4FH5A

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - mgutp bound
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
338
structure length
323
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
molecule keywords Poly(A) RNA polymerase protein cid1
total genus 111
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fh5A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fh5A02
3MDAA 1BPDA 5CR0A 8ICOA 4RWQA 5DBBA 4M9HA 5BOLA 5CHGA 2IHMA 4WC5A 5HRLA 5J0YA 1JN3A 4RWNA 2BCRA 3H37A 1ZQKA 4UD4A 4RQ0A 2DR8A 1ZQTA 1ZQMA 3JPOA 4KLLA 4UD5A 5J2HA 5IILA 8ICWA 1XSNA 5HR9A 5HRDA 2P66A 1F5AA 4X4TA 1BPZA 4M04A 4QZDA 2DR9A 1ZQLA 4UB2A 4O5EA 3UXPA 5DB9A 1UEUA 4RQ5A 1TV9A 4K4HA 9ICMA 2DRAA 4KLFA 4E7XA 4O9MA 4WC6A 3C18A 2BE3A 3UXNA 4X4RA 4EP7A 8ICVA 1OU5A 1R8CA 4QZ9A 1Q78A 4X4PA 3RH5A 4JWMA 4AT9A 5IIOA 3PMNA 9ICFA 9ICKA 9ICGA 4PHEA 2M2UA 3C2KA 2ZH5A 1RPLA 9ICEA 1BPXA 5J2DA 2BPCA 5J2EA 4X5VA 4UB5A 4R63A 9ICAA 4E80A 3H39A 1NOMA 4TUSA 3PMLA 3ISCA 3AU2A 4FHPA 4WC1A 4M9GA 3MBYA 8ICJA 5CJ7A 4NM2A 3K75D 1HUZA 3OGUA 4MFAA 4I2EA 1ZQPA 4NLZA 4XQ8A 4Z6CA 2DRBA 5J0OA 4KLDA 1ZQAA 7ICEA 5IIMA 5DDYA 1ZQUA 4QZCA 1RZTA 4I2JA 2M2WA 5F2VO 3WFQE 1MIWA 3MGIA 4WC0A 1PX5A 4NKTA 3V72A 9ICBA 4LZDA 9ICNA 9ICOA 2W9MA 4GXKA 3RH6A 4X4VA 4RPXA 1JAJA 3V7LA 4TURA 5J0WA 2ZH6A 3NYBA 4YMMA 5IIKA 5HRKA 1ZQGA 5J2JA 3PNCA 4QZ8A 7ICGA 2ZH7A 8ICQA 4KLSA 1TFYA 1ZQFA 2DVIA 4IG8A 4WC7A 4YMOA 4I2GA 3OVBA 4AT7A 1WOTA 4R65A 5J2BA 4I27A 4KLMA 2M2VA 1ZQSA 4KLTA 1R8AA 3ISBA 3RJJA 1ZQIA 3B0XA 4IQUA 3C5GA 9ICPA 5CWRA 4I2HA 9ICIA 2B56A 4IQTA 5J0UA 3HIYA 1BPBA 4R64A 8ICGA 4M9JA 4FH5A 5DKWA 4LT6A 5J2IA 5DBCA 7ICUA 2DR5A 3AQMA 7ICQA 2GWSA 4MFFA 3OVAA 9ICQA 3H3AA 1ZQYA 5CP2A 4I2BA 4UB1A 1ZQEA 8ICIA 3WFRE 4KLOA 2Q66A 8ICPA 4RQ4A 2BPGA 4M5DA 1VFGA 3MDCA 5J0TA 3HJ4A 2DR7A 1ZJNA 5HRIA 4M0AA 1JMSA 1ZQBA 5J2CA 4RQ2A 3ISDA 1ZQHA 4Z6FA 2M2TA 4KLJA 7ICJA 4QZAA 5J0RA 3UQ0A 4GXJA 5IIIA 4FO6A 4KLGA 1ZQCA 7ICLA 3JPNA 8ICZA 2O5AA 4X4UA 4F5RA 3OV7A 9ICXA 3TFSA 4KLEA 4WBZA 1ZQDA 4XUSA 7ICNA 4UAZA 9ICLA 1ZQQA 2ZH9A 3L9DA 1FA0A 1ZQRA 4RQ3A 4PGQA 1ZQWA 4RWPA 4RT2A 5DB6A 4LZGA 2BCUA 7ICPA 2ZH2A 3RJFA 7ICTA 3WFPA 4E8FA 5J2KA 2BCQA 4QZIA 1R8BA 4PHPA 5J2GA 4RPYA 5IIJA 2O1PA 4AT9B 4Z6DA 3RJIA 2HHPA 3WFOA 3AQKA 3C2LA 3HJ1A 5DECA 4X4SA 8ICAA 4I28A 7ICVA 5HRFA 4UB3A 4NM1A 4YCXA 4NLKA 2ID1A 5DEDA 4RQ6A 5HRGA 2PFQA 2BCSA 9ICCA 9ICVA 3RJHA 2ZHAA 4MFCA 3JPRA 1V4AA 4WC4A 3JPSA 5J0PA 8ICCA 5J29A 4P2HA 8ICMA 4YD2A 4DO9A 4NY8A 4KLIA 1KEJA 7ICRA 3JPQA 4AT7B 4XQ7A 4F5QA 4YMNA 3RH4A 2FMPA 3AU6A 4PH5A 4M2YA 2ZH3A 4WC3A 4QZGA 5DB7A 1ZQZA 4PGYA 4QZHA 4FHWA 7ICSA 5D49A 4ATBA 4P4OA 2PFOA 3AUOA 5DB8A 2ZH1A 4F5PA 4KLHA 5DDMA 9ICWA 4UBBA 3LQCB 4X0BA 1MIVA 3AQLA 4FHXA 4K4IA 4I2CA 1KDHA 3HWTA 3HW8A 4XA5A 4WC2A 5CA7A 5EOZA 2B51A 3JPTA 4FHVA 8ICXA 1NO5A 4AT8B 1MIYA 9ICSA 4YD1A 8ICUA 3UQ2A 8ICTA 8ICFA 2PXIA 4IQVA 3WFSC 2PFPA 4UAYA 1XSLA 2FMSA 3MGHA 4RQ8A 5HREA 5J2AA 4UB4A 4X4NA 1HUOA 5HHIA 4LVSA 4QZFA 4M47A 4O5CA 8ICNA 5CB1A 1TVAA 8ICHA 5HRHA 2B4VA 4FHYA 1ZQOA 3GDXA 4XRHA 4M9NA 3C2MA 4X4QA 1JQRA 4GXIA 9ICJA 3RJEA 4EBKA 4X0AA 3JYYA 2BCVA 1BPYA 4YN4A 4DOCA 1XSPA 1MQ3A 4KLUA 4MF8A 4PGXA 3V7KA 1VJ7A 4DOBA 5IINA 4P4MA 5HHHA 2ZHBA 1UEVA 4QZBA 4F5OA 2PBEA 4X4OA 7ICHA 5DBAA 4IQWA 2ZH4A 4S3NA 2ISOA 3HX0A 8ICRA 3OUYA 2ZH8A 3OUYB 2ISPA 7ICFA 5BOMA 2PFNA 3UXOA 8ICKA 4I2AA 3V7JA 4KLQA 2I9GA 4TUPA 4I2DA 4WCWA 4NXZA 3AQNA 5D46A 3TFRA 4I2IA 1ZJMA 4UBCA 3OVSA 1TFWA 4M9LA 4QZEA 4RQ7A 4K4GA 4PHAA 4UAWA 1R89A 2FMQA 4JWNA 3C66A 8ICSA 3C5FA 4RPZA 9ICRA 1KNYA 3UPSA 4MF2A 4I2FA 4ATBB 4RQ1A 1YLQA 4PPXA 4DOAA 1ZQVA 8ICBA 4TUQA 8ICYA 1ZQNA 5D4BA 4F5NA 5HRBA 9ICTA 4RWOA 3H38A 8ICEA 7ICOA 1ZQJA 4WBYA 1ZQXA 7ICMA 7ICIA 4NLNA 4Z6EA 5J0QA 4P4PA 3LK9A 3B0YA 4AT8A 3RJKA 5J0XA 5BPCA 5J2FA 4FH3A 1MQ2A 2BPFA 4RT3A 4NKUA 4PHDA 1BPEA 7ICKA 9ICHA 4O5KA 9ICUA 8ICLA 1Q79A 3JZ0A 2RFFA 5TZVA 2NRKA 5HC9A 4R66A 4EBJA 5J0SA 3UPQA 3RJGA 4I29A 1UETA 3JPPA 2VANA
