AQKA 2BCVA 1ZQMA 4RWNA 3V7LA 5D4BA 1TV9A 3JPNA 4M47A 3TFSA 4P4OA 3JZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFF A;  3JPQ A;  4M9N A;  4ATB B;  5J2C A;  4KLE A;  3H3A A;  7ICU A;  5J29 A;  1OU5 A;  1BPZ A;  4X4P A;  9ICH A;  9ICS A;  9ICP A;  4X4Q A;  3JPT A;  1WOT A;  4I2C A;  4RQ2 A;  3C2M A;  2BCR A;  4I2F A;  4K4G A;  4I27 A;  1ZQJ A;  3WFP A;  5DBC A;  4GXI A;  9ICN A;  2BE3 A;  4KLG A;  1ZJM A;  4M9H A;  5DB6 A;  8ICL A;  2ZH6 A;  2ZH2 A;  4NKU A;  2FMQ A;  4UBC A;  3C5G A;  3PMN A;  1BPD A;  4I2I A;  5DKW A;  4NXZ A;  5J0O A;  4JWM A;  2ZH7 A;  9ICJ A;  4JWN A;  4PGX A;  4FH5 A;  1ZJN A;  3UXN A;  5IIN A;  4MF2 A;  1ZQP A;  2O1P A;  5CR0 A;  2FMS A;  1ZQZ A;  3UPQ A;  4EBK A;  4LT6 A;  3RJK A;  4DOC A;  4X4V A;  4MFA A;  1ZQN A;  1ZQR A;  1ZQK A;  2B4V A;  7ICR A;  4NKT A;  4E80 A;  5J2H A;  5J0P A;  4YN4 A;  4IQT A;  4X0B A;  4X4N A;  4UD5 A;  4Z6E A;  4Z6F A;  1TFW A;  2O5A A;  1JN3 A;  4RPX A;  3RJF A;  5J2G A;  2ZH9 A;  5HRK A;  4UBB A;  3UQ0 A;  4QZH A;  3OUY A;  4QZB A;  4IQV A;  4RQ4 A;  4AT8 B;  2HHP A;  4DO9 A;  3OUY B;  4YMN A;  5DED A;  3HW8 A;  1R89 A;  2B56 A;  2PFN A;  5CJ7 A;  3UXP A;  3UQ2 A;  4WC4 A;  4YMO A;  2DRB A;  5IIO A;  1JMS A;  2PBE A;  4YMM A;  1RZT A;  4NM2 A;  4XRH A;  3H39 A;  4X4O A;  4F5N A;  3V72 A;  4R63 A;  4QZG A;  2ZH8 A;  5DB8 A;  1TVA A;  9ICV A;  4IQU A;  4RWP A;  3AQN A;  2ID1 A;  3B0X A;  1ZQX A;  2BCQ A;  1FA0 A;  3B0Y A;  3MDC A;  8ICS A;  1UEV A;  5IIM A;  4UD4 A;  4LZG A;  1BPE A;  5DDM A;  4R64 A;  4GXJ A;  3RJJ A;  4I2A A;  8ICY A;  4FHV A;  2M2V A;  3RH4 A;  5CWR A;  5J2K A;  2DR5 A;  7ICO A;  4FHY A;  3HJ1 A;  4ATB A;  1BPY A;  4MFC A;  5J2B A;  5D49 A;  1XSL A;  5J0S A;  2ZHB A;  4RWO A;  4K4I A;  7ICQ A;  1ZQO A;  4O5C A;  4PGQ A;  3RJI A;  1JQR A;  2M2U A;  3H38 A;  2ZHA A;  4RQ5 A;  4XA5 A;  1KNY A;  4YD1 A;  4AT9 B;  8ICO A;  1ZQT A;  4UB2 A;  4KLD A;  5IIJ A;  4FH3 A;  1TFY A;  4RQ8 A;  1ZQW A;  4PGY A;  4WC0 A;  5HRH A;  4QZF A;  4TUQ A;  8ICW A;  7ICI A;  8ICI A;  4QZE A;  5HRL A;  3ISB A;  4E8F A;  7ICT A;  3MGI A;  8ICE A;  1ZQD A;  4WBZ A;  