4FHAA

Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
310
structure length
306
Chain Sequence
SYQDLKECKIITAFITPFHEDGSINFDAIPALIEHLLAHHTDGILLAGTTAESPTLTHDEELELFAAVQKVVNGRVPLIAGVGTNDTRDSIEFVKEVAEFGGFAAGLAIVPYYNKPSQEGMYQHFKAIADASDLPIIIYNIPGRVVVELTPETMLRLADHPNIIGVECTSLANMAYLIEHKPEEFLIYTGEDGDAFHAMNLGADGVISVASHTNGDEMHEMFTAIAESDMKKAAAIQRKFIPKVNALFSYPSPAPVKAILNYMGFEAGPTRLPLVPAPEEDVKRIIKVVVDGDYEATVTGVLRPDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrodipicolinate synthase
publication title Structure, Function, Stability and Knockout Phenotype of Dihydrodipicolinate Synthase from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Lyase
total genus 105
structure length 306
sequence length 310
chains with identical sequence B
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2012-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fhaA00
2V2HA 1XKYA 2BLEA 4P61A 1SO3A 3W86A 2ISSA 1QO5A 3TX9A 4UCGA 2NUYA 3ATYA 3EWZA 3CPRA 3FKRA 3RF9A 2ZDRA 1Z41A 4LS0A 4HSNA 3R12A 3LHTA 2BWGA 2NXGA 1L2UA 4MKNA 4EVZA 1DJQA 3LCXA 1PHWA 4R34A 3P80A 3L67A 1JCJA 4IJBA 2CLEA 2QCMA 1FDZA 3ANYA 3H54A 3CEPA 4AH7A 2WSQA 3TDFA 1I2RA 1Z44A 2RDWA 4OT7A 4O57A 2R14A 1IXNA 3W1QA 3NM3A 1LROA 1JRBA 1WV2A 1H1YA 3QSTA 4KWVA 1LRQA 1R47A 3P62A 2Z0IA 2NX3A 2NV2A 3FS2A 5HWJA 2I9EA 2HS8A 1EWEA 4GFSA 4GJ1A 4O1DA 2WJZA 1QNVA 1R2TA 5CG7A 1HUVA 2CLMA 2RH9A 2A5HA 1C8VA 1RR2A 3N34A 1N7KA 3UWVA 3FOKA 4JN6A 4N9BA 3H55A 1VCVA 4M6PA 2PURA 3LCIA 3G24A 4JR5A 3A9IA 4NJHA 4MUZA 3DHFA 2B7OA 4NXSA 1GOXA 5CGQA 3R2GA 4C1KA 1R2RA 5LGZA 3C61A 3V1PA 4JTIA 3M9YA 2RFGA 5G4EA 1BWKA 5HR7A 3P61A 1ICQA 1OF8A 3DXIA 1QDSA 4GNJA 4IGHA 2R8WA 5AN7A 5KTLA 4JTKA 5AC8A 4A21A 3EX3A 4IMDA 2RKXA 4ORMA 1YXYA 3TW7A 2E6AA 1VGAA 3T55A 4O8RA 3C0JA 3MHFA 4G1KA 3M5VA 3NL5A 4JX4A 4GUJA 4QQ3A 3KRUA 5DY3A 1C29A 3WK0A 4NVTA 3OVRA 4IX2A 1OFPA 3MHGA 3C6CA 4JGDA 1SPQA 3UY7A 3O05A 3TC6A 2A7PA 3LBCA 4O11A 4RJEA 5HWMA 1JJKA 2PRLA 1H60A 3TJXA 1QO2A 4XUGA 3PSVA 2DZVA 2Y63A 1QFEA 3P8IA 1TREA 3TSBA 4ZQOA 4OE7A 1OF6A 4JIPA 5F2IA 3EXRA 1TCDA 5IBXA 2ZFAA 1LLZA 3NEVA 1V7YA 5F4WA 3LCWA 3QW3A 3B4UA 3SJ3A 3DFQA 2NX1A 2C15A 2V2DA 1FDYA 4OWGA 1VLWA 2X16A 4H6KA 5D04C 3DKJA 1W5OA 4B5NA 4RXGA 1EUNA 3Q2DA 3P82A 1AW1A 1LCOA 1W3IA 3FJLA 1FUYA 2ZRVA 2OT1A 2A6NA 3LDVA 3LLDA 1SQ7A 4IMFA 4A22A 2QCDB 5DN1A 1KV5A 2V5BA 3VNDA 3R8RA 4POCA 