chains in the Genus database with same CATH superfamily
3MDAA 2FCLA 1BPDA 5CR0A 8ICOA 4RWQA 5DBBA 4M9HA 5D63A 5BOLA 5CHGA 2IHMA 4WC5A 4HX0A 5HRLA 5J0YA 4RWNA 1JN3A 2BCRA 3H37A 1ZQKA 4UD4A 4RQ0A 2DR8A 1ZQTA 1ZQMA 3JPOA 4KLLA 4WH5A 4UD5A 5J2HA 5IILA 8ICWA 1XSNA 4LEYA 5HR9A 5HRDA 2P66A 1F5AA 4X4TA 1BPZA 4NXWA 4M04A 2BBHA 4QZDA 2DR9A 1ZQLA 4UB2A 4O5EA 3UXPA 5DB9A 1UEUA 4RQ5A 1TV9A 4K4HA 9ICMA 2DRAA 4KLFA 4MKPA 4E7XA 4O9MA 4FO1A 4WC6A 3C18A 2BE3A 4EV6A 3UXNA 4X4RA 4EP7A 8ICVA 1OU5A 1R8CA 4QZ9A 1Q78A 3NKUA 4X4PA 3RH5A 4JWMA 4AT9A 5IIOA 3PMNA 9ICFA 9ICKA 9ICGA 3MCRA 4PHEA 2M2UA 3C2KA 2ZH5A 1RPLA 9ICEA 1BPXA 5J2DA 3NVOA 2BPCA 5J2EA 4X5VA 4UB5A 4R63A 9ICAA 4E80A 4EGWA 4NXVA 3H39A 1NOMA 4TUSA 3PMLA 4JLZA 3AU2A 3ISCA 4FHPA 4OAIZ 3ER9B 4WC1A 4M9GA 3MBYA 8ICJA 5CJ7A 4NM2A 3K75D 1HUZA 3OGUA 4MFAA 4I2EA 1ZQPA 4NLZA 4XQ8A 2DRBA 4Z6CA 5J0OA 4KLDA 1ZQAA 7ICEA 5IIMA 5DDYA 1ZQUA 4QZCA 1RZTA 2HN1A 4I2JA 2M2WA 5F2VO 3WFQE 3ER8C 1MIWA 3MGIA 4WC0A 1PX5A 4NKTA 3V72A 9ICBA 2IUBA 4LZDA 9ICNA 9ICOA 2W9MA 4EEBA 4GXKA 3RH6A 4X4VA 4RPXA 1JAJA 3V7LA 4TURA 5J0WA 2ZH6A 4NXTA 3NYBA 4YMMA 5IIKA 5CFTA 5HRKA 1ZQGA 5J2JA 3PNCA 4QZ8A 7ICGA 2ZH7A 8ICQA 4KLSA 1TFYA 2BBJA 1ZQFA 2DVIA 4IG8A 4WC7A 4YMOA 4I2GA 3OVBA 4AT7A 1WOTA 4R65A 5J2BA 4I27A 4KLMA 2M2VA 1ZQSA 4KLTA 1R8AA 3ISBA 3RJJA 1ZQIA 3B0XA 4IQUA 3C5GA 9ICPA 5CWRA 4I2HA 4XJEA 9ICIA 2B56A 4IQTA 5J0UA 3HIYA 1BPBA 4R64A 8ICGA 4M9JA 4FH5A 4O67A 5DKWA 4LT6A 5J2IA 5DBCA 7ICUA 2DR5A 3AQMA 7ICQA 2GWSA 4MFFA 3OVAA 9ICQA 2IHOA 3H3AA 1ZQYA 5CP2A 4I2BA 4UB1A 1ZQEA 8ICIA 3WFRE 4KLOA 2Q66A 8ICPA 4RQ4A 2BPGA 4M5DA 1VFGA 4K9AA 3MDCA 5J0TA 3HJ4A 2DR7A 1ZJNA 5HRIA 4M0AA 1JMSA 1ZQBA 5J2CA 4RQ2A 4I0UA 3ISDA 1ZQHA 4Z6FA 2M2TA 5B3QA 4NXXA 4KLJA 7ICJA 4QZAA 5J0RA 3UQ0A 4GXJA 5IIIA 4FO6A 4KLGA 1ZQCA 7ICLA 3JPNA 8ICZA 2O5AA 4X4UA 4F5RA 3OV7A 9ICXA 5D61A 3TFSA 4LEVA 4KLEA 4WBZA 4WQLA 1ZQDA 4XUSA 7ICNA 4UAZA 9ICLA 1ZQQA 2ZH9A 3L9DA 1FA0A 1ZQRA 4RQ3A 4OAHA 4PGQA 1ZQWA 4O68A 4RWPA 4RT2A 5DB6A 4LZGA 2BCUA 5JTGA 7ICPA 5D62A 2ZH2A 3RJFA 7ICTA 3WFPA 4E8FA 5J2KA 2BCQA 4QZIA 1R8BA 4PHPA 5J2GA 4RPYA 5IIJA 2O1PA 4AT9B 4Z6DA 3RJIA 2HHPA 3WFOA 3AQKA 3C2LA 3HJ1A 5DECA 4X4SA 8ICAA 4I28A 7ICVA 5HRFA 4EEDA 4UB3A 4NM1A 4YCXA 4NLKA 2ID1A 5DEDA 4RQ6A 5HRGA 2PFQA 2BCSA 9ICCA 9ICVA 3RJHA 2ZHAA 4K9BA 4MFCA 3K7DA 3JPRA 1V4AA 4WC4A 3JPSA 5J0PA 8ICCA 3OWGA 5J29A 4P2HA 8ICMA 4YD2A 4DO9A 4NY8A 4KLIA 1KEJA 7ICRA 3JPQA 4AT7B 4N7RA 4XQ7A 4F5QA 4YMNA 3RH4A 2FMPA 3AU6A 4PH5A 4M2YA 2ZH3A 4WC3A 4JLXA 4QZGA 5DB7A 1ZQZA 4PGYA 4QZHA 4FHWA 7ICSA 5D49A 4LEWA 4O6AA 4ATBA 4P4OA 2PFOA 2HN2A 4K97A 3AUOA 5DB8A 2ZH1A 4F5PA 4KLHA 5DDMA 9ICWA 4UBBA 4O69A 2GA9D 3LQCB 4X0BA 1MIVA 3AQLA 4FHXA 4K4IA 4I2CA 1KDHA 3HWTA 3HW8A 4XA5A 4WC2A 5CA7A 5EOZA 2B51A 3JPTA 4FHVA 8ICXA 1NO5A 2EWRA 4AT8B 1MIYA 9ICSA 4YD1A 8ICUA 3UQ2A 8ICTA 8ICFA 2PXIA 4IQVA 3WFSC 2PFPA 4UAYA 1XSLA 2FMSA 3NWIA 3MGHA 4RQ8A 5HREA 5J2AA 4UB4A 4X4NA 1HUOA 5HHIA 4LVSA 5CHEA 4QZFA 4M47A 4O5CA 8ICNA 4K98A 5CB1A 5CFSA 3ERCC 1TVAA 8ICHA 5HRHA 2B4VA 4FHYA 1ZQOA 3GDXA 4XRHA 4M9NA 3C2MA 4X4QA 1JQRA 4GXIA 9ICJA 3RJEA 4EBKA 4X0AA 3JYYA 2BCVA 1BPYA 4YN4A 4DOCA 4OAGA 1XSPA 1MQ3A 4KLUA 4MF8A 4PGXA 3V7KA 1VJ7A 4DOBA 5IINA 4P4MA 5HHHA 2ZHBA 1UEVA 4QZBA 4F5OA 4X4OA 2PBEA 7ICHA 5DBAA 4IQWA 2ZH4A 4S3NA 