3C2L A;  4E7X A;  5D46 A;  4UB4 A;  4AT7 B;  9ICX A;  3H37 A;  4WC5 A;  1ZQL A;  4PPX A;  1ZQH A;  2BPG A;  9ICE A;  9ICF A;  1ZQU A;  4I2J A;  2W9M A;  3WFS C;  4UB5 A;  4K4H A;  4LVS A;  1MIY A;  9ICR A;  1HUO A;  1JAJ A;  2B51 A;  4WC7 A;  5J0X A;  5J0Q A;  4RWQ A;  7ICF A;  9ICC A;  3OVS A;  1ZQG A;  8ICT A;  2M2T A;  4RPY A;  1R8B A;  5HRF A;  5DBA A;  9ICM A;  2ISP A;  3V7J A;  4NLK A;  4F5Q A;  3AUO A;  8ICB A;  4P4P A;  5EOZ A;  5J0W A;  4M2Y A;  9ICO A;  4NY8 A;  5III A;  4RQ0 A;  2DVI A;  1HUZ A;  2DR8 A;  4AT8 A;  5HC9 A;  1ZQY A;  4WC1 A;  4X4R A;  4FHX A;  4DOA A;  3HX0 A;  5J0Y A;  1BPX A;  3RJE A;  4I2E A;  9ICW A;  3ISD A;  1ZQI A;  2M2W A;  4PHP A;  4TUR A;  4PHE A;  7ICM A;  4YD2 A;  3LK9 A;  1XSP A;  8ICR A;  1KDH A;  1MQ2 A;  4Z6D A;  5J2A A;  2DR7 A;  4M0A A;  3PNC A;  3JPO A;  4TUS A;  3OVB A;  5F2V O;  4IQW A;  4X4U A;  4WC3 A;  4KLJ A;  4I28 A;  3AU6 A;  8ICU A;  3AU2 A;  1V4A A;  4QZ8 A;  4X4T A;  4WCW A;  4F5R A;  4RT3 A;  4R66 A;  5HHI A;  5IIL A;  3V7K A;  2BPF A;  4RQ1 A;  1R8A A;  3WFR E;  2DR9 A;  4F5O A;  1ZQF A;  3OVA A;  1MQ3 A;  4FO6 A;  8ICV A;  3JPP A;  4UB1 A;  5CB1 A;  4QZD A;  3C18 A;  4O9M A;  1VJ7 A;  3JPR A;  1KEJ A;  1ZQQ A;  5DEC A;  4QZC A;  1MIW A;  3MBY A;  2IHM A;  3AQL A;  3NYB A;  7ICN A;  4X0A A;  5CP2 A;  7ICP A;  3HJ4 A;  4KLL A;  5DB7 A;  9ICB A;  8ICX A;  4UAZ A;  4M9L A;  5J0R A;  4AT9 A;  4UAW A;  8ICQ A;  4QZ9 A;  9ICG A;  4M04 A;  4KLQ A;  4KLU A;  1BPB A;  8ICN A;  4RT2 A;  4S3N A;  4GXK A;  5HHH A;  3C2K A;  5HRB A;  5J2J A;  4X5V A;  2PFP A;  4RQ3 A;  2ZH4 A;  4MF8 A;  4LZD A;  5DDY A;  4KLI A;  4M5D A;  2BCS A;  4KLO A;  7ICL A;  2I9G A;  4AT7 A;  3JYY A;  3RJG A;  5J2E A;  4P4M A;  4NLN A;  4UB3 A;  7ICE A;  8ICJ A;  4WBY A;  5HRE A;  3PML A;  2BCU A;  9ICU A;  2Q66 A;  1MIV A;  5J2F A;  1YLQ A;  4XQ7 A;  4UAY A;  2DRA A;  3RH6 A;  3HIY A;  4QZI A;  5HRG A;  1ZQV A;  5TZV A;  4XQ8 A;  4RQ7 A;  4IG8 A;  2NRK A;  5J0U A;  4DOB A;  3L9D A;  4EBJ A;  2P66 A;  4I2H A;  5DB9 A;  4XUS A;  5BOM A;  2BPC A;  5HRI A;  3ISC A;  4YCX A;  3MDA A;  5IIK A;  3AQM A;  