1P0NA 3MUXA 2Q3OA 1TQXA 3L68A 4IOTA 4QISA 4JTFA 4O28A 1SO4A 4RKAA 5TIMA 5LGXA 3SIZA 1G4TA 1SO5A 2GQ9A 3UPBA 1KFKA 5G5IA 3W7JA 4JYEA 4UFLA 5AFDA 2QCGA 3G1VA 2BX7A 4HSOA 1SR9A 3MP4A 1MO0A 5LNVA 4L4MA 1SW7A 3QPZA 1EP1A 4Y6GA 2BXVA 3QZEA 1B4EA 1YXDA 4LY8A 3NQMA 1GYLA 2ZRXA 2YX0A 4O52A 3IIOA 2DZTA 2Y7DA 4IQLA 3PWAA 3TFXA 5D32A 1FCBA 1HG3A 2DJLA 4CNPA 5K9CA 4R33A 1KFJA 3C3NA 5KZMA 1O60A 5G2IA 2H3DA 3W70A 3HPXA 1U5JA 3GLCA 2EGZA 2Y6ZA 2C19A 4EOUA 3W72A 3GKAA 3QEZA 5D2XA 3EB2A 3DU0A 1X8FA 1H7NA 1OJXA 1Z48A 3UZ5A 1F5ZA 2H6RA 2DZSA 3QFEA 1UCWA 5DXYA 4FNQA 1YTDA 3S1WA 1Q6RA 2G96A 1KFBA 1FWSA 1KM5A 5EYWA 4OV4A 2CZDA 2QCEA 2PE4A 1DJNA 4H4IA 5CPOA 1ML1A 3C2RA 3THAA 2QJHA 3AO0A 1UB3A 2A0NA 1LZOA 4MOZA 2EPHA 3L5AA 5K7JA 3N2XA 4CQAA 2JKPA 5HMSA 1OX5A 2VFIA 4AWTA 1D9EA 2Y7GA 4TX9A 5G2HA 4RXFA 2FPYA 1THFD 2CZFA 2ISWA 3G8RA 4ADUA 4K37A 4IXHA 1TPWA 4KFOA 2P0OA 5FF4A 5A8GA 4Z1AA 3R89A 1KV8A 3B8DA 4N6FA 3W2JA 3R5EA 1D3HA 1GVFA 5E93A 3LV6A 3HF3A 3RLUA 3UWYA 5CPMA 1G7UA 2C18A 4A3UA 4K7YA 2YYTA 3EWBX 3QC3A 1Y0EA 5A5WA 3TUUA 3MP5A 1JQXA 1T8XA 2A2IA 3LCHA 3MWAA 3TQKA 3G0SA 4MJZA 5LNRA 1I8JA 5LNSA 4K8HA 1K8YA 3RMJA 3G1AA 1TV5A 2CLIA 4I9AA 4ZQRA 3STFA 4DPQA 5G2WA 3TJLA 1S5TA 3W7MA 3W1RA 4ADSA 2Q8LA 1TPC1 4LVFA 1U83A 4NJJA 5FF7A 1KFEA 5KITA 5DBUA 3C2EA 4NT0A 3B03A 4XKYB 2Y61A 4Z08A 4JX5A 5CZ0A 3NL2A 3T44A 2VEMA 2WO5A 1X1OA 2E5CA 1OVDA 3W1TA 1GTEA 2ZTJA 3EX4A 4O19A 3DI1A 3NQGA 5D33A 3UQNA 1LBMA 3DKLA 3STGA 4FIRA 2Y85A 1EIXA 4Y96A 3SW6A 2E6YA 1ADOA 3UYCA 1X7FA 1GTHA 2TYSA 3RU6A 2GJNA 1I2NA 4A2SA 4BFAA 4UMAA 3F1QA 1VHCA 3DFNA 3FIGA 3DFSA 2J9ZA 3KVMA 4XZ9A 2G5WA 4YWIA 3U2OA 3G0XA 1LOSA 4Q32A 1EPXA 4IUOA 5I3HA 3WK3A 2QF7A 4JDBA 3FYPA 3DFTA 5E1QA 3NL3A 1M7OA 8TIMA 4AMAA 4LWWA 3QJAA 3B05A 1W56A 3F4WA 2YXGA 3KXQA 4BWLA 1TV7A 3IVTA 3ZWTA 2PCQA 5D03A 5DLCA 5J5RA 4CCDA 2PRHA 3INPA 4O54A 1I4NA 3W7NA 3BGJA 3PB2A 2Z6IA 4DPPA 4O14A 5FF2A 1ZNNA 3USBA 5I3FA 1Z42A 1DBTA 3W73A 5BMXA 1TRIA 4UTTA 3UXAA 5D2WA 1FDJA 4XKYA 3TIMA 3WJWA 3G3MA 3JRKA 4M7SA 4Z0JA 3BLEA 4IMCA 4QNWA 1QAPA 4HNNA 1WYIA 3LM7A 2AQWA 1TYGA 4N02A 1J2WA 1OFDA 4LU0A 2CLLA 2DP3A 3RLVA 4TU1A 2V8ZA 3CT7A 4AAJA 4NX0A 1TPB1 5U4NA 3QPYA 1B4KA 5FEPA 1OK6A 3N3MA 3LI0A 1IXPA 3E12A 3TU9A 1O95A 4UR8A 5SWUA 4LV9A 1TPDA 1VRDA 4JICA 1XUZA 1K7EA 1VYRA 4LS2A 2E6DA 2FB2A 3M44A 1W5NA 1B3OA 3N9RA 2FFCA 4NJGA 4ZZ9A 1F7BA 1KM4A 