4FH5A

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - mgutp bound
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
338
structure length
323
Chain Sequence
b'SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTKNGFGASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 111
structure length 323
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fh5A01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fh5A02
4QZBA 4UAZA 3WFSC 5CR0A 4R63A 4PPXA 3MDAA 4PHAA 4KLMA 3HWTA 3PMNA 4R64A 4XUSA 4NXZA 4LVSA 4RQ0A 4AT8B 4JWMA 3AU6A 3MBYA 5CWRA 2ZHAA 3GDXA 4Z6EA 1ZQIA 5J0OA 9ICHA 9ICJA 4UBBA 2ZH2A 4XQ7A 4IG8A 4F5QA 1FA0A 7ICEA 2ZH1A 1XSLA 4P2HA 1UETA 1ZJMA 4MF2A 9ICMA 1F5AA 3UQ0A 4UB1A 3RJFA 5F2VO 4YCXA 2BPGA 3MGHA 4RPYA 4UB3A 8ICQA 8ICAA 9ICXA 3B0YA 1TVAA 7ICJA 4RWPA 3C5GA 2ISPA 2DR9A 2M2TA 3TFSA 4IQWA 2NRKA 4QZAA 1TFYA 4E7XA 4KLOA 3HX0A 4FO6A 4O5KA 4F5NA 4TUSA 4AT7A 4AT7B 3OV7A 8ICXA 4E80A 4PGQA 2DR7A 2ZH9A 3UXPA 4FHVA 5HRBA 4WC6A 4WC2A 5J2EA 4QZDA 3JYYA 9ICUA 4EBJA 4KLLA 4M2YA 4RWOA 4P4MA 3RH6A 3HIYA 1R8CA 3HW8A 1MIWA 4KLEA 1JAJA 4X4NA 4M5DA 4KLJA 4MFFA 5DB8A 4TURA 4YD2A 8ICTA 9ICKA 4M9LA 4I2AA 4JWNA 8ICRA 4DOCA 9ICCA 5DDYA 5J2AA 4EBKA 1ZQJA 3L9DA 4X4QA 4QZEA 4X4VA 1R8AA 3UQ2A 1MQ3A 3C5FA 2GWSA 3B0XA 4I2FA 1TFWA 2ZH7A 2RFFA 4RQ3A 7ICIA 9ICLA 7ICLA 4FHXA 3OUYB 3RH4A 3ISCA 4XQ8A 4O5CA 4X4PA 3RJGA 5J0PA 5BOMA 8ICKA 4M9HA 4KLDA 1Q78A 3C66A 2ZH4A 2FMSA 5HR9A 4WCWA 2ZH8A 1ZQHA 1ZQKA 4QZGA 4PH5A 7ICVA 3AQLA 5J2FA 3H37A 3UPSA 4NM1A 3K75D 4QZ9A 5J2DA 9ICBA 2ID1A 2Q66A 1ZQBA 2P66A 4NKUA 4KLTA 9ICGA 5DEDA 2B4VA 9ICFA 5IILA 3JPRA 3AQMA 3PNCA 3JPPA 4TUPA 4PGXA 1UEVA 3H39A 1ZQYA 4F5RA 1KEJA 1JQRA 1BPYA 1ZQRA 4I2DA 1Q79A 4MF8A 1ZQUA 3HJ4A 4UB4A 4M9GA 4S3NA 4UD5A 5DKWA 2FMQA 1YLQA 4WBYA 1BPDA 4RPXA 5CJ7A 1ZJNA 5J0RA 5HRFA 3RJEA 4M47A 5BOLA 5D49A 5J0TA 8ICLA 2B51A 5HREA 1ZQTA 4M9NA 4M0AA 4QZIA 9ICAA 2PXIA 3MGIA 3JPNA 1MIVA 5J0WA 1ZQNA 5HHHA 3OVAA 3UPQA 3WFOA 4YMMA 5D4BA 2IHMA 4I2EA 8ICSA 4NY8A 7ICHA 5TZVA 4KLUA 3H3AA 8ICJA 4FHWA 8ICUA 4RQ5A 2BCVA 2BCUA 9ICNA 5DBBA 7ICGA 4QZFA 8ICGA 7ICMA 4K4IA 1VFGA 2I9GA 1KNYA 2PFPA 1PX5A 4AT9A 5DDMA 2ZH3A 4DO9A 7ICTA 9ICPA 4UD4A 4LT6A 5IIIA 7ICOA 2DR8A 4X4SA 3JZ0A 2FMPA 4M9JA 8ICPA 5IIOA 2BCRA 8ICBA 4I2CA 1HUZA 4WC0A 5DB6A 4RQ2A 3C2LA 5J2BA 3WFRE 5J0YA 1ZQWA 5CHGA 4XA5A 1BPBA 3RJKA 1BPEA 1ZQSA 3OVSA 4RT3A 1VJ7A 2DRBA 4FH3A 3WFPA 2ISOA 3JPSA 2ZH5A 3JPTA 2M2WA 3PMLA 4PGYA 3LK9A 4K4HA 4I2GA 1ZQVA 8ICHA 4RQ1A 1V4AA 5HHIA 3C2KA 4NKTA 4KLIA 3RJHA 8ICCA 1OU5A 3JPQA 1WOTA 2DR5A 4PHDA 4RWNA 3AQNA 4UAWA 4GXIA 4WC5A 8ICVA 9ICRA 8ICYA 1ZQLA 1R8BA 4X0AA 2B56A 4M04A 4IQVA 4P4PA 4FHYA 4I28A 1ZQCA 8ICWA 4RWQA 7ICKA 4KLSA 8ICOA 5CP2A 2ZHBA 4E8FA 4MFCA 3TFRA 1MIYA 1NOMA 4K4GA 2BE3A 3V7KA 4RQ8A 2PFOA 4YD1A 4I2HA 4WBZA 4X4UA 1ZQOA 1RZTA 1RPLA 5HRHA 3V72A 1JN3A 4X5VA 7ICNA 3ISDA 4X0BA 8ICFA 2BPCA 4RPZA 4DOAA 4RT2A 3UXOA 5J2HA 5J0SA 8ICEA 2HHPA 4QZCA 4I29A 4Z6DA 2M2VA 5J0XA 4DOBA 4AT8A 3H38A 2DVIA 9ICEA 9ICVA 4RQ4A 4KLGA 1ZQPA 5J2CA 1ZQGA 2PFQA 7ICSA 5J2IA 4I2BA 4LZGA 2DRAA 4Z6FA 4UB5A 4FHPA 5J0QA 5J2KA 2ZH6A 4LZDA 4R65A 5J0UA 3V7JA 4ATBA 4GXKA 4ATBB 4YMOA 3MDCA 9ICTA 1JMSA 4I27A 4IQTA 5HRIA 3JPOA 7ICFA 5HC9A 4X4OA 5D46A 5DBAA 3RJIA 1KDHA 5DBCA 5J2GA 4X4TA 4XRHA 4NLKA 3C2MA 4UB2A 8ICZA 5EOZA 1R89A 1ZQDA 3NYBA 2BCQA 3ISBA 5HRDA 5DB7A 2W9MA 3RH5A 1UEUA 3HJ1A 4QZ8A 5HRLA 3RJJA 9ICSA 4WC3A 4P4OA 3LQCB 4I2JA 1HUOA 4QZHA 2VANA 4AT9B 8ICIA 3C18A 3OVBA 4EP7A 8ICNA 4WC1A 4RQ6A 9ICWA 5HRKA 1TV9A 4NLZA 4UBCA 5IIKA 5BPCA 5HRGA 3AQKA 7ICQA 4O9MA 4MFAA 4KLFA 2PBEA 4WC7A 2PFNA 2M2UA 4KLQA 4I2IA 3OGUA 5DECA 4F5PA 4KLHA 3V7LA 2O1PA 3WFQE 4F5OA 4IQUA 5J2JA 4RQ7A 1XSNA 5IIMA 5IIJA 3UXNA 1ZQAA 7ICUA 4PHEA 4YMNA 3AU2A 7ICRA 1NO5A 4WC4A 1ZQXA 1ZQFA 2BCSA 5CA7A 4FH5A 4UAYA 1BPXA 4X4RA 4Z6CA 4TUQA 9ICIA 2O5AA 4NM2A 5IINA 1ZQMA 1MQ2A 5CB1A 8ICMA 9ICQA 5DB9A 1ZQQA 1ZQZA 2BPFA 4NLNA 7ICPA 4YN4A 1ZQEA 3AUOA 5J29A 4R66A 4GXJA 3OUYA 1XSPA 4PHPA 9ICOA 1BPZA 4O5EA