5HR9 A;  4KLM A;  8ICG A;  7ICS A;  5J2D A;  2PFQ A;  1RPL A;  3JPS A;  5J0T A;  4I2D A;  4R65 A;  9ICQ A;  4RQ6 A;  9ICA A;  1ZQA A;  7ICK A;  1ZQS A;  4KLS A;  8ICF A;  4PHA A;  4I2G A;  1Q79 A;  1ZQB A;  2FMP A;  1Q78 A;  1NO5 A;  5HRD A;  8ICA A;  4I2B A;  8ICZ A;  4WC6 A;  3LQC B;  4X4S A;  7ICG A;  7ICV A;  4M9J A;  1NOM A;  1PX5 A;  4TUP A;  9ICT A;  9ICL A;  1UET A;  4O5K A;  2ZH1 A;  4M9G A;  2ISO A;  8ICK A;  4FHP A;  5BPC A;  4NM1 A;  3C66 A;  1XSN A;  3OGU A;  4KLF A;  3RJH A;  3UPS A;  5CA7 A;  4QZA A;  4Z6C A;  3TFR A;  3C5F A;  4WC2 A;  1VFG A;  2GWS A;  4I29 A;  4O5E A;  4NLZ A;  1F5A A;  4PHD A;  7ICJ A;  1ZQE A;  2PXI A;  1UEU A;  9ICI A;  2RFF A;  2ZH5 A;  2ZH3 A;  5BOL A;  3UXO A;  5CHG A;  4KLH A;  3OV7 A;  2VAN A;  3K75 D;  4KLT A;  8ICC A;  8ICM A;  7ICH A;  3MGH A;  4P2H A;  8ICH A;  3RH5 A;  4EP7 A;  5DBB A;  4F5P A;  1ZQC A;  4RPZ A;  9ICK A;  4PH5 A;  3WFO A;  3WFQ E;  3HWT A;  4FHW A;  3GDX A;  1R8C A;  2PFO A;  5J2I A;  8ICP A;  3AQK A;  2BCV A;  1ZQM A;  4RWN A;  3V7L A;  5D4B A;  1TV9 A;  3JPN A;  4M47 A;  3TFS A;  4P4O A;  3JZ0 A; 
#chains in the Genus database with same CATH topology
 4MFF A;  3JPQ A;  3ERC C;  4M9N A;  4ATB B;  5J2C A;  4KLE A;  3H3A A;  7ICU A;  5J29 A;  4NXW A;  1OU5 A;  1BPZ A;  4X4P A;  9ICH A;  9ICS A;  9ICP A;  4X4Q A;  3JPT A;  1WOT A;  4I2C A;  4RQ2 A;  4HX0 A;  3C2M A;  2BCR A;  4I2F A;  4K4G A;  4I27 A;  1ZQJ A;  3WFP A;  5DBC A;  2BBH A;  4GXI A;  9ICN A;  2BE3 A;  4KLG A;  1ZJM A;  4MKP A;  4M9H A;  5DB6 A;  8ICL A;  2ZH6 A;  2ZH2 A;  4NKU A;  2FMQ A;  4UBC A;  3C5G A;  2BBJ A;  3PMN A;  1BPD A;  4I2I A;  5DKW A;  4NXZ A;  5J0O A;  4JWM A;  2ZH7 A;  9ICJ A;  4K9A A;  4JWN A;  4PGX A;  4FH5 A;  1ZJN A;  4LEY A;  3UXN A;  5IIN A;  4MF2 A;  1ZQP A;  2O1P A;  5CR0 A;  2FMS A;  1ZQZ A;  4EEB A;  3UPQ A;  4EBK A;  4LT6 A;  3RJK A;  4DOC A;  4X4V A;  4MFA A;  1ZQN A;  1ZQR A;  1ZQK A;  2B4V A;  7ICR A;  4NKT A;  4E80 A;  5J2H A;  5J0P A;  4YN4 A;  4IQT A;  4X0B A;  4X4N A;  4UD5 A;  4Z6E A;  4Z6F A;  1TFW A;  2O5A A;  1JN3 A;  4RPX A;  3RJF A;  5J2G A;  2ZH9 A;  5HRK