4KM5A 4K8VA 2ISOA 5B3PA 3HX0A 8ICRA 3OUYA 2ZH8A 3OUYB 3EF2A 4WQKA 2ISPA 7ICFA 5BOMA 2PFNA 4WOYA 3UXOA 8ICKA 4I2AA 3V7JA 4KLQA 2I9GA 4TUPA 4WCWA 4I2DA 4NXZA 3AQNA 5D46A 3TFRA 4I2IA 1ZJMA 4UBCA 3OVSA 1TFWA 4M9LA 4QZEA 1GPJA 4LEZA 4RQ7A 4K4GA 4PHAA 4UAWA 1R89A 2FMQA 4JWNA 3C66A 8ICSA 3C5FA 4RPZA 9ICRA 1KNYA 3UPSA 4OAFA 4K96A 4MF2A 4I2FA 4ATBB 4RQ1A 1YLQA 4KB6A 4PPXA 4DOAA 1ZQVA 8ICBA 3JCFA 4TUQA 8ICYA 1ZQNA 5D4BA 4F5NA 5HRBA 9ICTA 4RWOA 3CK6A 3H38A 8ICEA 7ICOA 1ZQJA 4K99A 4WBYA 1ZQXA 7ICMA 7ICIA 4NLNA 4Z6EA 5J0QA 4P4PA 3LK9A 4AT8A 3B0YA 2GAFD 3RJKA 5J0XA 5BPCA 5CFUA 5J2FA 4FH3A 1MQ2A 2BPFA 4RT3A 4NKUA 4PHDA 1BPEA 7ICKA 3PHZA 9ICHA 4O5KA 9ICUA 8ICLA 1Q79A 3JZ0A 2RFFA 5TZVA 2NRKA 4NXUA 5HC9A 4R66A 4EBJA 5J0SA 3UPQA 3RJGA 4I29A 1UETA 3JPPA 2VANA
chains in the Genus database with same CATH topology
3MDAA 1BPDA 5CR0A 8ICOA 4RWQA 5DBBA 4M9HA 5BOLA 5CHGA 2IHMA 4WC5A 5HRLA 5J0YA 1JN3A 4RWNA 2BCRA 3H37A 1ZQKA 4UD4A 4RQ0A 2DR8A 1ZQTA 1ZQMA 3JPOA 4KLLA 4UD5A 5J2HA 5IILA 8ICWA 1XSNA 4LEYA 5HR9A 5HRDA 2P66A 1F5AA 4X4TA 1BPZA 4NXWA 4M04A 4QZDA 2DR9A 1ZQLA 4UB2A 4O5EA 3UXPA 5DB9A 1UEUA 4RQ5A 1TV9A 4K4HA 9ICMA 2DRAA 4KLFA 4MKPA 4E7XA 4O9MA 4WC6A 3C18A 2BE3A 3UXNA 4X4RA 4EP7A 8ICVA 1OU5A 1R8CA 4QZ9A 1Q78A 4X4PA 3RH5A 4JWMA 4AT9A 5IIOA 3PMNA 9ICFA 9ICKA 9ICGA 4PHEA 2M2UA 3C2KA 2ZH5A 1RPLA 9ICEA 1BPXA 5J2DA 2BPCA 5J2EA 4X5VA 4UB5A 4R63A 9ICAA 4E80A 4NXVA 3H39A 4TUSA 1NOMA 3PMLA 4JLZA 3AU2A 3ISCA 4FHPA 4OAIZ 4WC1A 4M9GA 3MBYA 8ICJA 5CJ7A 4NM2A 3K75D 1HUZA 3OGUA 4MFAA 4I2EA 1ZQPA 4NLZA 4XQ8A 2DRBA 4Z6CA 5J0OA 4KLDA 1ZQAA 7ICEA 5IIMA 5DDYA 1ZQUA 4QZCA 1RZTA 4I2JA 2M2WA 5F2VO 3WFQE 1MIWA 3MGIA 4WC0A 1PX5A 4NKTA 3V72A 9ICBA 4LZDA 9ICNA 9ICOA 2W9MA 4GXKA 3RH6A 4X4VA 4RPXA 1JAJA 3V7LA 4TURA 5J0WA 2ZH6A 4NXTA 3NYBA 4YMMA 5IIKA 5HRKA 1ZQGA 5J2JA 3PNCA 4QZ8A 7ICGA 2ZH7A 8ICQA 4KLSA 1TFYA 1ZQFA 2DVIA 4IG8A 4WC7A 4YMOA 4I2GA 3OVBA 4AT7A 1WOTA 4R65A 5J2BA 4I27A 4KLMA 2M2VA 1ZQSA 4KLTA 1R8AA 3ISBA 3RJJA 1ZQIA 3B0XA 4IQUA 3C5GA 9ICPA 5CWRA 4I2HA 9ICIA 2B56A 4IQTA 5J0UA 3HIYA 1BPBA 4R64A 8ICGA 4M9JA 4FH5A 4O67A 5DKWA 4LT6A 5J2IA 5DBCA 7ICUA 2DR5A 3AQMA 7ICQA 2GWSA 4MFFA 3OVAA 9ICQA 3H3AA 1ZQYA 5CP2A 4I2BA 4UB1A 1ZQEA 8ICIA 3WFRE 4KLOA 2Q66A 8ICPA 4RQ4A 2BPGA 4M5DA 1VFGA 4K9AA 3MDCA 5J0TA 3HJ4A 2DR7A 1ZJNA 5HRIA 4M0AA 1JMSA 1ZQBA 5J2CA 4RQ2A 3ISDA 1ZQHA 4Z6FA 2M2TA 4NXXA 4KLJA 7ICJA 4QZAA 5J0RA 3UQ0A 4GXJA 5IIIA 4FO6A 4KLGA 1ZQCA 7ICLA 3JPNA 8ICZA 2O5AA 4X4UA 4F5RA 3OV7A 9ICXA 3TFSA 4LEVA 4KLEA 4WBZA 1ZQDA 4XUSA 7ICNA 4UAZA 9ICLA 1ZQQA 2ZH9A 3L9DA 1FA0A 1ZQRA 4RQ3A 4OAHA 4PGQA 1ZQWA 4O68A 4RWPA 4RT2A 5DB6A 4LZGA 2BCUA 7ICPA 2ZH2A 3RJFA 7ICTA 3WFPA 4E8FA 5J2KA 2BCQA 4QZIA 1R8BA 4PHPA 5J2GA 4RPYA 5IIJA 2O1PA 4AT9B 4Z6DA 3RJIA 2HHPA 3WFOA 3AQKA 3C2LA 3HJ1A 5DECA 4X4SA 8ICAA 4I28A 7ICVA 5HRFA 4UB3A 4NM1A 4YCXA 4NLKA 2ID1A 5DEDA 4RQ6A 5HRGA 2PFQA 2BCSA 9ICCA 9ICVA 3RJHA 2ZHAA 4K9BA 4MFCA 3JPRA 1V4AA 4WC4A 3JPSA 5J0PA 8ICCA 5J29A 4P2HA 8ICMA 4YD2A 4DO9A 4NY8A 4KLIA 1KEJA 7ICRA 3JPQA 4AT7B 4XQ7A 4F5QA 4YMNA 3RH4A 2FMPA 3AU6A 4PH5A 4M2YA 2ZH3A 4WC3A 4JLXA 4QZGA 5DB7A 1ZQZA 4PGYA 4QZHA 4FHWA 7ICSA 5D49A 4LEWA 4O6AA 4ATBA 4P4OA 2PFOA 3AUOA 4K97A 5DB8A 2ZH1A 4F5PA 4KLHA 5DDMA 9ICWA 4UBBA 4O69A 3LQCB 4X0BA 1MIVA 3AQLA 4FHXA 4K4IA 4I2CA 1KDHA 3HWTA 3HW8A 4XA5A 4WC2A 5CA7A 5EOZA 2B51A 3JPTA 4FHVA 8ICXA 1NO5A 4AT8B 1MIYA 9ICSA 4YD1A 8ICUA 3UQ2A 8ICTA 8ICFA 2PXIA 4IQVA 3WFSC 2PFPA 4UAYA 1XSLA 2FMSA 3MGHA 4RQ8A 5HREA 5J2AA 4UB4A 4X4NA 1HUOA 5HHIA 4LVSA 4QZFA 4M47A 4O5CA 8ICNA 4K98A 5CB1A 1TVAA 8ICHA 5HRHA 2B4VA 4FHYA 1ZQOA 3GDXA 4XRHA 4M9NA 3C2MA 