chains in the Genus database with same CATH superfamily
4QZBA 2HN1A 4UAZA 3WFSC 5CR0A 4O6AA 4R63A 4PPXA 3MDAA 4PHAA 4KLMA 3HWTA 3PMNA 4R64A 4XUSA 4NXZA 4LVSA 4RQ0A 4AT8B 4JWMA 3AU6A 3MBYA 5CWRA 2ZHAA 3GDXA 4Z6EA 1ZQIA 5J0OA 9ICHA 9ICJA 4UBBA 4OAIZ 2ZH2A 4FO1A 4XQ7A 4I0UA 4IG8A 4XJEA 4F5QA 1FA0A 7ICEA 2ZH1A 1XSLA 4P2HA 2FCLA 5D61A 1UETA 1ZJMA 5CFTA 4MF2A 9ICMA 1F5AA 3UQ0A 4UB1A 3RJFA 5F2VO 4YCXA 4O68A 2BPGA 4EGWA 3MGHA 4RPYA 4UB3A 8ICQA 8ICAA 4NXXA 9ICXA 4O69A 3B0YA 1TVAA 7ICJA 4RWPA 3C5GA 2ISPA 2DR9A 2M2TA 3TFSA 4IQWA 2NRKA 4QZAA 1TFYA 4E7XA 4KLOA 3HX0A 4FO6A 4O5KA 4F5NA 4TUSA 4AT7A 4AT7B 3OV7A 8ICXA 4E80A 4PGQA 2DR7A 5CFUA 2ZH9A 3UXPA 4FHVA 4WH5A 5HRBA 4WC6A 4WC2A 5J2EA 4QZDA 3JYYA 5CFSA 9ICUA 4EBJA 4KLLA 4M2YA 4KM5A 4RWOA 4P4MA 3RH6A 3MCRA 3HIYA 1R8CA 4OAFA 3HW8A 1MIWA 4KLEA 1JAJA 4X4NA 4M5DA 4KLJA 4MFFA 5DB8A 4TURA 3EF2A 4YD2A 8ICTA 9ICKA 4M9LA 4I2AA 4JWNA 8ICRA 4DOCA 9ICCA 5DDYA 4JLZA 5J2AA 4EBKA 1ZQJA 3L9DA 5D62A 4X4QA 4QZEA 4X4VA 1R8AA 4NXTA 3UQ2A 1MQ3A 3C5FA 2GWSA 4EV6A 3B0XA 4HX0A 4I2FA 1TFWA 2ZH7A 2RFFA 4RQ3A 7ICIA 9ICLA 7ICLA 2GAFD 4FHXA 3OUYB 3RH4A 3ISCA 4XQ8A 4O5CA 4X4PA 3RJGA 5J0PA 5BOMA 8ICKA 4KB6A 4M9HA 2EWRA 4KLDA 1Q78A 3C66A 2ZH4A 2FMSA 5HR9A 2ZH8A 4WCWA 1ZQHA 1ZQKA 4QZGA 4PH5A 7ICVA 3AQLA 5J2FA 3H37A 3UPSA 2HN2A 4NM1A 3K75D 4QZ9A 5J2DA 9ICBA 2ID1A 2Q66A 1ZQBA 2P66A 2BBJA 4NKUA 4KLTA 9ICGA 5DEDA 2B4VA 9ICFA 5IILA 3JPRA 3AQMA 3PNCA 3JPPA 4TUPA 4PGXA 1UEVA 4JLXA 3H39A 1ZQYA 4F5RA 1KEJA 2IUBA 1BPYA 1JQRA 1ZQRA 4I2DA 1Q79A 4MF8A 1ZQUA 3HJ4A 4UB4A 4M9GA 4S3NA 4UD5A 5DKWA 2FMQA 1YLQA 4WBYA 1BPDA 4RPXA 5CJ7A 1ZJNA 5J0RA 5HRFA 3RJEA 4M47A 5BOLA 5D49A 5J0TA 8ICLA 2B51A 5HREA 1ZQTA 4M9NA 4M0AA 4QZIA 9ICAA 2PXIA 3MGIA 3JPNA 1MIVA 5J0WA 4K9AA 1ZQNA 3OVAA 5HHHA 3UPQA 3WFOA 4YMMA 5D4BA 2IHMA 4I2EA 5JTGA 8ICSA 4NY8A 7ICHA 5TZVA 4KLUA 3H3AA 4K97A 8ICJA 4EEDA 4WOYA 4FHWA 8ICUA 4RQ5A 2BCVA 2BCUA 9ICNA 5DBBA 7ICGA 2BBHA 4QZFA 5B3PA 8ICGA 7ICMA 4K4IA 1VFGA 2I9GA 1KNYA 3K7DA 2PFPA 1PX5A 1GPJA 4AT9A 4LEWA 5DDMA 2ZH3A 4DO9A 7ICTA 4MKPA 9ICPA 4UD4A 4WQKA 4LT6A 5IIIA 7ICOA 2DR8A 4OAHA 4X4SA 3JZ0A 2FMPA 4M9JA 8ICPA 5IIOA 2BCRA 8ICBA 4I2CA 1HUZA 4WC0A 5DB6A 4RQ2A 3C2LA 5J2BA 3WFRE 5J0YA 1ZQWA 5CHGA 4XA5A 3NWIA 1BPBA 3RJKA 1BPEA 1ZQSA 3OVSA 3ER8C 4RT3A 1VJ7A 2DRBA 3NKUA 4FH3A 3WFPA 2ISOA 3JPSA 2ZH5A 3JPTA 2M2WA 3PMLA 4PGYA 3LK9A 4K4HA 4I2GA 1ZQVA 8ICHA 4RQ1A 1V4AA 5HHIA 3C2KA 4NKTA 3OWGA 4KLIA 3RJHA 8ICCA 1OU5A 3JPQA 2DR5A 1WOTA 4RWNA 4PHDA 3AQNA 4UAWA 4GXIA 4WC5A 8ICVA 9ICRA 8ICYA 1ZQLA 1R8BA 4X0AA 2B56A 4M04A 4IQVA 4P4PA 4FHYA 4I28A 4NXUA 1ZQCA 8ICWA 4RWQA 7ICKA 4KLSA 8ICOA 5CP2A 2ZHBA 4E8FA 4MFCA 3TFRA 1MIYA 1NOMA 4K4GA 2BE3A 3V7KA 4RQ8A 2PFOA 5D63A 4YD1A 4I2HA 4WBZA 4X4UA 1ZQOA 1RZTA 1RPLA 5HRHA 3V72A 1JN3A 4K99A 3PHZA 4X5VA 3ISDA 4X0BA 7ICNA 8ICFA 2BPCA 4RPZA 4DOAA 4RT2A 3UXOA 5J2HA 4K8VA 5J0SA 8ICEA 4LEVA 2HHPA 4QZCA 4I29A 4Z6DA 2M2VA 5J0XA 4DOBA 4AT8A 3H38A 2DVIA 9ICEA 9ICVA 2IHOA 4RQ4A 4KLGA 1ZQPA 5J2CA 3NVOA 1ZQGA 2PFQA 7ICSA 5J2IA 4I2BA 4LZGA 2DRAA 4Z6FA 4UB5A 4FHPA 5J0QA 5J2KA 2ZH6A 4LZDA 4R65A 5J0UA 4K9BA 3V7JA 4ATBA 4GXKA 4ATBB 4O67A 4YMOA 3MDCA 3JCFA 9ICTA 1JMSA 4I27A 4IQTA 5HRIA 3JPOA 7ICFA 5HC9A 4X4OA 5D46A 5DBAA 3RJIA 1KDHA 5DBCA 4X4TA 5J2GA 4XRHA 