A;  4UBB A;  3UQ0 A;  4QZH A;  3OUY A;  4QZB A;  4IQV A;  4NXU A;  4RQ4 A;  4AT8 B;  2HHP A;  4DO9 A;  3OUY B;  4YMN A;  5DED A;  3HW8 A;  1R89 A;  2B56 A;  2PFN A;  5CJ7 A;  3UXP A;  3CK6 A;  3UQ2 A;  4WC4 A;  4YMO A;  5D63 A;  2DRB A;  5IIO A;  1JMS A;  2PBE A;  4YMM A;  1RZT A;  4X4O A;  4XRH A;  3H39 A;  4NM2 A;  4NXT A;  4F5N A;  3V72 A;  4R63 A;  2ZH8 A;  4QZG A;  5DB8 A;  1TVA A;  9ICV A;  4IQU A;  4RWP A;  3AQN A;  2HN1 A;  2ID1 A;  3B0X A;  5B3P A;  3JCF A;  2FCL A;  1ZQX A;  4K9B A;  2BCQ A;  1FA0 A;  3B0Y A;  3MDC A;  8ICS A;  1UEV A;  5IIM A;  4UD4 A;  4LZG A;  1BPE A;  5DDM A;  4WOY A;  4R64 A;  4GXJ A;  3OWG A;  3RJJ A;  4I2A A;  8ICY A;  4FHV A;  2M2V A;  4WQK A;  3RH4 A;  5CWR A;  5J2K A;  2DR5 A;  7ICO A;  4FHY A;  3HJ1 A;  4EV6 A;  4ATB A;  1BPY A;  4MFC A;  5J2B A;  5D49 A;  1XSL A;  5J0S A;  2ZHB A;  4RWO A;  4K4I A;  7ICQ A;  1ZQO A;  4O5C A;  4PGQ A;  3RJI A;  1JQR A;  3EF2 A;  2M2U A;  4I0U A;  3H38 A;  2ZHA A;  4RQ5 A;  4XA5 A;  1KNY A;  4YD1 A;  4AT9 B;  8ICO A;  4K99 A;  4UB2 A;  1ZQT A;  4KLD A;  5IIJ A;  4FH3 A;  1TFY A;  4RQ8 A;  1ZQW A;  4PGY A;  4WC0 A;  5HRH A;  4QZF A;  4TUQ A;  4O67 A;  8ICW A;  7ICI A;  8ICI A;  4QZE A;  5HRL A;  3ISB A;  4E8F A;  7ICT A;  3MGI A;  8ICE A;  1ZQD A;  4WBZ A;  3C2L A;  4E7X A;  5D46 A;  4UB4 A;  4AT7 B;  9ICX A;  5CFS A;  3H37 A;  4O68 A;  4WC5 A;  2GAF D;  1ZQL A;  4PPX A;  1ZQH A;  4OAG A;  2BPG A;  9ICE A;  9ICF A;  1ZQU A;  4I2J A;  2W9M A;  3WFS C;  4UB5 A;  4K4H A;  4LVS A;  1MIY A;  9ICR A;  2IUB A;  1HUO A;  1JAJ A;  2B51 A;  4K8V A;  4WC7 A;  5J0X A;  5J0Q A;  4RWQ A;  7ICF A;  9ICC A;  3OVS A;  1ZQG A;  8ICT A;  2M2T A;  4RPY A;  1R8B A;  5HRF A;  5DBA A;  9ICM A;  2ISP A;  3V7J A;  4NLK A;  4F5Q A;  3AUO A;  8ICB A;  4P4P A;  5EOZ A;  5J0W A;  5D61 A;  4M2Y A;  9ICO A;  4NY8 A;  5III A;  4RQ0 A;  2DVI A;  2DR8 A;  2GA9 D;  1HUZ A;  4AT8 A;  5HC9 A;  2EWR A;  1ZQY A;  4WC1 A;  4X4R A;  4WQL A;  4FHX A;  4DOA A;  3HX0 A;  5J0Y A;  1BPX A;  3RJE A;  4I2E A;  9ICW A;  3ISD A;  1ZQI A;  5CFT A;  2M2W A;  4PHP A;  4TUR A;  4PHE A;  7ICM A;  4YD2 