4UTIA 3NQ7A 5L9FA 1SUXA 1W37A 3I7QA 4EIVA 2ZQ0A 5MHBA 1F76A 4JTJA 1I2PA 3W7CA 4CCCA 3NQEA 3P5ZA 3ZS4A 1PCKA 1MEIA 1XBZA 4FNRA 4S2BA 4O13A 2RDUA 3NYZA 5FI8A 5EKYA 3TQ0A 1D3GA 1FWTA 2QCNA 3TK7A 1MEHA 3SZ8A 3UWQA 1JUBA 1LORA 3MI6A 4LW7A 1GVSA 1TIMA 1DORA 1F6PA 1SZGA 3RNDA 4JXCA 1MEWA 1H5YA 4N2YA 1A5CA 3NO5A 5CZSA 3W1LA 3TE9A 3FYOA 3LCFA 3U6WA 4XTDA 4HPJA 3W1AA 3P67A 1W54A 5TQLA 4LVAA 3GDRA 1JQVA 2W6RA 2I14A 3A23A 1GJPA 4YXGA 3KX6A 4ZQNA 4MYXA 2W0UA 1O4UA 3MI3A 2QDHA 3C52A 5DCDA 3W71A 1RPXA 4QJ1A 4ADTA 2ZZ6A 3S9YA 1Q6OA 3MW7A 1TRDA 2PRMA 2J9XA 1YXCA 1FCVA 2GUUA 1VYPX 3T7VA 3W7QA 4CNNA 1PVNA 1EWDA 1R2SA 3GIYA 4TMBA 4JTHA 3G1SA 5AHIA 5K4ZA 4QM1A 2G97A 3S8HA 1ZJIA 3GR7A 1I45A 4HT3A 4AEOA 3Q94A 3KRZA 2CWNA 1YTKA 1VZWA 4JTUA 4DF0A 1NF0A 3UWZA 4LVBA 3GKFA 4JD4A 2VXNA 1T99A 1ZENA 5EPDA 1XDMA 1JCNA 3P5YA 4O4VA 3HPSA 2JGQA 1HL2A 3HQ1A 3HIJA 4I7UA 3V75A 1VC4A 3IVSA 3NXFA 4JYDA 2B7NA 5I3JA 4YCPA 1K02A 1NVMA 2BSLA 2YGYA 1QR7A 3EX6A 3OHIA 5D02A 1C9DA 2NUXA 3GXPA 3PBWA 4MFEA 3FEMA 3W7DA 4R7JA 1HFBA 1WBJA 3L0NA 4AXKA 3VFLA 5AOUA 2FB3A 1S3HA 1ZALA 3EX2A 4LUIA 3I68A 4PC8A 2GVGA 3ABQA 1TMHA 2V82A 2B7QA 7TIMA 3Q37A 5G4WA 2DJXA 1T0OA 3B0PA 1SSDA 2WSYA 4HNTA 1PCWA 4FNSA 4AHPA 4M7TA 1K7XA 4NX5A 2A1YA 2ATMA 4Y90A 4DF1A 4NQ1A 1TJPA 2TMDA 2QCHA 2VC6A 3W87A 1CI1A 3NQFA 4ZQPA 2DORA 1CX9A 4O15A 5D2TA 3DENA 4BR1A 2YCEA 2HMCA 1EP3A 1IIGA 3KVJA 1OFRA 1K8XA 4O10A 4ICNA 1LOLA 1FCQA 1O94A 3W75A 2QUVA 3QMTA 5AHNA 4MIMA 1XM3A 3DFOA 4NNAA 4Q33A 4ORIA 3O07A 1IXQA 5E0KA 3O1NA 4MVAA 2YW4A 4MJMA 1W3TA 1GVQA 2E77A 4FB7A 4ONVA 2O7QA 5HINA 1TTJA 3QQ0A 4UFMA 2C0AA 2VENA 3OVPA 3UZJA 1TTIA 1LRTA 1JCYA 3GNNA 3PAJA 4ZQMA 1L9WA 1PS9A 2NWRA 3MBFA 4MY8A 5AC6A 3BW4A 4XBSA 5D2YA 3W84A 3W7IA 2ZA1A 3SY5A 3M7WA 1JULA 4GC4A 3NPVA 4X2RA 1WAUA 3S5OA 3O6YX 5GVJA 2EHHA 4FNTA 4WOQA 2FPTA 4IPJA 5K4XA 3I7SA 1DKWA 1FCUA 2H3BA 3I7RA 3GDMA 4UTUA 3LCLA 1H51A 3STEA 4IPIA 1XDLA 2ZZ3A 1LBFA 3HG5A 4E2DA 5DCBA 2WQPA 3BV4A 1PV8A 4RX0A 1IF2A 4D2JA 3W2NA 2W79A 3NQCA 3VCRA 5DXXA 1S5WA 2WNNA 3IIPA 2ABBA 1P0KA 3B0UX 1UUMA 4EF8A 4FX8A 1VYSX 5D2VA 1KW1A 3L65A 5K3VA 5HR6A 1BTMA 1P1XA 1X6UA 2X1UA 3M5YA 2ZRYA 3NVTA 1WXJA 4LS1A 5EMUA 4OV9A 4JY8A 3GB6A 4M6VA 1KM6A 1KLYA 3W1UA 1H7OA 3W23A 1FQ0A 3LRLA 2O7SA 3E0IA 4JS3A 4UR7A 2Z2UA 1RQHA 1BEUA 3BG5A 3GVGA 3CU2A 3EX1A 1ICPA 1LOQA 1K7FA 3B06A 5G1YA 1J5TA 3ABOA 3HG4A 