4X4QA 1JQRA 4GXIA 9ICJA 3RJEA 4EBKA 4X0AA 3JYYA 2BCVA 1BPYA 4YN4A 4DOCA 4OAGA 1XSPA 1MQ3A 4KLUA 4MF8A 4PGXA 3V7KA 1VJ7A 4DOBA 5IINA 4P4MA 5HHHA 2ZHBA 1UEVA 4QZBA 4F5OA 4X4OA 2PBEA 7ICHA 5DBAA 4IQWA 2ZH4A 4S3NA 4KM5A 4K8VA 2ISOA 3HX0A 8ICRA 3OUYA 2ZH8A 3OUYB 2ISPA 7ICFA 5BOMA 2PFNA 4WOYA 3UXOA 8ICKA 4I2AA 3V7JA 4KLQA 2I9GA 4TUPA 4I2DA 4WCWA 4NXZA 3AQNA 5D46A 3TFRA 4I2IA 1ZJMA 4UBCA 3OVSA 1TFWA 4M9LA 4QZEA 4LEZA 4RQ7A 4K4GA 4PHAA 4UAWA 1R89A 2FMQA 4JWNA 3C66A 8ICSA 3C5FA 4RPZA 9ICRA 1KNYA 3UPSA 4OAFA 4K96A 4MF2A 4I2FA 4ATBB 4RQ1A 1YLQA 4KB6A 4PPXA 4DOAA 1ZQVA 8ICBA 4TUQA 8ICYA 1ZQNA 5D4BA 4F5NA 5HRBA 9ICTA 4RWOA 3H38A 8ICEA 7ICOA 1ZQJA 4K99A 4WBYA 1ZQXA 7ICMA 7ICIA 4NLNA 4Z6EA 5J0QA 4P4PA 3LK9A 4AT8A 3B0YA 3RJKA 5J0XA 5BPCA 5J2FA 4FH3A 1MQ2A 2BPFA 4RT3A 4NKUA 4PHDA 1BPEA 7ICKA 9ICHA 4O5KA 9ICUA 8ICLA 1Q79A 3JZ0A 2RFFA 5TZVA 2NRKA 4NXUA 5HC9A 4R66A 4EBJA 5J0SA 3UPQA 3RJGA 4I29A 1UETA 3JPPA 2VANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MDA A;  1BPD A;  5CR0 A;  8ICO A;  4RWQ A;  5DBB A;  4M9H A;  5BOL A;  5CHG A;  2IHM A;  4WC5 A;  5HRL A;  5J0Y A;  1JN3 A;  4RWN A;  2BCR A;  3H37 A;  1ZQK A;  4UD4 A;  4RQ0 A;  2DR8 A;  1ZQT A;  1ZQM A;  3JPO A;  4KLL A;  4UD5 A;  5J2H A;  5IIL A;  8ICW A;  1XSN A;  5HR9 A;  5HRD A;  2P66 A;  1F5A A;  4X4T A;  1BPZ A;  4M04 A;  4QZD A;  2DR9 A;  1ZQL A;  4UB2 A;  4O5E A;  3UXP A;  5DB9 A;  1UEU A;  4RQ5 A;  1TV9 A;  4K4H A;  9ICM A;  2DRA A;  4KLF A;  4E7X A;  4O9M A;  4WC6 A;  3C18 A;  2BE3 A;  3UXN A;  4X4R A;  4EP7 A;  8ICV A;  1OU5 A;  1R8C A;  4QZ9 A;  1Q78 A;  4X4P A;  3RH5 A;  4JWM A;  4AT9 A;  5IIO A;  3PMN A;  9ICF A;  9ICK A;  9ICG A;  4PHE A;  2M2U A;  3C2K A;  2ZH5 A;  1RPL A;  9ICE A;  1BPX A;  5J2D A;  2BPC A;  5J2E A;  4X5V A;  4UB5 A;  4R63 A;  9ICA A;  4E80 A;  3H39 A;  1NOM A;  4TUS A;  3PML A;  3ISC A;  3AU2 A;  4FHP A;  4WC1 A;  4M9G A;  3MBY A;  8ICJ A;  5CJ7 A;  4NM2 A;  3K75 D;  1HUZ A;  3OGU A;  4MFA A;  4I2E A;  1ZQP A;  4NLZ A;  4XQ8 A;  4Z6C A;  2DRB A;  5J0O A;  4KLD A;  1ZQA A;  7ICE A;  5IIM A;  5DDY A;  1ZQU A;  4QZC A;  1RZT A;  4I2J A;  2M2W A;  5F2V O;  3WFQ E;  1MIW A;  3MGI A;  4WC0 A;  1PX5 A;  4NKT A;  3V72 A;  9ICB A;  4LZD A;  9ICN A;  9ICO A;  2W9M A;  4GXK A;  3RH6 A;  4X4V A;  4RPX A;  1JAJ A;  3V7L A;  4TUR A;  5J0W A;  2ZH6 A;  3NYB A;  4YMM A;  5IIK A;  5HRK A;  1ZQG A;  5J2J A;  3PNC A;  4QZ8 A;  7ICG A;  2ZH7 A;  8ICQ A;  4KLS A;  1TFY A;  1ZQF A;  2DVI A;  4IG8 A;  4WC7 A;  4YMO A;  4I2G A;  3OVB A;  4AT7 A;  1WOT A;  4R65 A;  5J2B A;  4I27 A;  4KLM A;  2M2V A;  1ZQS A;  4KLT A;  1R8A A;  3ISB A;  3RJJ A;  1ZQI A;  3B0X A;  4IQU A;  3C5G A;  9ICP A;  5CWR A;  4I2H A;  9ICI A;  2B56 A;  4IQT A;  5J0U A;  3HIY A;  1BPB A;  4R64 A;  8ICG A;  4M9J A;  4FH5 A;  5DKW A;  4LT6 A;  5J2I A;  5DBC A;  7ICU A;  2DR5 A;  3AQM A;  7ICQ A;  2GWS A;  4MFF A;  3OVA A;  9ICQ A;  3H3A A;  1ZQY A;  5CP2 A;  4I2B A;  4UB1 A;  1ZQE A;  8ICI A;  3WFR E;  4KLO A;  2Q66 A;  8ICP A;  4RQ4 A;  2BPG A;  4M5D A;  1VFG A;  3MDC A;  5J0T A;  3HJ4 A;  2DR7 A;  1ZJN A;  5HRI A;  4M0A A;  1JMS A;  1ZQB A;  5J2C A;  4RQ2 A;  3ISD A;  1ZQH A;  4Z6F A;  2M2T A;  4KLJ A;  7ICJ A;  4QZA A;  5J0R A;  3UQ0 A;  4GXJ A;  5III A;  4FO6 A;  4KLG A;  1ZQC A;  7ICL A;  3JPN A;  8ICZ A;  2O5A A;  4X4U A;  4F5R A;  3OV7 A;  9ICX A;  3TFS A;  4KLE A;  4WBZ A;  1ZQD A;  4XUS A;  7ICN A;  4UAZ A;  9ICL A;  1ZQQ A;  2ZH9 A;  3L9D A;  1FA0 A;  1ZQR A;  4RQ3 A;  4PGQ A;  1ZQW A;  4RWP A;  4RT2 A;  5DB6 A;  4LZG A;  2BCU A;  7ICP A;  2ZH2 A;  3RJF A;  7ICT