4NLKA 3C2MA 4UB2A 4OAGA 8ICZA 5EOZA 1R89A 1ZQDA 3NYBA 2BCQA 3ISBA 5DB7A 5HRDA 2W9MA 3RH5A 1UEUA 3HJ1A 4QZ8A 5HRLA 3RJJA 9ICSA 4WC3A 4P4OA 4EEBA 3LQCB 4I2JA 5CHEA 4LEYA 2GA9D 1HUOA 4QZHA 2VANA 4AT9B 8ICIA 3C18A 3OVBA 4EP7A 8ICNA 3CK6A 4WC1A 4RQ6A 9ICWA 5HRKA 1TV9A 4NLZA 4UBCA 5IIKA 5BPCA 5HRGA 3AQKA 7ICQA 4O9MA 4MFAA 4KLFA 2PBEA 4WC7A 2PFNA 2M2UA 4KLQA 4I2IA 3OGUA 3ERCC 5DECA 4F5PA 4KLHA 3V7LA 2O1PA 3WFQE 4F5OA 4IQUA 5J2JA 4RQ7A 1XSNA 5IIMA 5IIJA 3ER9B 3UXNA 1ZQAA 4NXWA 4PHEA 7ICUA 4YMNA 3AU2A 4N7RA 7ICRA 1NO5A 4WQLA 4WC4A 1ZQXA 1ZQFA 5B3QA 4LEZA 4K98A 2BCSA 5CA7A 4FH5A 4UAYA 4NXVA 1BPXA 4X4RA 4Z6CA 4TUQA 9ICIA 2O5AA 4NM2A 5IINA 1ZQMA 1MQ2A 5CB1A 8ICMA 9ICQA 4K96A 5DB9A 1ZQZA 1ZQQA 2BPFA 4NLNA 7ICPA 4YN4A 1ZQEA 3AUOA 5J29A 4R66A 4GXJA 3OUYA 1XSPA 4PHPA 9ICOA 1BPZA 4O5EA
chains in the Genus database with same CATH topology
4QZBA 4UAZA 3WFSC 5CR0A 4O6AA 4R63A 4PPXA 3MDAA 4PHAA 4KLMA 3HWTA 3PMNA 4R64A 4XUSA 4NXZA 4LVSA 4RQ0A 4AT8B 4JWMA 3AU6A 3MBYA 5CWRA 2ZHAA 3GDXA 4Z6EA 1ZQIA 5J0OA 9ICHA 9ICJA 4UBBA 4OAIZ 2ZH2A 4XQ7A 4IG8A 4F5QA 1FA0A 7ICEA 2ZH1A 1XSLA 4P2HA 1UETA 1ZJMA 4MF2A 9ICMA 1F5AA 3UQ0A 4UB1A 3RJFA 5F2VO 4YCXA 4O68A 2BPGA 3MGHA 4RPYA 4UB3A 8ICQA 8ICAA 4NXXA 9ICXA 4O69A 3B0YA 1TVAA 7ICJA 4RWPA 3C5GA 2ISPA 2DR9A 2M2TA 3TFSA 4IQWA 2NRKA 4QZAA 1TFYA 4E7XA 4KLOA 3HX0A 4FO6A 4O5KA 4F5NA 4TUSA 4AT7A 4AT7B 3OV7A 8ICXA 4E80A 4PGQA 2DR7A 2ZH9A 3UXPA 4FHVA 5HRBA 4WC6A 4WC2A 5J2EA 4QZDA 3JYYA 9ICUA 4EBJA 4KLLA 4M2YA 4KM5A 4RWOA 4P4MA 3RH6A 3HIYA 1R8CA 4OAFA 3HW8A 1MIWA 4KLEA 1JAJA 4X4NA 4M5DA 4KLJA 4MFFA 5DB8A 4TURA 4YD2A 8ICTA 9ICKA 4M9LA 4I2AA 4JWNA 8ICRA 4DOCA 9ICCA 5DDYA 4JLZA 5J2AA 4EBKA 1ZQJA 3L9DA 4X4QA 4QZEA 4X4VA 1R8AA 4NXTA 3UQ2A 1MQ3A 3C5FA 2GWSA 3B0XA 4I2FA 1TFWA 2ZH7A 2RFFA 4RQ3A 7ICIA 9ICLA 7ICLA 3OUYB 4FHXA 3RH4A 3ISCA 4XQ8A 4O5CA 4X4PA 3RJGA 5J0PA 5BOMA 8ICKA 4KB6A 4M9HA 4KLDA 1Q78A 3C66A 2ZH4A 2FMSA 5HR9A 2ZH8A 4WCWA 1ZQHA 1ZQKA 4QZGA 4PH5A 7ICVA 3AQLA 5J2FA 3H37A 3UPSA 4NM1A 3K75D 4QZ9A 5J2DA 9ICBA 2ID1A 2Q66A 1ZQBA 2P66A 4NKUA 4KLTA 9ICGA 5DEDA 2B4VA 9ICFA 5IILA 3JPRA 3AQMA 3PNCA 3JPPA 4TUPA 4PGXA 1UEVA 4JLXA 3H39A 1ZQYA 4F5RA 1KEJA 1JQRA 1BPYA 1ZQRA 4I2DA 1Q79A 4MF8A 1ZQUA 3HJ4A 4UB4A 4M9GA 4S3NA 4UD5A 5DKWA 2FMQA 1YLQA 4WBYA 4RPXA 1BPDA 5CJ7A 1ZJNA 5J0RA 5HRFA 3RJEA 4M47A 5BOLA 5D49A 5J0TA 8ICLA 2B51A 5HREA 1ZQTA 4M9NA 4M0AA 4QZIA 9ICAA 2PXIA 3MGIA 3JPNA 1MIVA 5J0WA 4K9AA 1ZQNA 3OVAA 5HHHA 3UPQA 3WFOA 4YMMA 5D4BA 2IHMA 4I2EA 8ICSA 4NY8A 7ICHA 5TZVA 4KLUA 3H3AA 4K97A 8ICJA 4WOYA 4FHWA 8ICUA 4RQ5A 2BCVA 2BCUA 9ICNA 5DBBA 7ICGA 4QZFA 8ICGA 7ICMA 4K4IA 1VFGA 2I9GA 1KNYA 2PFPA 1PX5A 4AT9A 4LEWA 5DDMA 2ZH3A 4DO9A 7ICTA 4MKPA 9ICPA 4UD4A 4LT6A 5IIIA 7ICOA 2DR8A 4OAHA 4X4SA 3JZ0A 2FMPA 4M9JA 8ICPA 5IIOA 2BCRA 8ICBA 4I2CA 1HUZA 4WC0A 5DB6A 4RQ2A 3C2LA 5J2BA 3WFRE 5J0YA 1ZQWA 5CHGA 4XA5A 1BPBA 3RJKA 1BPEA 1ZQSA 3OVSA 4RT3A 1VJ7A 2DRBA 4FH3A 3WFPA 2ISOA 3JPSA 2ZH5A 3JPTA 2M2WA 3PMLA 4PGYA 3LK9A 4K4HA 4I2GA 1ZQVA 8ICHA 4RQ1A 1V4AA 5HHIA 3C2KA 4NKTA 4KLIA 3RJHA 8ICCA 1OU5A 3JPQA 2DR5A 1WOTA 4PHDA 4RWNA 3AQNA 4UAWA 4GXIA 4WC5A 8ICVA 9ICRA 8ICYA 1ZQLA 1R8BA 4X0AA 2B56A 4M04A 4IQVA 4P4PA 4FHYA 4I28A 4NXUA 1ZQCA 8ICWA 4RWQA 7ICKA 4KLSA 8ICOA 5CP2A 2ZHBA 4E8FA 4MFCA 3TFRA 1MIYA 1NOMA 4K4GA 2BE3A 3V7KA 4RQ8A 2PFOA 4YD1A 4I2HA 4WBZA 4X4UA 1ZQOA 1RZTA 1RPLA 5HRHA 3V72A 1JN3A 4K99A 4X5VA 7ICNA 3ISDA 4X0BA 8ICFA 2BPCA 4RPZA 4DOAA 4RT2A 3UXOA 5J2HA 4K8VA 5J0SA 8ICEA 4LEVA 2HHPA 4QZCA 4I29A 4Z6DA 2M2VA 5J0XA 4DOBA 4AT8A 3H38A 2DVIA 9ICEA 9ICVA 4RQ4A 4KLGA 1ZQPA 5J2CA 1ZQGA 2PFQA 7ICSA 5J2IA 4I2BA 4LZGA 2DRAA 