2NUWA 3LHVA 4JTTA 5HNRA 2DZPA 5EA9A 3CEUA 1XBXA 1HO4A 3LHUA 1SZEA 4TIMA 5BRBA 3G1XA 3NGJA 3WFAA 2C6QA 2UV8G 3W22A 5BOOA 3OA3A 3M47A 1Q6LA 3KVKA 2YFNA 1XUUA 1F74A 3GDKA 1DV7A 1SU5A 1GPWA 2ZA3A 3HPZA 2NZLA 4WD0A 1TJRA 5K9XA 2R94A 3G18A 1W31A 2IQTA 3NL6A 3A5VA 4K8EA 2LLEA 3NR0A 3CLMA 3QMRA 4UTWA 1ZY9A 3U8GA 1HO1A 3GZ3A 5DELA 1P5BA 2E5BA 1F73A 4LTSA 1UUOA 1UBSA 2C13A 1LRNA 1R30A 3LRMA 1NEYA 1QPRA 1VCFA 2AAMA 5I3KA 3GXNA 1EB3A 3L0KA 1IGSA 4PCFA 3PULA 1A5BA 5EBUA 3UWUA 2R91A 5C54A 3L0GA 4JX6A 3PUEA 2EF9A 3DAQA 3W1XA 2DZUA 3QM3A 3W7HA 4KFNA 4BK9A 2ZCGA 3OBKA 3PG9A 4WZHA 1VH7A 4DQWA 2XN2A 3GK0A 2Y70A 3CWOX 3HGOA 3QMSA 3F03K 1GG0A 1SW0A 3BG3A 3TSMA 1XI3A 3MJYA 1JVNA 1OFEA 1LDCA 3TSDA 1YDVA 3K30A 4CQ8A 4PODA 1OHLA 1O5KA 1LBLA 2V5LA 3ZFHA 3LCGA 4PTNA 2J27A 1TPEA 4LRSA 1GWJA 2PC4A 3TXZA 2YFOA 1FBAA 4FXRA 2J9YA 4YL2A 5CKSA 4Z1BA 3S1VA 3UXDA 3T4CA 4UTHA 2ZZ2A 3KRSA 1S5VA 4DO6A 2I1OA 1H7XA 1R46A 3W2MA 2QUUA 1YLVA 1T96A 3NQAA 1QPNA 4RZ6A 2YZRA 4FEZA 2Y89A 4UTJA 1GVRA 4BF9A 4JEQA 3HG2A 3TR2A 3TAKA 2Y88A 3NZ1A 1FWWA 2QR6A 3GAYA 4QNEA 2JBMA 3L9CA 2CW6A 1OYAA 2VEIA 2A21A 1OYCA 5T26A 1G67A 5AHFA 4QSHA 4O16A 1DVJA 2KZHA 3A24A 4O1BA 3TFCA 4RR4A 2VKZG 3M0ZA 5HUOA 4FXSA 3EKZA 1GYNA 5LNWA 3E02A 1G7VA 3W9ZA 1ZAIA 2ZYFA 5FEZA 2E5DA 1BKSA 3S1XA 3W6YA 4JTLA 4IMEA 1OG0A 3C4UA 1M5WA 1GG1A 3EWUA 1QMLA 1DL3A 4EF9A 3O6DA 3UWWA 3G1HA 1H7PA 3G1YA 1L6WA 4X9SA 1FXQA 3SR7A 3KVLA 1K3UA 4DBEA 3I65A 4AB4A 3NPXA 2Z6JA 2V2CA 4JYFA 4ALDA 3JS3A 3L21A 3TV8A 3W83A 1E51A 3SFKA 3N19B 3A22A 3TCEA 4PA8A 2ZZ7A 4AWSA 3QF0A 4E0CA 4RZ5A 1YYAA 2GQAA 4S1FA 2WKJA 2F84A 1TPUA 1WA3A 1RZMA 3LGEA 4NU7A 3ELFA 3IRDA 1SO6A 1GT8A 5KZDA 3NQ8A 1FX6A 4MY9A 4WQ6A 2QJGA 4AHQA 5IBXC 5U7SA 3E9AA 3QH2A 1N8FA 1H7RA 4XWUA 2OX1A 1OFBA 1OFOA 2XN0A 4CLMA 4PH6A 4XQ6A 2JK2A 1MSSA 4UXDA 4WJEA 2B7PA 1J4EA 1EP2A 3GYEA 2GJLA 3GDTA 4O0ZA 3PF3A 1LM1A 3LI1A 3W07A 1KTBA 2B4GA 3SGUA 4BI6A 3NQDA 4S2CA 3PM6A 4AF0A 2WNZA 1VS1A 4Y8FA 5I3GA 3HJZA 1QWGA 2EAWA 2TSYA 1KA9F 4KKXA 3T78A 1XL9A 3VI2A 1H63A 3EWXA 5FEXA 3FLUA 3HB9A 2Y7FA 4WY0A 1AL8A 3BVJA 4DO4A 4FHAA 5IM51 5LNUA 5CSSA 3UPWA 3WK2A 3HO8A 3BGGA 5C55A 1AW2A 4N9DA 5LZLA 3EKLA 1ZHAA 2ATSA 5F4XA 1NFBA 2XN1A 1OX4A 3ZR4A 3S1UA 3IIZA 1YPIA 5C6MA 2FDSA 3G3DA 5FF3A 1JRCA 2JGYA 1LP6A 1SZNA 3TA6A 4JIQA 4L4LA 3R13A 4MFDA 4GUFA 4DBDA 4HPXA 4LNYA 2V0TA 3G1FA 1XFBA 1F6KA 1VQTA 