A;  3WFP A;  4E8F A;  5J2K A;  2BCQ A;  4QZI A;  1R8B A;  4PHP A;  5J2G A;  4RPY A;  5IIJ A;  2O1P A;  4AT9 B;  4Z6D A;  3RJI A;  2HHP A;  3WFO A;  3AQK A;  3C2L A;  3HJ1 A;  5DEC A;  4X4S A;  8ICA A;  4I28 A;  7ICV A;  5HRF A;  4UB3 A;  4NM1 A;  4YCX A;  4NLK A;  2ID1 A;  5DED A;  4RQ6 A;  5HRG A;  2PFQ A;  2BCS A;  9ICC A;  9ICV A;  3RJH A;  2ZHA A;  4MFC A;  3JPR A;  1V4A A;  4WC4 A;  3JPS A;  5J0P A;  8ICC A;  5J29 A;  4P2H A;  8ICM A;  4YD2 A;  4DO9 A;  4NY8 A;  4KLI A;  1KEJ A;  7ICR A;  3JPQ A;  4AT7 B;  4XQ7 A;  4F5Q A;  4YMN A;  3RH4 A;  2FMP A;  3AU6 A;  4PH5 A;  4M2Y A;  2ZH3 A;  4WC3 A;  4QZG A;  5DB7 A;  1ZQZ A;  4PGY A;  4QZH A;  4FHW A;  7ICS A;  5D49 A;  4ATB A;  4P4O A;  2PFO A;  3AUO A;  5DB8 A;  2ZH1 A;  4F5P A;  4KLH A;  5DDM A;  9ICW A;  4UBB A;  3LQC B;  4X0B A;  1MIV A;  3AQL A;  4FHX A;  4K4I A;  4I2C A;  1KDH A;  3HWT A;  3HW8 A;  4XA5 A;  4WC2 A;  5CA7 A;  5EOZ A;  2B51 A;  3JPT A;  4FHV A;  8ICX A;  1NO5 A;  4AT8 B;  1MIY A;  9ICS A;  4YD1 A;  8ICU A;  3UQ2 A;  8ICT A;  8ICF A;  2PXI A;  4IQV A;  3WFS C;  2PFP A;  4UAY A;  1XSL A;  2FMS A;  3MGH A;  4RQ8 A;  5HRE A;  5J2A A;  4UB4 A;  4X4N A;  1HUO A;  5HHI A;  4LVS A;  4QZF A;  4M47 A;  4O5C A;  8ICN A;  5CB1 A;  1TVA A;  8ICH A;  5HRH A;  2B4V A;  4FHY A;  1ZQO A;  3GDX A;  4XRH A;  4M9N A;  3C2M A;  4X4Q A;  1JQR A;  4GXI A;  9ICJ A;  3RJE A;  4EBK A;  4X0A A;  3JYY A;  2BCV A;  1BPY A;  4YN4 A;  4DOC A;  1XSP A;  1MQ3 A;  4KLU A;  4MF8 A;  4PGX A;  3V7K A;  1VJ7 A;  4DOB A;  5IIN A;  4P4M A;  5HHH A;  2ZHB A;  1UEV A;  4QZB A;  4F5O A;  2PBE A;  4X4O A;  7ICH A;  5DBA A;  4IQW A;  2ZH4 A;  4S3N A;  2ISO A;  3HX0 A;  8ICR A;  3OUY A;  2ZH8 A;  3OUY B;  2ISP A;  7ICF A;  5BOM A;  2PFN A;  3UXO A;  8ICK A;  4I2A A;  3V7J A;  4KLQ A;  2I9G A;  4TUP A;  4I2D A;  4WCW A;  4NXZ A;  3AQN A;  5D46 A;  3TFR A;  4I2I A;  1ZJM A;  4UBC A;  3OVS A;  1TFW A;  4M9L A;  4QZE A;  4RQ7 A;  4K4G A;  4PHA A;  4UAW A;  1R89 A;  2FMQ A;  4JWN A;  3C66 A;  8ICS A;  3C5F A;  4RPZ A;  9ICR A;  1KNY A;  3UPS A;  4MF2 A;  4I2F A;  4ATB B;  4RQ1 A;  1YLQ A;  4PPX A;  4DOA A;  1ZQV A;  8ICB A;  4TUQ A;  8ICY A;  1ZQN A;  5D4B A;  4F5N A;  5HRB A;  9ICT A;  4RWO A;  3H38 A;  8ICE A;  7ICO A;  1ZQJ A;  4WBY A;  1ZQX A;  7ICM A;  7ICI A;  4NLN A;  4Z6E A;  5J0Q A;  4P4P A;  3LK9 A;  3B0Y A;  4AT8 A;  3RJK A;  5J0X A;  5BPC A;  5J2F A;  4FH3 A;  1MQ2 A;  2BPF A;  4RT3 A;  4NKU A;  4PHD A;  1BPE A;  7ICK A;  9ICH A;  4O5K A;  9ICU A;  8ICL A;  1Q79 A;  3JZ0 A;  2RFF A;  5TZV A;  2NRK A;  5HC9 A;  4R66 A;  4EBJ A;  5J0S A;  3UPQ A;  3RJG A;  4I29 A;  1UET A;  3JPP A;  2VAN A; 
#chains in the Genus database with same CATH topology
 3MDA A;  2FCL A;  1BPD A;  5CR0 A;  8ICO A;  4RWQ A;  5DBB A;  4M9H A;  5D63 A;  5BOL A;  5CHG A;  2IHM A;  4WC5 A;  4HX0 A;  5HRL A;  5J0Y A;  4RWN A;  1JN3 A;  2BCR A;  3H37 A;  1ZQK A;  4UD4 A;  4RQ0 A;  2DR8 A;  1ZQT A;  1ZQM A;  3JPO A;  4KLL A;  4WH5 A;  4UD5 A;  5J2H A;  5IIL A;  8ICW A;  1XSN A;  4LEY A;  5HR9 A;  5HRD A;  2P66 A;  1F5A A;  4X4T A;  1BPZ A;  4NXW A;  4M04 A;  2BBH A;  4QZD A;  2DR9 A;  1ZQL A;  4UB2 A;  4O5E A;  3UXP A;  5DB9 A;  1UEU A;  4RQ5 A;  1TV9 A;  4K4H A;  9ICM A;  2DRA A;  4KLF A;  4MKP A;  4E7X A;  4O9M A;  4FO1 A;  4WC6 A;  3C18 A;  2BE3 A;  4EV6 A;  3UXN A;  4X4R A;  4EP7 A;  8ICV A;  1OU5 A;  1R8C A;  4QZ9 A;  1Q78 A;  3NKU A;  4X4P A;  3RH5 A;  4JWM A;  4AT9 A;  5IIO A;  3PMN A;  9ICF A;  9ICK A;  9ICG A;  3MCR A;  4PHE A;  2M2U A;  3C2K A;  2ZH5 A;  1RPL A;  9ICE A;  1BPX A;  