4Z6FA 4UB5A 4FHPA 5J0QA 5J2KA 2ZH6A 4LZDA 4R65A 5J0UA 4K9BA 3V7JA 4ATBA 4GXKA 4ATBB 4O67A 4YMOA 3MDCA 9ICTA 1JMSA 4I27A 4IQTA 5HRIA 3JPOA 7ICFA 5HC9A 4X4OA 5D46A 5DBAA 3RJIA 1KDHA 5DBCA 4X4TA 5J2GA 4XRHA 4NLKA 3C2MA 4UB2A 4OAGA 8ICZA 5EOZA 1R89A 1ZQDA 3NYBA 2BCQA 3ISBA 5HRDA 5DB7A 2W9MA 3RH5A 1UEUA 3HJ1A 4QZ8A 5HRLA 3RJJA 9ICSA 4WC3A 4P4OA 3LQCB 4I2JA 4LEYA 1HUOA 4QZHA 2VANA 4AT9B 8ICIA 3C18A 3OVBA 4EP7A 8ICNA 4WC1A 4RQ6A 9ICWA 5HRKA 1TV9A 4NLZA 4UBCA 5IIKA 5BPCA 5HRGA 3AQKA 7ICQA 4O9MA 4MFAA 4KLFA 2PBEA 4WC7A 2PFNA 2M2UA 4KLQA 4I2IA 3OGUA 5DECA 4F5PA 4KLHA 3V7LA 2O1PA 3WFQE 4F5OA 4IQUA 5J2JA 4RQ7A 1XSNA 5IIMA 5IIJA 3UXNA 1ZQAA 4NXWA 4PHEA 7ICUA 4YMNA 3AU2A 7ICRA 1NO5A 4WC4A 1ZQXA 1ZQFA 4LEZA 4K98A 2BCSA 5CA7A 4FH5A 4UAYA 4NXVA 1BPXA 4X4RA 4Z6CA 4TUQA 9ICIA 2O5AA 4NM2A 5IINA 1ZQMA 1MQ2A 5CB1A 8ICMA 9ICQA 4K96A 5DB9A 1ZQZA 1ZQQA 2BPFA 4NLNA 7ICPA 4YN4A 1ZQEA 3AUOA 5J29A 4R66A 4GXJA 3OUYA 1XSPA 4PHPA 9ICOA 1BPZA 4O5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QZB A;  4UAZ A;  3WFS C;  5CR0 A;  4R63 A;  4PPX A;  3MDA A;  4PHA A;  4KLM A;  3HWT A;  3PMN A;  4R64 A;  4XUS A;  4NXZ A;  4LVS A;  4RQ0 A;  4AT8 B;  4JWM A;  3AU6 A;  3MBY A;  5CWR A;  2ZHA A;  3GDX A;  4Z6E A;  1ZQI A;  5J0O A;  9ICH A;  9ICJ A;  4UBB A;  2ZH2 A;  4XQ7 A;  4IG8 A;  4F5Q A;  1FA0 A;  7ICE A;  2ZH1 A;  1XSL A;  4P2H A;  1UET A;  1ZJM A;  4MF2 A;  9ICM A;  1F5A A;  3UQ0 A;  4UB1 A;  3RJF A;  5F2V O;  4YCX A;  2BPG A;  3MGH A;  4RPY A;  4UB3 A;  8ICQ A;  8ICA A;  9ICX A;  3B0Y A;  1TVA A;  7ICJ A;  4RWP A;  3C5G A;  2ISP A;  2DR9 A;  2M2T A;  3TFS A;  4IQW A;  2NRK A;  4QZA A;  1TFY A;  4E7X A;  4KLO A;  3HX0 A;  4FO6 A;  4O5K A;  4F5N A;  4TUS A;  4AT7 A;  4AT7 B;  3OV7 A;  8ICX A;  4E80 A;  4PGQ A;  2DR7 A;  2ZH9 A;  3UXP A;  4FHV A;  5HRB A;  4WC6 A;  4WC2 A;  5J2E A;  4QZD A;  3JYY A;  9ICU A;  4EBJ A;  4KLL A;  4M2Y A;  4RWO A;  4P4M A;  3RH6 A;  3HIY A;  1R8C A;  3HW8 A;  1MIW A;  4KLE A;  1JAJ A;  4X4N A;  4M5D A;  4KLJ A;  4MFF A;  5DB8 A;  4TUR A;  4YD2 A;  8ICT A;  9ICK A;  4M9L A;  4I2A A;  4JWN A;  8ICR A;  4DOC A;  9ICC A;  5DDY A;  5J2A A;  4EBK A;  1ZQJ A;  3L9D A;  4X4Q A;  4QZE A;  4X4V A;  1R8A A;  3UQ2 A;  1MQ3 A;  3C5F A;  2GWS A;  3B0X A;  4I2F A;  1TFW A;  2ZH7 A;  2RFF A;  4RQ3 A;  7ICI A;  9ICL A;  7ICL A;  4FHX A;  3OUY B;  3RH4 A;  3ISC A;  4XQ8 A;  4O5C A;  4X4P A;  3RJG A;  5J0P A;  5BOM A;  8ICK A;  4M9H A;  4KLD A;  1Q78 A;  3C66 A;  2ZH4 A;  2FMS A;  5HR9 A;  4WCW A;  2ZH8 A;  1ZQH A;  1ZQK A;  4QZG A;  4PH5 A;  7ICV A;  3AQL A;  5J2F A;  3H37 A;  3UPS A;  4NM1 A;  3K75 D;  4QZ9 A;  5J2D A;  9ICB A;  2ID1 A;  2Q66 A;  1ZQB A;  2P66 A;  4NKU A;  4KLT A;  9ICG A;  5DED A;  2B4V A;  9ICF A;  5IIL A;  3JPR A;  3AQM A;  3PNC A;  3JPP A;  4TUP A;  4PGX A;  1UEV A;  3H39 A;  1ZQY A;  4F5R A;  1KEJ A;  1JQR A;  1BPY A;  1ZQR A;  4I2D A;  1Q79 A;  4MF8 A;  1ZQU A;  3HJ4 A;  4UB4 A;  4M9G A;  4S3N A;  4UD5 A;  5DKW A;  2FMQ A;  1YLQ A;  4WBY A;  1BPD A;  4RPX A;  5CJ7 A;  1ZJN A;  5J0R A;  5HRF A;  3RJE A;  4M47 A;  5BOL A;  5D49 A;  5J0T A;  8ICL A;  2B51 A;  5HRE A;  1ZQT A;  4M9N A;  4M0A A;  4QZI A;  9ICA A;  2PXI A;  3MGI A;  3JPN A;  1MIV A;  5J0W A;  1ZQN A;  5HHH A;  3OVA A;  3UPQ A;  3WFO A;  4YMM A;  5D4B A;  2IHM A;  4I2E A;  8ICS A;  4NY8 A;  7ICH A;  5TZV A;  4KLU A;  3H3A A;  8ICJ A;  4FHW A;  8ICU A;  4RQ5 A;  2BCV A;  2BCU A;  9ICN A;  5DBB A;  7ICG A;  4QZF A;  8ICG A;  7ICM A;  4K4I A;  1VFG A;  2I9G A;  1KNY A;  2PFP A;  1PX5 A;  4AT9 A;  5DDM A;  2ZH3 A;  4DO9 A;  7ICT A;  9ICP