A;  3LK9 A;  1XSP A;  8ICR A;  1KDH A;  1MQ2 A;  4Z6D A;  5J2A A;  2DR7 A;  4M0A A;  3PNC A;  3JPO A;  4TUS A;  3OVB A;  5F2V O;  4IQW A;  4X4U A;  4WC3 A;  4KLJ A;  4I28 A;  3AU6 A;  8ICU A;  3AU2 A;  1V4A A;  4N7R A;  4K98 A;  1GPJ A;  4QZ8 A;  4X4T A;  4WCW A;  4F5R A;  4RT3 A;  4R66 A;  5HHI A;  5IIL A;  3V7K A;  2BPF A;  4RQ1 A;  1R8A A;  3WFR E;  2DR9 A;  4F5O A;  1ZQF A;  3OVA A;  1MQ3 A;  4FO6 A;  3ER8 C;  8ICV A;  3JPP A;  4UB1 A;  5CB1 A;  4QZD A;  4OAH A;  3C18 A;  1VJ7 A;  4O9M A;  3JPR A;  1KEJ A;  1ZQQ A;  5DEC A;  4QZC A;  1MIW A;  3MBY A;  2IHM A;  3AQL A;  3PHZ A;  3NYB A;  3MCR A;  7ICN A;  4X0A A;  5CP2 A;  7ICP A;  3HJ4 A;  5B3Q A;  4KLL A;  5DB7 A;  9ICB A;  4O6A A;  4UAZ A;  4M9L A;  8ICX A;  5J0R A;  4AT9 A;  4UAW A;  8ICQ A;  4QZ9 A;  9ICG A;  4M04 A;  4KLQ A;  4KLU A;  1BPB A;  3NKU A;  4S3N A;  4RT2 A;  8ICN A;  4GXK A;  5HHH A;  3C2K A;  5HRB A;  5J2J A;  4X5V A;  2HN2 A;  2PFP A;  2ZH4 A;  4RQ3 A;  4MF8 A;  4LZD A;  4KM5 A;  5DDY A;  4KLI A;  4M5D A;  2BCS A;  4KLO A;  7ICL A;  2I9G A;  4LEW A;  4AT7 A;  4O69 A;  3JYY A;  3RJG A;  4NXV A;  5J2E A;  4P4M A;  4NLN A;  4UB3 A;  7ICE A;  8ICJ A;  4WBY A;  5HRE A;  3PML A;  2BCU A;  5CFU A;  3ER9 B;  9ICU A;  2Q66 A;  1MIV A;  5D62 A;  5J2F A;  4XQ7 A;  1YLQ A;  4UAY A;  2DRA A;  3RH6 A;  3HIY A;  4QZI A;  5HRG A;  1ZQV A;  5TZV A;  4XQ8 A;  4RQ7 A;  4IG8 A;  2NRK A;  5J0U A;  4DOB A;  3L9D A;  4EBJ A;  2P66 A;  4I2H A;  5DB9 A;  4WH5 A;  4XUS A;  5JTG A;  5BOM A;  2BPC A;  5HRI A;  3ISC A;  4YCX A;  3MDA A;  5IIK A;  3AQM A;  5HR9 A;  4KLM A;  8ICG A;  7ICS A;  5J2D A;  2PFQ A;  1RPL A;  3JPS A;  4JLX A;  5J0T A;  4I2D A;  4KB6 A;  4R65 A;  9ICQ A;  4RQ6 A;  9ICA A;  1ZQA A;  7ICK A;  1ZQS A;  4KLS A;  8ICF A;  4PHA A;  4K97 A;  4I2G A;  1Q79 A;  1ZQB A;  2FMP A;  1Q78 A;  1NO5 A;  5HRD A;  8ICA A;  4OAF A;  4I2B A;  8ICZ A;  4WC6 A;  3K7D A;  3LQC B;  4X4S A;  7ICG A;  7ICV A;  4JLZ A;  4M9J A;  1PX5 A;  1NOM A;  4TUP A;  4LEZ A;  9ICL A;  9ICT A;  1UET A;  4NXX A;  4O5K A;  2ZH1 A;  4M9G A;  2ISO A;  8ICK A;  4FHP A;  5BPC A;  4NM1 A;  3NWI A;  