1SW3A 5KZEA 4UMBA 3VE7A 3TH6A 4GBUA 3TQVA 2ZZ1A 5D09A 1TSIA 1P4CA 1YDOA 3EEGA 4X22A 4IX0A 3LBMA 1VLIA 5AHLA 1O5XA 4CCEA 3CB8A 1X1ZA 4I7WA 4U28A 6TIMA 3D0CA 1M7PA 4O17A 3W2KA 3LHZA 5LHEA 1ONRA 3OVQA 1I2QA 1MZHA 1Q45A 1KFCA 2GVLA 1EX5A 5F1UA 3ZWSA 3W7KA 2VFEA 3LRKA 5CZTA 2CLHA 1JCMP 2Z1BA 4KWWA 4R53A 4UMCA 2X1RA 1A5AA 4DO5A 3YPIA 1AMKA 2VELA 4ZQCA 4RLIA 1G4EA 4E2BA 4M6QA 1FY6A 1GEQA 1TV8A 3M41A 4UTWC 3NG3A 3OIXA 3S5YA 4P2VA 3WJXA 3GXTA 1L6YA 3MYPA 4WXYA 3O6CA 5DBTA 5KSWA 3E96A 1W5QA 4NJIA 2YSWA 5BMWA 2DZWA 3M1ZA 4MZYA 3LHYA 3IIXA 4ML9A 3W76A 4UFJA 3GAKA 4WUIA 3TKFA 3IIVA 4PEKA 4JTEA 4DF2A 1RQEA 5DCEA 1H62A 2OT0A 2JKAA 2FLIA 2WPBA 1DHPA 3LTPA 4UFKA 4MPQA 4ZL1A 2VFFA 4LVGA 2ZTKA 4U4MA 2YDAA 3CC1A 5I3IA 4LT9A 3DHDA 3L5LA 3DGRA 4LVDA 4N4QA 2E09A 3HBLA 4IXXA 3RK8A 2QJIA 4HN4A 5LSMA 3PR2A 2D73A 3OEXA 1VPXA 2WNQA 3B0VC 3NPUA 5LKYA 1EUAA 1KBJA 3HG3A 4J9JA 3PSWA 4YCOA 3C2VA 1KTNA 2E6FA 3W7GA 5AB3A 4YLWA 3SGZA 5F2GA 2A6LA 3PC0A 2YPIA 5F1VA 3G8EA 2Y62A 3BO9A 3DZ1A 1XBVA 2QAFA 1LYXA 4IWWA 3W3OA 3LLFA 3VKJA 2NXIA 2H8ZA 4WX2A 3QYQA 1G4SA 2P1FA 3DH7A 4UTMA 2OMAA 3NOEA 2JKEA 1ME8A 3NPWA 2CU0A 5F2MA 3EWWA 2HSAA 1VJIA 1F05A 2ZA2A 1KM0A 2X1TA 3TXVA 4NJKA 3LXAA 4Z1DA 3P7YA 1XBYA 1ZAHA 2ALDA 2J24A 3M6YA 5AYXA 1TPH1 1RV8A 3RFAA 2E68A 1QPQA 3G1DA 3KFTA 3NDOA 4BWLC 4FO4A 4Y9AA 3PVFA 1JCLA 2P10A 4GWEA 3BG9A 3TAOA 3P81A 4JTGA 2TRSA 4XBKA 1GVOA 1B9BA 1KBIA 4UNLA 3N9SA 2NX9A 3L5MA 3SI9A 1RVGA 4GUHA 1QOQA 2VFHA 3M5XA 4RCXA 5C2XA 4QIUA 4DELA 2V81A 5LHFA 2G95A 2C14A 1WBHA 3KOFA 3LTYA 2CZ5A 3W1MA 3IGUA 1H7WA 4UTTC 1FWRA 4RK8A 3TNOA 4UFHA 5H2ZA 5F2LA 4MZ8A 2V30A 2VFDA 4O53A 3UY8A 1B57A 1W5PA 4ZVJA 4O4WA 5FEWA 4W9TA 4JTSA 4O0KA 1NF7A 4LUJA 4TR9A 4GUGA 3S42A 2A7RA 4NNCA 3W85A 5F4SA 4X3ZA 3PUOA 3THQA 1V5XA 2FQIA 1TQJA 1GZGA 4NZFA 1QOPA 3HGJA 3O06A 3P84A 4N9EA 4M19A 1NSJA 3DBPA 4BI7A 4I7VA 4Z0SA 2YYUA 4AVFA 3FKKA 4A2RA 3SECA 3G22A 5C5YA 1N55A 4JY9A 5DY2A 3N2MA 3TROA 3KAOA 4A29A 1VCGA 3LXBA 3MMTA 2NXHA 1FXPA 3I6RA 1XCFA 1NAL1 3L66A 4JNMA 4O50A 3QSRA 1L6SA 3O15A 4O1CA 1YTEA 3W7EA 4PL1A 5K9DA 4O12A 2Q8ZA 4OQVA 2QCCA 2GPTA 2J88A 2QDGA 1EA0A 3W7LA 3LB0A 2GVJA 4UIOA 4LRTA 4OBTA 4KFPA 3W7PA 4PFMA 2V9DA 1AL7A 1ZFJA 3L2IA 5KINA 2OCZA 3C56A 4FX6M 4RZ4A 2H8XA 1SSGA 4HHPA 3W2UA 5HUPA 3OG3A 3CIWA 1RD5A 2X30A 3E49A 3ATZA 1Q6QA 3IVUA 2AGKA 3BLFA 3P8JA 2CZEA 3PG8A 1H61A 4O18A 