A;  4UD4 A;  4LT6 A;  5III A;  7ICO A;  2DR8 A;  4X4S A;  3JZ0 A;  2FMP A;  4M9J A;  8ICP A;  5IIO A;  2BCR A;  8ICB A;  4I2C A;  1HUZ A;  4WC0 A;  5DB6 A;  4RQ2 A;  3C2L A;  5J2B A;  3WFR E;  5J0Y A;  1ZQW A;  5CHG A;  4XA5 A;  1BPB A;  3RJK A;  1BPE A;  1ZQS A;  3OVS A;  4RT3 A;  1VJ7 A;  2DRB A;  4FH3 A;  3WFP A;  2ISO A;  3JPS A;  2ZH5 A;  3JPT A;  2M2W A;  3PML A;  4PGY A;  3LK9 A;  4K4H A;  4I2G A;  1ZQV A;  8ICH A;  4RQ1 A;  1V4A A;  5HHI A;  3C2K A;  4NKT A;  4KLI A;  3RJH A;  8ICC A;  1OU5 A;  3JPQ A;  1WOT A;  2DR5 A;  4PHD A;  4RWN A;  3AQN A;  4UAW A;  4GXI A;  4WC5 A;  8ICV A;  9ICR A;  8ICY A;  1ZQL A;  1R8B A;  4X0A A;  2B56 A;  4M04 A;  4IQV A;  4P4P A;  4FHY A;  4I28 A;  1ZQC A;  8ICW A;  4RWQ A;  7ICK A;  4KLS A;  8ICO A;  5CP2 A;  2ZHB A;  4E8F A;  4MFC A;  3TFR A;  1MIY A;  1NOM A;  4K4G A;  2BE3 A;  3V7K A;  4RQ8 A;  2PFO A;  4YD1 A;  4I2H A;  4WBZ A;  4X4U A;  1ZQO A;  1RZT A;  1RPL A;  5HRH A;  3V72 A;  1JN3 A;  4X5V A;  7ICN A;  3ISD A;  4X0B A;  8ICF A;  2BPC A;  4RPZ A;  4DOA A;  4RT2 A;  3UXO A;  5J2H A;  5J0S A;  8ICE A;  2HHP A;  4QZC A;  4I29 A;  4Z6D A;  2M2V A;  5J0X A;  4DOB A;  4AT8 A;  3H38 A;  2DVI A;  9ICE A;  9ICV A;  4RQ4 A;  4KLG A;  1ZQP A;  5J2C A;  1ZQG A;  2PFQ A;  7ICS A;  5J2I A;  4I2B A;  4LZG A;  2DRA A;  4Z6F A;  4UB5 A;  4FHP A;  5J0Q A;  5J2K A;  2ZH6 A;  4LZD A;  4R65 A;  5J0U A;  3V7J A;  4ATB A;  4GXK A;  4ATB B;  4YMO A;  3MDC A;  9ICT A;  1JMS A;  4I27 A;  4IQT A;  5HRI A;  3JPO A;  7ICF A;  5HC9 A;  4X4O A;  5D46 A;  5DBA A;  3RJI A;  1KDH A;  5DBC A;  5J2G A;  4X4T A;  4XRH A;  4NLK A;  3C2M A;  4UB2 A;  8ICZ A;  5EOZ A;  1R89 A;  1ZQD A;  3NYB A;  2BCQ A;  3ISB A;  5HRD A;  5DB7 A;  2W9M A;  3RH5 A;  1UEU A;  3HJ1 A;  4QZ8 A;  5HRL A;  3RJJ A;  9ICS A;  4WC3 A;  4P4O A;  3LQC B;  4I2J A;  1HUO A;  4QZH A;  2VAN A;  4AT9 B;  8ICI A;  3C18 A;  3OVB A;  4EP7 A;  8ICN A;  4WC1 A;  4RQ6 A;  9ICW A;  5HRK A;  1TV9 A;  4NLZ A;  4UBC A;  5IIK A;  5BPC A;  5HRG A;  3AQK A;  7ICQ A;  4O9M A;  4MFA A;  4KLF A;  2PBE A;  4WC7 A;  2PFN A;  2M2U A;  4KLQ A;  4I2I A;  3OGU A;  5DEC A;  4F5P A;  4KLH A;  3V7L A;  2O1P A;  3WFQ E;  4F5O A;  4IQU A;  5J2J A;  4RQ7 A;  1XSN A;  5IIM A;  5IIJ A;  3UXN A;  1ZQA A;  7ICU A;  4PHE A;  4YMN A;  3AU2 A;  7ICR A;  1NO5 A;  4WC4 A;  1ZQX A;  1ZQF A;  2BCS A;  5CA7 A;  4FH5 A;  4UAY A;  1BPX A;  4X4R A;  4Z6C A;  4TUQ A;  9ICI A;  2O5A A;  4NM2 A;  5IIN A;  1ZQM A;  1MQ2 A;  5CB1 A;  8ICM A;  9ICQ A;  5DB9 A;  1ZQQ A;  1ZQZ A;  2BPF A;  4NLN A;  7ICP A;  4YN4 A;  1ZQE A;  3AUO A;  5J29 A;  4R66 A;  4GXJ A;  3OUY A;  1XSP A;  4PHP A;  9ICO A;  1BPZ A;  4O5E A; 
#chains in the Genus database with same CATH topology
 4QZB A;  2HN1 A;  4UAZ A;  3WFS C;  5CR0 A;  4O6A A;  4R63 A;  4PPX A;  3MDA A;  4PHA A;  4KLM A;  3HWT A;  3PMN A;  4R64 A;  4XUS A;  4NXZ A;  4LVS A;  4RQ0 A;  4AT8 B;  4JWM A;  3AU6 A;  3MBY A;  5CWR A;  2ZHA A;  3GDX A;  4Z6E A;  1ZQI A;  5J0O A;  9ICH A;  9ICJ A;  4UBB A;  4OAI Z;  2ZH2 A;  4FO1 A;  4XQ7 A;  4I0U A;  4IG8 A;  4XJE A;  4F5Q A;  1FA0 A;  7ICE A;  2ZH1 A;  1XSL A;  4P2H A;  2FCL A;  5D61 A;  1UET A;  1ZJM A;  5CFT A;  4MF2 A;  9ICM A;  1F5A A;  3UQ0 A;  4UB1 A;  3RJF A;  5F2V O;  4YCX A;  4O68 A;  2BPG A;  4EGW A;  3MGH A;  4RPY A;  4UB3 A;  8ICQ A;  8ICA A;  4NXX A;  9ICX A;  4O69 A;  3B0Y A;  1TVA A;  7ICJ A;  4RWP A;  3C5G A;  2ISP A;  2DR9 A;  2M2T A;  3TFS A;  4IQW A;  2NRK A;  4QZA A;  1TFY A;  4E7X A;  4KLO A;  3HX0 A;  4FO6 A;  4O5K A;  4F5N A;  4TUS A;  4AT7 A;  4AT7 B;  3OV7 