3C66 A;  4OAI Z;  1XSN A;  3OGU A;  4KLF A;  3RJH A;  3UPS A;  5CA7 A;  4QZA A;  4Z6C A;  3TFR A;  3C5F A;  4WC2 A;  1VFG A;  2GWS A;  4K96 A;  4I29 A;  4O5E A;  4NLZ A;  1F5A A;  4PHD A;  4EED A;  7ICJ A;  1ZQE A;  5CHE A;  2PXI A;  1UEU A;  9ICI A;  2RFF A;  2ZH5 A;  2ZH3 A;  5BOL A;  3UXO A;  5CHG A;  4KLH A;  3OV7 A;  2VAN A;  3K75 D;  2IHO A;  4LEV A;  4KLT A;  8ICC A;  8ICM A;  3MGH A;  7ICH A;  4P2H A;  8ICH A;  3RH5 A;  4EGW A;  4EP7 A;  5DBB A;  4XJE A;  4F5P A;  1ZQC A;  4RPZ A;  9ICK A;  3NVO A;  4PH5 A;  3WFO A;  3WFQ E;  3HWT A;  1R8C A;  4FHW A;  3GDX A;  2PFO A;  5J2I A;  8ICP A;  3AQK A;  2BCV A;  4RWN A;  1ZQM A;  3V7L A;  4FO1 A;  5D4B A;  1TV9 A;  3JPN A;  4M47 A;  3TFS A;  4P4O A;  3JZ0 A; 
#chains in the Genus database with same CATH homology
 4MFF A;  3JPQ A;  4M9N A;  4ATB B;  5J2C A;  4KLE A;  3H3A A;  7ICU A;  5J29 A;  4NXW A;  1OU5 A;  1BPZ A;  4X4P A;  9ICH A;  9ICS A;  9ICP A;  4X4Q A;  3JPT A;  1WOT A;  4I2C A;  4RQ2 A;  3C2M A;  2BCR A;  4I2F A;  4K4G A;  4I27 A;  1ZQJ A;  3WFP A;  5DBC A;  4GXI A;  9ICN A;  2BE3 A;  4KLG A;  1ZJM A;  4MKP A;  4M9H A;  5DB6 A;  8ICL A;  2ZH6 A;  2ZH2 A;  4NKU A;  2FMQ A;  4UBC A;  3C5G A;  3PMN A;  1BPD A;  4I2I A;  5DKW A;  4NXZ A;  5J0O A;  4JWM A;  2ZH7 A;  9ICJ A;  4K9A A;  4JWN A;  4PGX A;  4FH5 A;  1ZJN A;  4LEY A;  3UXN A;  5IIN A;  4MF2 A;  1ZQP A;  2O1P A;  5CR0 A;  2FMS A;  1ZQZ A;  3UPQ A;  4EBK A;  4LT6 A;  3RJK A;  4DOC A;  4X4V A;  4MFA A;  1ZQN A;  1ZQR A;  1ZQK A;  2B4V A;  7ICR A;  4NKT A;  4E80 A;  5J2H A;  5J0P A;  4YN4 A;  4IQT A;  4X0B A;  4X4N A;  4UD5 A;  4Z6E A;  4Z6F A;  1TFW A;  2O5A A;  1JN3 A;  4RPX A;  3RJF A;  5J2G A;  2ZH9 A;  5HRK A;  4UBB A;  3UQ0 A;  4QZH A;  3OUY A;  4QZB A;  4IQV A;  4NXU A;  4RQ4 A;  4AT8 B;  2HHP A;  4DO9 A;  3OUY B;  4YMN A;  5DED A;  3HW8 A;  1R89 A;  2B56 A;  2PFN A;  5CJ7 A;  3UXP A;  3UQ2 A;  4WC4 A;  4YMO A;  2DRB A;  5IIO A;  1JMS A;  2PBE A;  4YMM A;  1RZT A;  4X4O A;  4XRH A;  3H39 A;  4NM2 A;  4NXT A;  4F5N A;  3V72 A;  4R63 A;  2ZH8 A;  4QZG A;  5DB8 A;  1TVA A;  9ICV A;  4IQU A;  4RWP A;  