1VR6A 3MBDA 1KM1A 1ALDA 3TMQA 4EWND 5FF0A 5BNKA 3PUDA 3HMJG 1OYBA 5AYYA 4HNUA 3WJYA 5KMYA 1TTQA 4RV8A 1WX0A 3LHWA 3BW2A 1F2JA 1ICSA 2QCDA 4ZMGA 2BTMA 5G1TA 1QPOA 3HOJA 1OX6A 4CQ9A 1MXSA 1DOSA 5K2ZA 1W3NA 3PB0A 3W2LA 3EXSA 3MI2A 2B0MA 3T40A 1SZFA 2Y7EA 2RHGA 2ZRUA 1FWNA 1OK4A 2NWSA 3NZRA 4UNKA 3W1NA 5AYZA 1PIIA 2ZRZA 3M16A 5D30A 5ABTA 3S0CA 2C1HA 4DXVA 4FNPA 5AHEA 3S5ZA 1K03A 1W1ZA 2A4AA 5HQEA 4BI5A 4YMZA 3W7OA 3CHVA 4UTKA 2J6XA 1TPVA 3SSJA 3CIXA 4NZJA 1Q3NA 4GRSA 5D38A 5CSRA 1KTCA 1UASA 4UFIA 3MO7A 4K38A 1WOAA 1TB3A 3Q58A 4HNVA 3HGSA 4AHOA 1K8ZA 2X1SA 2A7NA 4QAIA 4QITA 3S6DA 2QCLA 2HS6A 1OFQA 3UNDA 4NUWA 1PL9A 3JR2A 3WK1A 5CZJA 1G69A 4NNBA 3LV5A 2ZZ4A 4E38A 2NV1A 3QW4B 3MP3A 5D05A 4OGZA 1GQNA 3W7RA 1JCXA 5CPLA 2X2GA 1KFLA 3NQ6A 3PBVA 1IIHA 2OZ0A 1CW2A 2EKCA 3PS7A 2QAPA 3DFPA 3HGRA 1KM3A 3MHUA 1H1ZA 3LERA 3WJSA 4UUIA 3IV3A 1HTIA 2F7FA 5D37A 3O16A 1TTPA 4MZ1A 3IGSA 2FPVA 2CFFA 2A85A 3GX9A 4OHQA 1LTDA 3PBYA 4FIQA 1KLZA 2WV8A 2FTPA 2GOUA 3CQ0A 3UD6A 1PHQA 2FIQA 4MYAA 3BW3A 3QRHA 3A5FA 5FESA 3CM4A 2H90A 4AF0B 4LV4A 1YPFA 3FFSA 3GDLA 1UJPA 2ISVA 3KHJA 3ABSA 3O8AA 2VOMA 3NQVA 1XXXA 3LOTA 4Q4KA 4TMCA 1OABA 1YDNA 1A5SA 2DZXA 3F4NA 2RDTA 3W74A 3BARA 5AHMA 3H53A 2C16A 2WSRA 4WY0B 2BZNA 4PL2A 1DQXA 1WOBA 2YR1A 5CPNA 3C2FA 3DI0A 2TPSA 3NQ2A 4GE8A 3EXTA 3CWNA 1AG1O 3FA5A 1G6CA 2CLOA 2ZRWA 1I2OA 1SFJA 4O1AA 1A53A 1EEPA 1W5MA 3LXCA 3NM1A 5H91A 3TC7A 3N14A 1OX4B 4MLJA 4N9CA 3BLIA 5EL1A 2VEPA 4MY1A 4H3DA 5EY5A 2C3ZA 4M5PA 4UTLA 3P74A 1W0MA 1QCWA 1JR1A 3QQ1A 4LC6A 2ZZ5A 3CTLA 3TW6A 2XFWA 3IEBA 1OFAA 4MLRA 1TO3A 5J5DA 1XC4A 3BPWA 4K7VA 4LOCA 3N73A 3NAVA 4WXZA 2E1DA 1ZCOA 4GXMA 3NNTA 1AK5A 4FF7A 5L6UA 1AW5A 1PE1A 2ABAA 4HKPA 2CLKA 1WQ5A 3GNDA 4N6EA 4OU1A 4XTIA 3STCA 4HIBA 1WDWA 1TPFA 2QUTA 3ABRA 4WY0F 2OJPA 2HTMA 4FX7A 4C1LA 1ME7A 2YW3A 2QKFA 4K6AA 4UC5A 3M43A 2QEZA 3GR8A 1KM2A 4NXKA 4N4PA 3C2OA 4TO8A 4IMGA 1ME9A 1G4PA 5HULA 3MYOA 4GUIA 3AJXA 5HJLA 1IXOA 5AC7A 2GQ8A 3W1PA 2DU2A 3VE9A 4FNUA 3TMLA 2VFGA 3A21A 2FJKA 4DEFA 6ALDA 5BW6A 2WOQA 3G0UA 3FJ6A 3O63A 2VEKA 4AWUA 1H50A 1DQWA 3WJZA 1SFLA 3NA8A 1M6JA 5HWNA 4CNOA 2CLFA 4Z1CA 3PY2A 4LC8A 3LX9A 2ZBTA 1LLWA 3PBUA 2NLIA 1JUEA 3M5ZA 3EWYA 3W88A 4K36A 1YADA 3BK0A 4K39A 3S5NA 1VHNA 1A50A 1JUKA 4WOZA 3C8FA 5TBOA 1RQBA 1W8SA 3LTSA 3P60A 2Q3RA 2QCFA 1ZAJA 3B04A 1BWLA 3IGXA 4JDYA