5J2D A;  3NVO A;  2BPC A;  5J2E A;  4X5V A;  4UB5 A;  4R63 A;  9ICA A;  4E80 A;  4EGW A;  4NXV A;  3H39 A;  1NOM A;  4TUS A;  3PML A;  4JLZ A;  3AU2 A;  3ISC A;  4FHP A;  4OAI Z;  3ER9 B;  4WC1 A;  4M9G A;  3MBY A;  8ICJ A;  5CJ7 A;  4NM2 A;  3K75 D;  1HUZ A;  3OGU A;  4MFA A;  4I2E A;  1ZQP A;  4NLZ A;  4XQ8 A;  2DRB A;  4Z6C A;  5J0O A;  4KLD A;  1ZQA A;  7ICE A;  5IIM A;  5DDY A;  1ZQU A;  4QZC A;  1RZT A;  2HN1 A;  4I2J A;  2M2W A;  5F2V O;  3WFQ E;  3ER8 C;  1MIW A;  3MGI A;  4WC0 A;  1PX5 A;  4NKT A;  3V72 A;  9ICB A;  2IUB A;  4LZD A;  9ICN A;  9ICO A;  2W9M A;  4EEB A;  4GXK A;  3RH6 A;  4X4V A;  4RPX A;  1JAJ A;  3V7L A;  4TUR A;  5J0W A;  2ZH6 A;  4NXT A;  3NYB A;  4YMM A;  5IIK A;  5CFT A;  5HRK A;  1ZQG A;  5J2J A;  3PNC A;  4QZ8 A;  7ICG A;  2ZH7 A;  8ICQ A;  4KLS A;  1TFY A;  2BBJ A;  1ZQF A;  2DVI A;  4IG8 A;  4WC7 A;  4YMO A;  4I2G A;  3OVB A;  4AT7 A;  1WOT A;  4R65 A;  5J2B A;  4I27 A;  4KLM A;  2M2V A;  1ZQS A;  4KLT A;  1R8A A;  3ISB A;  3RJJ A;  1ZQI A;  3B0X A;  4IQU A;  3C5G A;  9ICP A;  5CWR A;  4I2H A;  4XJE A;  9ICI A;  2B56 A;  4IQT A;  5J0U A;  3HIY A;  1BPB A;  4R64 A;  8ICG A;  4M9J A;  4FH5 A;  4O67 A;  5DKW A;  4LT6 A;  5J2I A;  5DBC A;  7ICU A;  2DR5 A;  3AQM A;  7ICQ A;  2GWS A;  4MFF A;  3OVA A;  9ICQ A;  2IHO A;  3H3A A;  1ZQY A;  5CP2 A;  4I2B A;  4UB1 A;  1ZQE A;  8ICI A;  3WFR E;  4KLO A;  2Q66 A;  8ICP A;  4RQ4 A;  2BPG A;  4M5D A;  1VFG A;  4K9A A;  3MDC A;  5J0T A;  3HJ4 A;  2DR7 A;  1ZJN A;  5HRI A;  4M0A A;  1JMS A;  1ZQB A;  5J2C A;  4RQ2 A;  4I0U A;  3ISD A;  1ZQH A;  4Z6F A;  2M2T A;  5B3Q A;  4NXX A;  4KLJ A;  7ICJ A;  4QZA A;  5J0R A;  3UQ0 A;  4GXJ A;  5III A;  4FO6 A;  4KLG A;  1ZQC A;  7ICL A;  3JPN A;  8ICZ A;  2O5A A;  4X4U A;  4F5R A;  3OV7 A;  9ICX A;  5D61 A;  3TFS A;  4LEV A;  4KLE A;  4WBZ A;  4WQL A;  1ZQD A;  4XUS A;  7ICN A;  4UAZ A;  9ICL A;  1ZQQ A;  2ZH9 A;  3L9D A;  1FA0 A;  1ZQR A;  4RQ3 A;  4OAH A;  4PGQ A;  1ZQW A;  4O68 A;  4RWP A;  4RT2 A;  5DB6 A;  4LZG A;  2BCU A;  5JTG A;  7ICP A;  5D62 A;  2ZH2 A;  3RJF A;  7ICT A;  3WFP A;  4E8F A;  5J2K A;  2BCQ A;  4QZI A;  1R8B A;  4PHP A;  5J2G A;  4RPY A;  5IIJ A;  2O1P A;  4AT9 B;  4Z6D A;  3RJI A;  2HHP A;  3WFO A;  3AQK A;  3C2L A;  3HJ1 A;  5DEC A;  4X4S A;  8ICA A;  4I28 A;  7ICV A;  5HRF A;  4EED A;  4UB3 A;  4NM1 A;  4YCX A;  4NLK A;  2ID1 A;  5DED A;  4RQ6 A;  5HRG A;  2PFQ A;  2BCS A;  9ICC A;  9ICV A;  3RJH A;  2ZHA A;  4K9B A;  4MFC A;  3K7D A;  3JPR A;  1V4A A;  4WC4 A;  3JPS A;  5J0P A;  8ICC A;  3OWG A;  5J29 A;  4P2H A;  8ICM A;  4YD2 A;  4DO9 A;  4NY8 A;  4KLI A;  1KEJ A;  7ICR A;  3JPQ A;  4AT7 B;  4N7R A;  4XQ7 A;  4F5Q A;  4YMN A;  3RH4 A;  2FMP A;  3AU6 A;  4PH5 A;  4M2Y A;  2ZH3 A;  4WC3 A;  4JLX A;  4QZG A;  5DB7 A;  1ZQZ A;  4PGY A;  4QZH A;  4FHW A;  7ICS A;  5D49 A;  4LEW A;  4O6A A;  4ATB A;  4P4O A;  2PFO A;  2HN2 A;  4K97 A;  3AUO A;  5DB8 A;  2ZH1 A;  4F5P A;  4KLH A;  5DDM A;  9ICW A;  4UBB A;  4O69 A;  2GA9 D;  3LQC B;  4X0B A;  1MIV A;  3AQL A;  4FHX A;  4K4I A;  4I2C A;  1KDH A;  3HWT A;  3HW8 A;  4XA5 A;  4WC2 A;  5CA7 A;  5EOZ A;  2B51 A;  3JPT A;  4FHV A;  8ICX A;  1NO5 A;  2EWR A;  4AT8 B;  1MIY A;  9ICS A;  4YD1 A;  8ICU A;  3UQ2 A;  8ICT A;  8ICF A;  2PXI A;  4IQV A;  3WFS C;  2PFP A;  4UAY A;  1XSL A;  2FMS A;  3NWI A;  3MGH A;  4RQ8 A;  5HRE A;  5J2A A;  4UB4 A;  4X4N A;  1HUO A;  5HHI A;  4LVS A;  5CHE A;  4QZF A;  4M47 A;  4O5C A;  8ICN A;  4K98 A;  5CB1 A;  5CFS A;  3ERC C;  1TVA A;  8ICH A;  5HRH A;  2B4V A;  4FHY A;  1ZQO A;  3GDX A;  