3AQN A;  2ID1 A;  3B0X A;  1ZQX A;  4K9B A;  2BCQ A;  1FA0 A;  3B0Y A;  3MDC A;  8ICS A;  1UEV A;  5IIM A;  4UD4 A;  4LZG A;  1BPE A;  5DDM A;  4WOY A;  4R64 A;  4GXJ A;  3RJJ A;  4I2A A;  8ICY A;  4FHV A;  2M2V A;  3RH4 A;  5CWR A;  5J2K A;  2DR5 A;  7ICO A;  4FHY A;  3HJ1 A;  4ATB A;  1BPY A;  4MFC A;  5J2B A;  5D49 A;  1XSL A;  5J0S A;  2ZHB A;  4RWO A;  4K4I A;  7ICQ A;  1ZQO A;  4O5C A;  4PGQ A;  3RJI A;  1JQR A;  2M2U A;  3H38 A;  2ZHA A;  4RQ5 A;  4XA5 A;  1KNY A;  4YD1 A;  4AT9 B;  8ICO A;  4K99 A;  4UB2 A;  1ZQT A;  4KLD A;  5IIJ A;  4FH3 A;  1TFY A;  4RQ8 A;  1ZQW A;  4PGY A;  4WC0 A;  5HRH A;  4QZF A;  4TUQ A;  4O67 A;  8ICW A;  7ICI A;  8ICI A;  4QZE A;  5HRL A;  3ISB A;  4E8F A;  7ICT A;  3MGI A;  8ICE A;  1ZQD A;  4WBZ A;  3C2L A;  4E7X A;  5D46 A;  4UB4 A;  4AT7 B;  9ICX A;  3H37 A;  4O68 A;  4WC5 A;  1ZQL A;  4PPX A;  1ZQH A;  4OAG A;  2BPG A;  9ICE A;  9ICF A;  1ZQU A;  4I2J A;  2W9M A;  3WFS C;  4UB5 A;  4K4H A;  4LVS A;  1MIY A;  9ICR A;  1HUO A;  1JAJ A;  2B51 A;  4WC7 A;  4K8V A;  5J0X A;  5J0Q A;  4RWQ A;  7ICF A;  9ICC A;  3OVS A;  1ZQG A;  8ICT A;  2M2T A;  4RPY A;  1R8B A;  5HRF A;  5DBA A;  9ICM A;  2ISP A;  3V7J A;  4NLK A;  4F5Q A;  3AUO A;  8ICB A;  4P4P A;  5EOZ A;  5J0W A;  4M2Y A;  9ICO A;  4NY8 A;  5III A;  4RQ0 A;  2DVI A;  2DR8 A;  1HUZ A;  4AT8 A;  5HC9 A;  1ZQY A;  4WC1 A;  4X4R A;  4FHX A;  4DOA A;  3HX0 A;  5J0Y A;  1BPX A;  3RJE A;  4I2E A;  9ICW A;  3ISD A;  1ZQI A;  2M2W A;  4PHP A;  4TUR A;  4PHE A;  7ICM A;  4YD2 A;  3LK9 A;  1XSP A;  8ICR A;  1KDH A;  1MQ2 A;  4Z6D A;  5J2A A;  2DR7 A;  4M0A A;  3PNC A;  3JPO A;  4TUS A;  3OVB A;  5F2V O;  4IQW A;  4X4U A;  4WC3 A;  4KLJ A;  4I28 A;  3AU6 A;  8ICU A;  3AU2 A;  1V4A A;  4K98 A;  4QZ8 A;  4X4T A;  4WCW A;  4F5R A;  4RT3 A;  4R66 A;  5HHI A;  5IIL A;  3V7K A;  2BPF A;  4RQ1 A;  1R8A A;  3WFR E;  2DR9 A;  4F5O A;  1ZQF A;  3OVA A;  1MQ3 A;  4FO6 A;  8ICV A;  3JPP A;  4UB1 A;  5CB1 A;  4QZD A;  4OAH A;  3C18 A;  1VJ7 A;  4O9M A;  3JPR A;  1KEJ A;  1ZQQ A;  5DEC A;  4QZC A;  1MIW A;  3MBY A;  2IHM A;  3AQL A;  3NYB A;  7ICN A;  4X0A