chains in the Genus database with same CATH superfamily
4MF4A 2IKHA 3WMSA 3W86A 1IEVA 2ISSA 3TX9A 4UCGA 2NUYA 3ATYA 3CPRA 4LYPA 3N6JA 2E9LA 4HSNA 4NY2A 1UWSA 5E5CA 2VQTA 3N2BA 1GW9A 2BOEX 4C6MA 1PHWA 4R34A 3L67A 1JCJA 3W26A 2P88A 2QCMA 3CEPA 4AH7A 4D6DA 2RDWA 3OGSA 1IR1A 4BF5A 1TUFA 5HJXA 3WNLA 1LROA 2I16A 2V69A 1JRBA 5HDRA 4KS0A 1TZ9A 3MDUA 4H7ZA 2EG7A 3NJ3A 1IE7C 2NX3A 3FS2A 2I9EA 2XPKA 4GJ1A 3E0VA 4AG0A 1HKIA 3H70A 3CTTA 4S3KA 1JAEA 4JN6A 2OU4A 3AS3A 3M07A 2VP8A 3O6AA 1J8VA 3FCPA 2PURA 1CXIA 3FJNA 4MUZA 1AUSL 1XRVA 2G41A 3CUFA 1H4PA 5CGQA 4HN8A 4DZ5A 4Q7IA 4JTIA 2RFGA 3RM4A 3BAJA 1F3WA 2BS9A 1ICQA 4XZBA 1OF8A 3AHVA 3UG4A 1QDSA 4JQAA 4AVOA 4EX4A 3A6OA 3WLPA 3EX3A 3R79A 4DJFA 1RSCA 2O4QA 4MWAA 3MHFA 2J13A 3M5VA 4GUJA 3OLEA 4NVTA 4D6EA 1OFPA 4JGDA 1SPQA 2QNEA 3O05A 4O11A 2GSHA 2J25A 1ZJHA 2VD9A 4K2SA 1JJKA 1H60A 3BE7A 2WYSA 2GJPA 3L4TA 4XUGA 1HIZA 1B5TA 1TREA 1UR9A 1NJJA 4DZAA 3SAZA 3OZYA 2D2HA 4KCTA 3EXRA 4HHHA 1V3KA 3ZJ8A 2C0HA 5DF0A 4AY8A 1LLZA 2WVSA 3LCWA 3GFZA 1QHOA 5HJYA 4I9MA 3T2OA 2IPJA 1W9UA 3WDQA 1ZU8A 3N1AA 4UOJA 1VLWA 5D04C 1UYQA 3DKJA 1AQ0A 5JH1A 2FKPA 3Q2DA 3EBVA 4KWUA 3MT1A 1LCOA 1W3IA 3DECA 4Q7BA 1L6GA 3GG7A 1SQ7A 3VNDA 1WDPA 3C8NA 1UD5A 3B9OA 3VVGA 1P0NA 1TQXA 3L68A 4PTXA 1E4MM 1YMYA 2BY0A 5TIMA 3SIZA 1G4TA 4INFA 3UPBA 4UFLA 5PTDA 3WQGA 1DXIA 4HSOA 3W82A 1CLKA 3MP4A 1QASA 1MO0A 4DBUA 4Y6GA 2NQLA 1R9XA 4KIRA 3TLQA 2BXVA 3QZEA 1NFGA 1U1HA 5GJNA 3V7PA 2CESA 2GZXA 3CUZA 4DJDD 4GHRA 2WM0A 3SQMA 2WHLA 1QUMA 2X2YA 5K9CA 3VD3A 1CGYA 4ZB0A 1KFJA 4FXJA 5KZMA 2RJGA 5LIWX 4JIRA 2W92A 4AIBA 3VKBA 2C19A 2E67A 4EOUA 1XHGA 3TTYA 3GKAA 3AZTA 1XLBA 2EPNA 1F5ZA 3ONCA 1LF1A 5DXYA 1PX8A 4AX7A 4FNQA 4DM2A 1Q6RA 1KRBC 5EYWA 3H4XA 4B9ZA 2J8FA 3LNMA 5REQB 1BSLA 1E9YB 2AOSA 2PE4A 1DJNA 4WDXA 1EZ2A 1PKNA 1CB2A 1V7AA 1LZOA 1MW0A 3KTCA 5K7JA 2PI6A 2JKPA 5HMSA 2VFIA 3ARWA 1R3TA 5G2HA 3OPSA 2CPUA 1THFD 4K37A 2RUSA 1TPWA 5FF4A 3B9EA 4Q8VA 3VNZA 2X09A 2C8NA 4Z17A 3V5OA 1B3ZA 3RLUA 4RNHA 2CBVA 1PAMA 1CGUA 2D0FA 1T8XA 3UEQA 3MWAA 3TQKA 3NO3A 2PODA 1OC7A 3RMJA 4ZQRA 2D0GA 3KWXA 4BCEA 1PWMA 3NZGA 3MMDA 2VQUA 4LVFA 1KFEA 4NT0A 3V18A 4XKYB 2Y61A 7XIMA 3F4DA 2VEMA 4QFUA 4ZEPA 1GTEA 2ZTJA 4ATLA 3N4EA 3DI1A 4PCTA 1D7FA 1LBMA 3NSXA 3VDCA 2FGBA 3QGKC 3P2VA 4M51A 3SW6A 4NIRA 1ADOA 1GCYA 3RU6A 4G1NA 1HJVA 1I2NA 4A2SA 4UMAA 4BFAA 3F1QA 1MYRA 2BNJA 1XLEA 4C5ZA 2XZ9A 1V3LA 