A;  8ICX A;  4E80 A;  4PGQ A;  2DR7 A;  5CFU A;  2ZH9 A;  3UXP A;  4FHV A;  4WH5 A;  5HRB A;  4WC6 A;  4WC2 A;  5J2E A;  4QZD A;  3JYY A;  5CFS A;  9ICU A;  4EBJ A;  4KLL A;  4M2Y A;  4KM5 A;  4RWO A;  4P4M A;  3RH6 A;  3MCR A;  3HIY A;  1R8C A;  4OAF A;  3HW8 A;  1MIW A;  4KLE A;  1JAJ A;  4X4N A;  4M5D A;  4KLJ A;  4MFF A;  5DB8 A;  4TUR A;  3EF2 A;  4YD2 A;  8ICT A;  9ICK A;  4M9L A;  4I2A A;  4JWN A;  8ICR A;  4DOC A;  9ICC A;  5DDY A;  4JLZ A;  5J2A A;  4EBK A;  1ZQJ A;  3L9D A;  5D62 A;  4X4Q A;  4QZE A;  4X4V A;  1R8A A;  4NXT A;  3UQ2 A;  1MQ3 A;  3C5F A;  2GWS A;  4EV6 A;  3B0X A;  4HX0 A;  4I2F A;  1TFW A;  2ZH7 A;  2RFF A;  4RQ3 A;  7ICI A;  9ICL A;  7ICL A;  2GAF D;  4FHX A;  3OUY B;  3RH4 A;  3ISC A;  4XQ8 A;  4O5C A;  4X4P A;  3RJG A;  5J0P A;  5BOM A;  8ICK A;  4KB6 A;  4M9H A;  2EWR A;  4KLD A;  1Q78 A;  3C66 A;  2ZH4 A;  2FMS A;  5HR9 A;  2ZH8 A;  4WCW A;  1ZQH A;  1ZQK A;  4QZG A;  4PH5 A;  7ICV A;  3AQL A;  5J2F A;  3H37 A;  3UPS A;  2HN2 A;  4NM1 A;  3K75 D;  4QZ9 A;  5J2D A;  9ICB A;  2ID1 A;  2Q66 A;  1ZQB A;  2P66 A;  2BBJ A;  4NKU A;  4KLT A;  9ICG A;  5DED A;  2B4V A;  9ICF A;  5IIL A;  3JPR A;  3AQM A;  3PNC A;  3JPP A;  4TUP A;  4PGX A;  1UEV A;  4JLX A;  3H39 A;  1ZQY A;  4F5R A;  1KEJ A;  2IUB A;  1BPY A;  1JQR A;  1ZQR A;  4I2D A;  1Q79 A;  4MF8 A;  1ZQU A;  3HJ4 A;  4UB4 A;  4M9G A;  4S3N A;  4UD5 A;  5DKW A;  2FMQ A;  1YLQ A;  4WBY A;  1BPD A;  4RPX A;  5CJ7 A;  1ZJN A;  5J0R A;  5HRF A;  3RJE A;  4M47 A;  5BOL A;  5D49 A;  5J0T A;  8ICL A;  2B51 A;  5HRE A;  1ZQT A;  4M9N A;  4M0A A;  4QZI A;  9ICA A;  2PXI A;  3MGI A;  3JPN A;  1MIV A;  5J0W A;  4K9A A;  1ZQN A;  3OVA A;  5HHH A;  3UPQ A;  3WFO A;  4YMM A;  5D4B A;  2IHM A;  4I2E A;  5JTG A;  8ICS A;  4NY8 A;  7ICH A;  5TZV A;  4KLU A;  3H3A A;  4K97 A;  8ICJ A;  4EED A;  4WOY A;  4FHW A;  8ICU A;  4RQ5 A;  2BCV A;  2BCU A;  9ICN A;  5DBB A;  7ICG A;  2BBH A;  4QZF A;  5B3P A;  8ICG A;  7ICM A;  4K4I A;  1VFG A;  2I9G A;  1KNY A;  3K7D A;  2PFP A;  1PX5 A;  1GPJ A;  4AT9 A;  4LEW A;  5DDM A;  2ZH3 A;  4DO9 A;  7ICT A;  4MKP A;  9ICP A;  4UD4 A;  4WQK A;  4LT6 A;  5III A;  7ICO A;  2DR8 A;  4OAH A;  4X4S A;  3JZ0 A;  2FMP A;  4M9J A;  8ICP A;  5IIO A;  2BCR A;  8ICB A;  4I2C A;  1HUZ A;  4WC0 A;  5DB6 A;  4RQ2 A;  3C2L A;  5J2B A;  3WFR E;  5J0Y A;  1ZQW A;  5CHG A;  4XA5 A;  3NWI A;  1BPB A;  3RJK A;  1BPE A;  1ZQS A;  3OVS A;  3ER8 C;  4RT3 A;  1VJ7 A;  2DRB A;  3NKU A;  4FH3 A;  3WFP A;  2ISO A;  3JPS A;  2ZH5 A;  3JPT A;  2M2W A;  3PML A;  4PGY A;  3LK9 A;  4K4H A;  4I2G A;  1ZQV A;  8ICH A;  4RQ1 A;  1V4A A;  5HHI A;  3C2K A;  4NKT A;  3OWG A;  4KLI A;  3RJH A;  8ICC A;  1OU5 A;  3JPQ A;  2DR5 A;  1WOT A;  4RWN A;  4PHD A;  3AQN A;  4UAW A;  4GXI A;  4WC5 A;  8ICV A;  9ICR A;  8ICY A;  1ZQL A;  1R8B A;  4X0A A;  2B56 A;  4M04 A;  4IQV A;  4P4P A;  4FHY A;  4I28 A;  4NXU A;  1ZQC A;  8ICW A;  4RWQ A;  7ICK A;  4KLS A;  8ICO A;  5CP2 A;  2ZHB A;  4E8F A;  4MFC A;  3TFR A;  1MIY A;  1NOM A;  4K4G A;  2BE3 A;  3V7K A;  4RQ8 A;  2PFO A;  5D63 A;  4YD1 A;  4I2H A;  4WBZ A;  4X4U A;  1ZQO A;  1RZT A;  1RPL A;  5HRH A;  3V72 A;  1JN3 A;  4K99 A;  3PHZ A;  4X5V A;  3ISD A;  4X0B A;  7ICN A;  8ICF A;  2BPC A;  4RPZ A;  4DOA A;  4RT2 A;  3UXO A;  5J2H A;  4K8V A;  5J0S A;  8ICE A;  4LEV A;  2HHP A;  4QZC A;  4I29 A;  4Z6D A;  2M2V A;  5J0X A;  4DOB A;  4AT8 A;  3H38 A;  2DVI A;  9ICE A;  9ICV A;  2IHO A;  4RQ4 A;  4KLG A;  1ZQP A;  5J2C A;  3NVO A;  1ZQG A;  2PFQ A;  7ICS A;  5J2I A;  4I2B A;  4LZG A;  2DRA A;  4Z6F A;  