A;  5CP2 A;  7ICP A;  3HJ4 A;  4KLL A;  5DB7 A;  9ICB A;  4O6A A;  4UAZ A;  4M9L A;  8ICX A;  5J0R A;  4AT9 A;  4UAW A;  8ICQ A;  4QZ9 A;  9ICG A;  4M04 A;  4KLQ A;  4KLU A;  1BPB A;  8ICN A;  4RT2 A;  4S3N A;  4GXK A;  5HHH A;  3C2K A;  5HRB A;  5J2J A;  4X5V A;  2PFP A;  2ZH4 A;  4RQ3 A;  4MF8 A;  4LZD A;  4KM5 A;  5DDY A;  4KLI A;  4M5D A;  2BCS A;  4KLO A;  7ICL A;  2I9G A;  4LEW A;  4AT7 A;  4O69 A;  3JYY A;  3RJG A;  4NXV A;  5J2E A;  4P4M A;  4NLN A;  4UB3 A;  7ICE A;  8ICJ A;  4WBY A;  5HRE A;  3PML A;  2BCU A;  9ICU A;  2Q66 A;  1MIV A;  5J2F A;  1YLQ A;  4XQ7 A;  4UAY A;  2DRA A;  3RH6 A;  3HIY A;  4QZI A;  5HRG A;  1ZQV A;  5TZV A;  4XQ8 A;  4RQ7 A;  4IG8 A;  2NRK A;  5J0U A;  4DOB A;  3L9D A;  4EBJ A;  2P66 A;  4I2H A;  5DB9 A;  4XUS A;  5BOM A;  2BPC A;  5HRI A;  3ISC A;  4YCX A;  3MDA A;  5IIK A;  3AQM A;  5HR9 A;  4KLM A;  8ICG A;  7ICS A;  5J2D A;  2PFQ A;  1RPL A;  3JPS A;  4JLX A;  5J0T A;  4I2D A;  4KB6 A;  4R65 A;  9ICQ A;  4RQ6 A;  9ICA A;  1ZQA A;  7ICK A;  1ZQS A;  4KLS A;  8ICF A;  4PHA A;  4K97 A;  4I2G A;  1Q79 A;  1ZQB A;  2FMP A;  1Q78 A;  1NO5 A;  5HRD A;  8ICA A;  4OAF A;  4I2B A;  8ICZ A;  4WC6 A;  3LQC B;  4X4S A;  7ICG A;  7ICV A;  4JLZ A;  4M9J A;  1NOM A;  1PX5 A;  4TUP A;  4LEZ A;  9ICL A;  9ICT A;  1UET A;  4NXX A;  4O5K A;  2ZH1 A;  4M9G A;  2ISO A;  8ICK A;  4FHP A;  5BPC A;  4NM1 A;  3C66 A;  4OAI Z;  1XSN A;  3OGU A;  4KLF A;  3RJH A;  3UPS A;  5CA7 A;  4QZA A;  4Z6C A;  3TFR A;  3C5F A;  4WC2 A;  1VFG A;  2GWS A;  4K96 A;  4I29 A;  4O5E A;  4NLZ A;  1F5A A;  4PHD A;  7ICJ A;  1ZQE A;  2PXI A;  1UEU A;  9ICI A;  2RFF A;  2ZH5 A;  2ZH3 A;  5BOL A;  3UXO A;  5CHG A;  4KLH A;  3OV7 A;  2VAN A;  3K75 D;  4LEV A;  4KLT A;  8ICC A;  8ICM A;  3MGH A;  7ICH A;  4P2H A;  8ICH A;  3RH5 A;  4EP7 A;  5DBB A;  4F5P A;  1ZQC A;  4RPZ A;  9ICK A;  4PH5 A;  3WFO A;  3WFQ E;  3HWT A;  1R8C A;  4FHW A;  3GDX A;  2PFO A;  5J2I A;  8ICP A;  3AQK A;  2BCV A;  1ZQM A;  4RWN A;  3V7L A;  5D4B A;  1TV9 A;  3JPN A;  4M47 A;  3TFS A;  4P4O A;  3JZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...