4XRH A;  4M9N A;  3C2M A;  4X4Q A;  1JQR A;  4GXI A;  9ICJ A;  3RJE A;  4EBK A;  4X0A A;  3JYY A;  2BCV A;  1BPY A;  4YN4 A;  4DOC A;  4OAG A;  1XSP A;  1MQ3 A;  4KLU A;  4MF8 A;  4PGX A;  3V7K A;  1VJ7 A;  4DOB A;  5IIN A;  4P4M A;  5HHH A;  2ZHB A;  1UEV A;  4QZB A;  4F5O A;  4X4O A;  2PBE A;  7ICH A;  5DBA A;  4IQW A;  2ZH4 A;  4S3N A;  4KM5 A;  4K8V A;  2ISO A;  5B3P A;  3HX0 A;  8ICR A;  3OUY A;  2ZH8 A;  3OUY B;  3EF2 A;  4WQK A;  2ISP A;  7ICF A;  5BOM A;  2PFN A;  4WOY A;  3UXO A;  8ICK A;  4I2A A;  3V7J A;  4KLQ A;  2I9G A;  4TUP A;  4WCW A;  4I2D A;  4NXZ A;  3AQN A;  5D46 A;  3TFR A;  4I2I A;  1ZJM A;  4UBC A;  3OVS A;  1TFW A;  4M9L A;  4QZE A;  1GPJ A;  4LEZ A;  4RQ7 A;  4K4G A;  4PHA A;  4UAW A;  1R89 A;  2FMQ A;  4JWN A;  3C66 A;  8ICS A;  3C5F A;  4RPZ A;  9ICR A;  1KNY A;  3UPS A;  4OAF A;  4K96 A;  4MF2 A;  4I2F A;  4ATB B;  4RQ1 A;  1YLQ A;  4KB6 A;  4PPX A;  4DOA A;  1ZQV A;  8ICB A;  3JCF A;  4TUQ A;  8ICY A;  1ZQN A;  5D4B A;  4F5N A;  5HRB A;  9ICT A;  4RWO A;  3CK6 A;  3H38 A;  8ICE A;  7ICO A;  1ZQJ A;  4K99 A;  4WBY A;  1ZQX A;  7ICM A;  7ICI A;  4NLN A;  4Z6E A;  5J0Q A;  4P4P A;  3LK9 A;  4AT8 A;  3B0Y A;  2GAF D;  3RJK A;  5J0X A;  5BPC A;  5CFU A;  5J2F A;  4FH3 A;  1MQ2 A;  2BPF A;  4RT3 A;  4NKU A;  4PHD A;  1BPE A;  7ICK A;  3PHZ A;  9ICH A;  4O5K A;  9ICU A;  8ICL A;  1Q79 A;  3JZ0 A;  2RFF A;  5TZV A;  2NRK A;  4NXU A;  5HC9 A;  4R66 A;  4EBJ A;  5J0S A;  3UPQ A;  3RJG A;  4I29 A;  1UET A;  3JPP A;  2VAN A; 
#chains in the Genus database with same CATH homology
 3MDA A;  1BPD A;  5CR0 A;  8ICO A;  4RWQ A;  5DBB A;  4M9H A;  5BOL A;  5CHG A;  2IHM A;  4WC5 A;  5HRL A;  5J0Y A;  1JN3 A;  4RWN A;  2BCR A;  3H37 A;  1ZQK A;  4UD4 A;  4RQ0 A;  2DR8 A;  1ZQT A;  1ZQM A;  3JPO A;  4KLL A;  4UD5 A;  5J2H A;  5IIL A;  8ICW A;  1XSN A;  4LEY A;  5HR9 A;  5HRD A;  2P66 A;  1F5A A;  4X4T A;  1BPZ A;  4NXW A;  4M04 A;  4QZD A;  2DR9 A;  1ZQL A;  4UB2 A;  4O5E A;  3UXP A;  5DB9 A;  1UEU A;  4RQ5 A;  1TV9 A;  4K4H A;  9ICM A;  2DRA A;  4KLF A;  4MKP A;  4E7X A;  4O9M A;  4WC6 A;  3C18 A;  2BE3 A;  3UXN A;  4X4R A;  4EP7 A;  8ICV A;  1OU5 A;  1R8C A;  4QZ9 A;  1Q78 A;  4X4P A;  3RH5 A;  4JWM A;  4AT9 A;  5IIO A;  3PMN A;  9ICF A;  9ICK A;  9ICG A;  4PHE A;  2M2U A;  3C2K A;  2ZH5 A;  1RPL A;  9ICE A;  1BPX A;  5J2D A;  2BPC A;  5J2E A;  4X5V A;  4UB5 A;  4R63 A;  9ICA A;  4E80 A;  4NXV A;  3H39 A;  4TUS A;  1NOM A;  3PML A;  4JLZ A;  3AU2 A;  3ISC A;  4FHP A;  4OAI Z;  4WC1 A;  4M9G A;  3MBY A;  8ICJ A;  5CJ7 A;  4NM2 A;  3K75 D;  1HUZ A;  3OGU A;  4MFA A;  4I2E A;  1ZQP A;  4NLZ A;  4XQ8 A;  2DRB A;  4Z6C A;  5J0O A;  4KLD A;  1ZQA A;  7ICE A;  5IIM A;  5DDY A;  1ZQU A;  4QZC A;  1RZT A;  4I2J A;  2M2W A;  5F2V O;  3WFQ E;  1MIW A;  3MGI A;  4WC0 A;  1PX5 A;  4NKT A;  3V72 A;  9ICB A;  4LZD A;  9ICN A;  9ICO A;  2W9M A;  4GXK A;  3RH6 A;  4X4V A;  4RPX A;  1JAJ A;  3V7L A;  4TUR A;  5J0W A;  2ZH6 A;  4NXT A;  3NYB A;  4YMM A;  5IIK A;  5HRK A;  1ZQG A;  5J2J A;  3PNC A;  4QZ8 A;  7ICG A;  2ZH7 A;  8ICQ A;  4KLS A;  1TFY A;  1ZQF A;  2DVI A;  4IG8 A;  4WC7 A;  4YMO A;  4I2G A;  3OVB A;  4AT7 A;  1WOT A;  4R65 A;  5J2B A;  4I27 A;  4KLM A;  2M2V A;  1ZQS A;  4KLT A;  1R8A A;  3ISB A;  3RJJ A;  1ZQI A;  3B0X A;  4IQU A;  3C5G A;  9ICP A;  5CWR A;  4I2H A;  9ICI A;  2B56 A;  4IQT A;  5J0U A;  3HIY A;  1BPB A;  4R64 A;  8ICG A;  4M9J A;  4FH5 A;  4O67 A;  5DKW A;  4LT6 A;  5J2I A;  5DBC A;  7ICU A;  2DR5 A;  3AQM A;  7ICQ A;  2GWS A;  4MFF A;  3OVA A;  9ICQ A;  3H3A A;  1ZQY