4UB5 A;  4FHP A;  5J0Q A;  5J2K A;  2ZH6 A;  4LZD A;  4R65 A;  5J0U A;  4K9B A;  3V7J A;  4ATB A;  4GXK A;  4ATB B;  4O67 A;  4YMO A;  3MDC A;  3JCF A;  9ICT A;  1JMS A;  4I27 A;  4IQT A;  5HRI A;  3JPO A;  7ICF A;  5HC9 A;  4X4O A;  5D46 A;  5DBA A;  3RJI A;  1KDH A;  5DBC A;  4X4T A;  5J2G A;  4XRH A;  4NLK A;  3C2M A;  4UB2 A;  4OAG A;  8ICZ A;  5EOZ A;  1R89 A;  1ZQD A;  3NYB A;  2BCQ A;  3ISB A;  5DB7 A;  5HRD A;  2W9M A;  3RH5 A;  1UEU A;  3HJ1 A;  4QZ8 A;  5HRL A;  3RJJ A;  9ICS A;  4WC3 A;  4P4O A;  4EEB A;  3LQC B;  4I2J A;  5CHE A;  4LEY A;  2GA9 D;  1HUO A;  4QZH A;  2VAN A;  4AT9 B;  8ICI A;  3C18 A;  3OVB A;  4EP7 A;  8ICN A;  3CK6 A;  4WC1 A;  4RQ6 A;  9ICW A;  5HRK A;  1TV9 A;  4NLZ A;  4UBC A;  5IIK A;  5BPC A;  5HRG A;  3AQK A;  7ICQ A;  4O9M A;  4MFA A;  4KLF A;  2PBE A;  4WC7 A;  2PFN A;  2M2U A;  4KLQ A;  4I2I A;  3OGU A;  3ERC C;  5DEC A;  4F5P A;  4KLH A;  3V7L A;  2O1P A;  3WFQ E;  4F5O A;  4IQU A;  5J2J A;  4RQ7 A;  1XSN A;  5IIM A;  5IIJ A;  3ER9 B;  3UXN A;  1ZQA A;  4NXW A;  4PHE A;  7ICU A;  4YMN A;  3AU2 A;  4N7R A;  7ICR A;  1NO5 A;  4WQL A;  4WC4 A;  1ZQX A;  1ZQF A;  5B3Q A;  4LEZ A;  4K98 A;  2BCS A;  5CA7 A;  4FH5 A;  4UAY A;  4NXV A;  1BPX A;  4X4R A;  4Z6C A;  4TUQ A;  9ICI A;  2O5A A;  4NM2 A;  5IIN A;  1ZQM A;  1MQ2 A;  5CB1 A;  8ICM A;  9ICQ A;  4K96 A;  5DB9 A;  1ZQZ A;  1ZQQ A;  2BPF A;  4NLN A;  7ICP A;  4YN4 A;  1ZQE A;  3AUO A;  5J29 A;  4R66 A;  4GXJ A;  3OUY A;  1XSP A;  4PHP A;  9ICO A;  1BPZ A;  4O5E A; 
#chains in the Genus database with same CATH homology
 4QZB A;  4UAZ A;  3WFS C;  5CR0 A;  4O6A A;  4R63 A;  4PPX A;  3MDA A;  4PHA A;  4KLM A;  3HWT A;  3PMN A;  4R64 A;  4XUS A;  4NXZ A;  4LVS A;  4RQ0 A;  4AT8 B;  4JWM A;  3AU6 A;  3MBY A;  5CWR A;  2ZHA A;  3GDX A;  4Z6E A;  1ZQI A;  5J0O A;  9ICH A;  9ICJ A;  4UBB A;  4OAI Z;  2ZH2 A;  4XQ7 A;  4IG8 A;  4F5Q A;  1FA0 A;  7ICE A;  2ZH1 A;  1XSL A;  4P2H A;  1UET A;  1ZJM A;  4MF2 A;  9ICM A;  1F5A A;  3UQ0 A;  4UB1 A;  3RJF A;  5F2V O;  4YCX A;  4O68 A;  2BPG A;  3MGH A;  4RPY A;  4UB3 A;  8ICQ A;  8ICA A;  4NXX A;  9ICX A;  4O69 A;  3B0Y A;  1TVA A;  7ICJ A;  4RWP A;  3C5G A;  2ISP A;  2DR9 A;  2M2T A;  3TFS A;  4IQW A;  2NRK A;  4QZA A;  1TFY A;  4E7X A;  4KLO A;  3HX0 A;  4FO6 A;  4O5K A;  4F5N A;  4TUS A;  4AT7 A;  4AT7 B;  3OV7 A;  8ICX A;  4E80 A;  4PGQ A;  2DR7 A;  2ZH9 A;  3UXP A;  4FHV A;  5HRB A;  4WC6 A;  4WC2 A;  5J2E A;  4QZD A;  3JYY A;  9ICU A;  4EBJ A;  4KLL A;  4M2Y A;  4KM5 A;  4RWO A;  4P4M A;  3RH6 A;  3HIY A;  1R8C A;  4OAF A;  3HW8 A;  1MIW A;  4KLE A;  1JAJ A;  4X4N A;  4M5D A;  4KLJ A;  4MFF A;  5DB8 A;  4TUR A;  4YD2 A;  8ICT A;  9ICK A;  4M9L A;  4I2A A;  4JWN A;  8ICR A;  4DOC A;  9ICC A;  5DDY A;  4JLZ A;  5J2A A;  4EBK A;  1ZQJ A;  3L9D A;  4X4Q A;  4QZE A;  4X4V A;  1R8A A;  4NXT A;  3UQ2 A;  1MQ3 A;  3C5F A;  2GWS A;  3B0X A;  4I2F A;  1TFW A;  2ZH7 A;  2RFF A;  4RQ3 A;  7ICI A;  9ICL A;  7ICL A;  3OUY B;  4FHX A;  3RH4 A;  3ISC A;  4XQ8 A;  4O5C A;  4X4P A;  3RJG A;  5J0P A;  5BOM A;  8ICK A;  4KB6 A;  4M9H A;  4KLD A;  1Q78 A;  3C66 A;  2ZH4 A;  2FMS A;  5HR9 A;  2ZH8 A;  4WCW A;  1ZQH A;  1ZQK A;  4QZG A;  4PH5 A;  7ICV A;  3AQL A;  5J2F A;  3H37 A;  3UPS A;  4NM1 A;  3K75 D;  4QZ9 A;  5J2D A;  9ICB A;  2ID1 A;  2Q66 A;  1ZQB A;  2P66 A;  4NKU A;  4KLT A;  9ICG A;  5DED A;  2B4V A;  9ICF A;  5IIL A;  3JPR A;  3AQM A;  3PNC A;  3JPP A;  4TUP A;  4PGX A;  1UEV A;  4JLX A;  3H39 A;  1ZQY A;  4F5R A;  1KEJ A;  1JQR A;  1BPY A;  1ZQR A;  4I2D A;  1Q79 A;  4MF8 A;  1ZQU A;  3HJ4 A;  4UB4 A;  4M9G A;  4S3N A;  4UD5 A;  5DKW A;  2FMQ A;  1YLQ A;  4WBY A;  4RPX A;  1BPD A;  5CJ7 A;  1ZJN A;  5J0R A;  5HRF A;  3RJE A;  4M47 A;  5BOL A;  5D49 A;  5J0T A;  8ICL A;  2B51 A;  5HRE A;  1ZQT A;  4M9N A;  4M0A A;  4QZI A;  9ICA A;  2PXI A;  3MGI A;  3JPN A;  1MIV A;  5J0W A;  4K9A A;  1ZQN A;  3OVA A;  5HHH A;  3UPQ A;  3WFO A;  4YMM A;  5D4B A;  2IHM A;  4I2E A;  8ICS A;  4NY8 A;  7ICH A;  5TZV A;  4KLU A;  3H3A A;  4K97 A;  8ICJ A;  4WOY A;  4FHW A;  8ICU A;  4RQ5 A;  2BCV A;  2BCU A;  9ICN A;  5DBB A;  7ICG A;  4QZF A;  8ICG A;  7ICM A;  4K4I A;  1VFG A;  2I9G A;  1KNY A;  2PFP A;  1PX5 A;  4AT9 A;  4LEW A;  5DDM A;  2ZH3 A;  4DO9 A;  7ICT A;  4MKP A;  9ICP A;  4UD4 A;  4LT6 A;  5III A;  7ICO A;  2DR8 A;  4OAH A;  4X4S A;  3JZ0 A;  2FMP A;  4M9J A;  8ICP A;  5IIO A;  2BCR A;  8ICB A;  4I2C A;  1HUZ A;  4WC0 A;  5DB6 A;  4RQ2 A;  3C2L A;  5J2B A;  3WFR E;  5J0Y A;  1ZQW A;  5CHG A;  4XA5 A;  1BPB A;  3RJK A;  1BPE A;  1ZQS A;  3OVS A;  4RT3 A;  1VJ7 A;  2DRB A;  4FH3 A;  3WFP A;  2ISO A;  3JPS A;  2ZH5 A;  3JPT A;  2M2W A;  3PML A;  4PGY A;  3LK9 A;  4K4H A;  4I2G A;  1ZQV A;  8ICH A;  4RQ1 A;  1V4A A;  5HHI A;  3C2K A;  4NKT A;  4KLI A;  3RJH A;  8ICC A;  1OU5 A;  3JPQ A;  2DR5 A;  1WOT A;  4PHD A;  4RWN A;  3AQN A;  4UAW A;  4GXI A;  4WC5 A;  8ICV A;  9ICR A;  8ICY A;  1ZQL A;  1R8B A;  4X0A A;  2B56 A;  4M04 A;  4IQV A;  4P4P A;  4FHY A;  4I28 A;  4NXU A;  1ZQC A;  8ICW A;  4RWQ A;  7ICK A;  4KLS A;  8ICO A;  5CP2 A;  2ZHB A;  4E8F A;  4MFC A;  3TFR A;  1MIY A;  1NOM A;  4K4G A;  2BE3 A;  3V7K A;  4RQ8 A;  2PFO A;  4YD1 A;  4I2H A;  4WBZ A;  4X4U A;  1ZQO A;  1RZT A;  1RPL A;  5HRH A;  3V72 A;  1JN3 A;  4K99 A;  4X5V A;  7ICN A;  3ISD A;  4X0B A;  8ICF A;  2BPC A;  4RPZ A;  4DOA A;  4RT2 A;  3UXO A;  5J2H A;  4K8V A;  5J0S A;  8ICE A;  4LEV A;  2HHP A;  4QZC A;  4I29 A;  4Z6D A;  2M2V A;  5J0X A;  4DOB A;  4AT8 A;  3H38 A;  2DVI A;  9ICE A;  9ICV A;  4RQ4 A;  4KLG A;  1ZQP A;  5J2C A;  1ZQG A;  2PFQ A;  7ICS A;  5J2I A;  4I2B A;  4LZG A;  2DRA A;  4Z6F A;  4UB5 A;  4FHP A;  5J0Q A;  5J2K A;  2ZH6 A;  4LZD A;  4R65 A;  5J0U A;  4K9B A;  3V7J A;  4ATB A;  4GXK A;  4ATB B;  4O67 A;  4YMO A;  3MDC A;  9ICT A;  1JMS A;  4I27 A;  4IQT A;  5HRI A;  3JPO A;  7ICF A;  5HC9 A;  4X4O A;  5D46 A;  5DBA A;  3RJI A;  1KDH A;  5DBC A;  4X4T A;  5J2G A;  4XRH A;  4NLK A;  3C2M A;  4UB2 A;  4OAG A;  8ICZ A;  5EOZ A;  1R89 A;  1ZQD A;  3NYB A;  2BCQ A;  3ISB A;  5HRD A;  5DB7 A;  2W9M A;  3RH5 A;  1UEU A;  3HJ1 A;  4QZ8 A;  5HRL A;  3RJJ A;  9ICS A;  4WC3 A;  4P4O A;  3LQC B;  4I2J A;  4LEY A;  1HUO A;  4QZH A;  2VAN A;  4AT9 B;  8ICI A;  3C18 A;  3OVB A;  4EP7 A;  8ICN A;  4WC1 A;  4RQ6 A;  9ICW A;  5HRK A;  1TV9 A;  4NLZ A;  4UBC A;  5IIK A;  5BPC A;  5HRG A;  3AQK A;  7ICQ A;  4O9M A;  4MFA A;  4KLF A;  2PBE A;  4WC7 A;  2PFN A;  2M2U A;  4KLQ A;  4I2I A;  3OGU A;  5DEC A;  4F5P A;  4KLH A;  3V7L A;  2O1P A;  3WFQ E;  4F5O A;  4IQU A;  5J2J A;  4RQ7 A;  1XSN A;  5IIM A;  5IIJ A;  3UXN A;  1ZQA A;  4NXW A;  4PHE A;  7ICU A;  4YMN A;  3AU2 A;  7ICR A;  1NO5 A;  4WC4 A;  1ZQX A;  1ZQF A;  4LEZ A;  4K98 A;  2BCS A;  5CA7 A;  4FH5 A;  4UAY A;  4NXV A;  1BPX A;  4X4R A;  4Z6C A;  4TUQ A;  9ICI A;  2O5A A;  4NM2 A;  5IIN A;  1ZQM A;  1MQ2 A;  5CB1 A;  8ICM A;  9ICQ A;  4K96 A;  5DB9 A;  1ZQZ A;  1ZQQ A;  2BPF A;  4NLN A;  7ICP A;  4YN4 A;  1ZQE A;  3AUO A;  5J29 A;  4R66 A;  4GXJ A;  3OUY A;  1XSP A;  4PHP A;  9ICO A;  1BPZ A;  4O5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...