A;  5CP2 A;  4I2B A;  4UB1 A;  1ZQE A;  8ICI A;  3WFR E;  4KLO A;  2Q66 A;  8ICP A;  4RQ4 A;  2BPG A;  4M5D A;  1VFG A;  4K9A A;  3MDC A;  5J0T A;  3HJ4 A;  2DR7 A;  1ZJN A;  5HRI A;  4M0A A;  1JMS A;  1ZQB A;  5J2C A;  4RQ2 A;  3ISD A;  1ZQH A;  4Z6F A;  2M2T A;  4NXX A;  4KLJ A;  7ICJ A;  4QZA A;  5J0R A;  3UQ0 A;  4GXJ A;  5III A;  4FO6 A;  4KLG A;  1ZQC A;  7ICL A;  3JPN A;  8ICZ A;  2O5A A;  4X4U A;  4F5R A;  3OV7 A;  9ICX A;  3TFS A;  4LEV A;  4KLE A;  4WBZ A;  1ZQD A;  4XUS A;  7ICN A;  4UAZ A;  9ICL A;  1ZQQ A;  2ZH9 A;  3L9D A;  1FA0 A;  1ZQR A;  4RQ3 A;  4OAH A;  4PGQ A;  1ZQW A;  4O68 A;  4RWP A;  4RT2 A;  5DB6 A;  4LZG A;  2BCU A;  7ICP A;  2ZH2 A;  3RJF A;  7ICT A;  3WFP A;  4E8F A;  5J2K A;  2BCQ A;  4QZI A;  1R8B A;  4PHP A;  5J2G A;  4RPY A;  5IIJ A;  2O1P A;  4AT9 B;  4Z6D A;  3RJI A;  2HHP A;  3WFO A;  3AQK A;  3C2L A;  3HJ1 A;  5DEC A;  4X4S A;  8ICA A;  4I28 A;  7ICV A;  5HRF A;  4UB3 A;  4NM1 A;  4YCX A;  4NLK A;  2ID1 A;  5DED A;  4RQ6 A;  5HRG A;  2PFQ A;  2BCS A;  9ICC A;  9ICV A;  3RJH A;  2ZHA A;  4K9B A;  4MFC A;  3JPR A;  1V4A A;  4WC4 A;  3JPS A;  5J0P A;  8ICC A;  5J29 A;  4P2H A;  8ICM A;  4YD2 A;  4DO9 A;  4NY8 A;  4KLI A;  1KEJ A;  7ICR A;  3JPQ A;  4AT7 B;  4XQ7 A;  4F5Q A;  4YMN A;  3RH4 A;  2FMP A;  3AU6 A;  4PH5 A;  4M2Y A;  2ZH3 A;  4WC3 A;  4JLX A;  4QZG A;  5DB7 A;  1ZQZ A;  4PGY A;  4QZH A;  4FHW A;  7ICS A;  5D49 A;  4LEW A;  4O6A A;  4ATB A;  4P4O A;  2PFO A;  3AUO A;  4K97 A;  5DB8 A;  2ZH1 A;  4F5P A;  4KLH A;  5DDM A;  9ICW A;  4UBB A;  4O69 A;  3LQC B;  4X0B A;  1MIV A;  3AQL A;  4FHX A;  4K4I A;  4I2C A;  1KDH A;  3HWT A;  3HW8 A;  4XA5 A;  4WC2 A;  5CA7 A;  5EOZ A;  2B51 A;  3JPT A;  4FHV A;  8ICX A;  1NO5 A;  4AT8 B;  1MIY A;  9ICS A;  4YD1 A;  8ICU A;  3UQ2 A;  8ICT A;  8ICF A;  2PXI A;  4IQV A;  3WFS C;  2PFP A;  4UAY A;  1XSL A;  2FMS A;  3MGH A;  4RQ8 A;  5HRE A;  5J2A A;  4UB4 A;  4X4N A;  1HUO A;  5HHI A;  4LVS A;  4QZF A;  4M47 A;  4O5C A;  8ICN A;  4K98 A;  5CB1 A;  1TVA A;  8ICH A;  5HRH A;  2B4V A;  4FHY A;  1ZQO A;  3GDX A;  4XRH A;  4M9N A;  3C2M A;  4X4Q A;  1JQR A;  4GXI A;  9ICJ A;  3RJE A;  4EBK A;  4X0A A;  3JYY A;  2BCV A;  1BPY A;  4YN4 A;  4DOC A;  4OAG A;  1XSP A;  1MQ3 A;  4KLU A;  4MF8 A;  4PGX A;  3V7K A;  1VJ7 A;  4DOB A;  5IIN A;  4P4M A;  5HHH A;  2ZHB A;  1UEV A;  4QZB A;  4F5O A;  4X4O A;  2PBE A;  7ICH A;  5DBA A;  4IQW A;  2ZH4 A;  4S3N A;  4KM5 A;  4K8V A;  2ISO A;  3HX0 A;  8ICR A;  3OUY A;  2ZH8 A;  3OUY B;  2ISP A;  7ICF A;  5BOM A;  2PFN A;  4WOY A;  3UXO A;  8ICK A;  4I2A A;  3V7J A;  4KLQ A;  2I9G A;  4TUP A;  4I2D A;  4WCW A;  4NXZ A;  3AQN A;  5D46 A;  3TFR A;  4I2I A;  1ZJM A;  4UBC A;  3OVS A;  1TFW A;  4M9L A;  4QZE A;  4LEZ A;  4RQ7 A;  4K4G A;  4PHA A;  4UAW A;  1R89 A;  2FMQ A;  4JWN A;  3C66 A;  8ICS A;  3C5F A;  4RPZ A;  9ICR A;  1KNY A;  3UPS A;  4OAF A;  4K96 A;  4MF2 A;  4I2F A;  4ATB B;  4RQ1 A;  1YLQ A;  4KB6 A;  4PPX A;  4DOA A;  1ZQV A;  8ICB A;  4TUQ A;  8ICY A;  1ZQN A;  5D4B A;  4F5N A;  5HRB A;  9ICT A;  4RWO A;  3H38 A;  8ICE A;  7ICO A;  1ZQJ A;  4K99 A;  4WBY A;  1ZQX A;  7ICM A;  7ICI A;  4NLN A;  4Z6E A;  5J0Q A;  4P4P A;  3LK9 A;  4AT8 A;  3B0Y A;  3RJK A;  5J0X A;  5BPC A;  5J2F A;  4FH3 A;  1MQ2 A;  2BPF A;  4RT3 A;  4NKU A;  4PHD A;  1BPE A;  7ICK A;  9ICH A;  4O5K A;  9ICU A;  8ICL A;  1Q79 A;  3JZ0 A;  2RFF A;  5TZV A;  2NRK A;  4NXU A;  5HC9 A;  4R66 A;  4EBJ A;  5J0S A;  3UPQ A;  3RJG A;  4I29 A;  1UET A;  3JPP A;  2VAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...