4FPSA 2G5WA 1KGXA 5HBFA 3QFWA 3VKCA 2QF7A 5CAHA 4Q6JA 3CLWA 1V3IA 4MJ4A 1VBHA 4REQB 3B05A 3J7HA 2FH6A 1DQUA 2WMGA 5BRPA 2HJPA 3THDA 1H1NA 5J5RA 3BC9A 1ISVA 2PRHA 2O4MA 3KP1A 1EO7A 2Z7GA 3W7NA 3BGJA 2C7FA 2Z6IA 5E70A 4O14A 4XZWA 1Z42A 1UD8A 3VUSA 1DBTA 5ABHA 4BEQA 4V1XA 5BCAA 1BAGA 2Z1VA 3UXAA 3P93A 1BGGA 5D2WA 5LIYX 5FJIA 1AH3A 4GGBA 3G3MA 3JRKA 3C0SA 1E6SM 1XYLA 4HNNA 3N12A 4GCAA 4N02A 4F2TA 1EKOA 1SR0A 1IHIA 2V5JA 4NX0A 5U4NA 4GX8A 2PDGA 5FEPA 4DIAA 4CVWA 1OK6A 5H1WA 1RLDA 4AFYA 2ZIDA 4A05A 2GDQA 1VRDA 5IHSA 1J2BA 3SBFA 2OTDA 1J96A 1B3OA 1KWKA 2VDIA 1REQA 3MS8A 3T0AA 2FFCA 4NJGA 3MZNA 3T0TA 4UTIA 1AZ1A 1SUXA 3I7QA 4PRRA 4EIVA 3CQKA 2E1WA 1IEQA 3HM7A 1F76A 2OZTA 3SM0A 4KMQA 3NQEA 3ZS4A 1PCKA 1X38A 4AC1X 1Q63A 1MEIA 2QT3A 4FNRA 2RDUA 1UR8A 4I5RA 3WMBA 4H83A 5FI8A 3WQ5A 4JN7A 3TK7A 3TW9A 3CUGA 1MEHA 1BG4A 3EMZA 3UWQA 1JUBA 3ARSA 3EOEA 3EYPA 1S2VA 3MVTA 2WZMA 1GVSA 1TIMA 1UW9A 2O9TA 3HQNA 1DE5A 3VU2A 4UR9A 2R1PA 2Y8UA 4IG2A 1FWFC 2WCAA 2YA1A 4HCDA 5CXPA 4N2YA 3W25A 1A5CA 1R3VA 5CZSA 1UOKA 3O7UA 1EOKA 2PDFA 3W1AA 1UKSA 3P67A 2P50A 2F8QA 2W6RA 3LSCA 2I14A 4PULA 3PTQA 4MYXA 4XAYA 3MI3A 2VZTA 1RCXB 3H2CA 3GUGA 5D9PA 3WLKX 4H9YA 2QPXA 1U5HA 2PRMA 2J9XA 1YXCA 1CXHA 1FCVA 3GIPA 2XH7A 4M3PA 1ZQ5A 1VYPX 2DGAA 5C9XA 2G4FA 4CNNA 1BRLA 1EWDA 1I0BA 3JU2A 4TMBA 6CGTA 1BYDA 2QPSA 3G1SA 4JTHA 1C92A 2GOKA 4XX6A 5EMMA 3TEVA 3DHPA 1IEIA 4HT3A 4AEOA 3Q94A 1E43A 1V6YA 4RDVA 4LVBA 5FCZA 3GKFA 1ZENA 1XDMA 3T0DA 2JGQA 1XLFA 5EMJA 1E3XA 1YE4A 3V75A 3IVSA 3NXLA 3W38A 3AZSA 3BMVA 2BSLA 2NQHA 1A0CA 5D02A 4Q8UA 3BMXA 1LQ2A 1DPMA 1HFBA 1EFZA 3APTA 1DIKA 3FDKA 1ZALA 4PMOA 3GW3A 1TX0A 1O1HA 3DEQA 4AW7A 7TIMA 2XM2A 1FHLA 2FFIA 1UQZA 1M04A 1T0OA 3A9BA 2GDVA 3WF1A 3TTEA 1PCWA 1W3JA 4WCJA 4AHPA 4NX5A 4D1IA 2D23A 2VJXA 1W1B1 1Q6FA 1TJPA 1E5NA 2TMDA 1EYEA 2QCHA 1CI1A 4ZQPA 4ZTYA 3FVDA 1XIHA 1C8QA 4X0VA 3C0QA 2FZ8A 2YCEA 3UGVA 3I4KA 2F6UA 3R10A 3R25A 4IQDA 1RUSA 2R82A 1UP3A 3QMTA 1TMQA 4Q33A 5BYWA 2YA0A 3NOYA 4P8UA 3O1NA 4MVAA 2YB1A 4FB7A 3KLKA 4XV0A 5HINA 1WUFA 1Z89A 3AHXA 3HPAA 3UZJA 4WK9A 2F38A 1JCYA 4F2BA 2H9AA 2R1LA 3T08A 3UZXA 4H9VA 3FN9A 2ZA1A 4EPDC 1FVPA 3W29A 4XAGA 4KCUA 3UWEA 2XIMA 1WAUA 2OFJA 3EOLA 1A0DA 4FNTA 2OLAA 2FPTA 4WOQA 3RCYA 1BYCA 2KAUC 3I7SA 1FCUA 3H6OA 2H3BA 4ZO9A 2IPFA 3FHAA 1MW2A 1CCWB 3GDBA 1GOIA 4IPIA 3W01A 2ZX8A 4HD5A 4E2DA 3BV4A 3ZZ1A 5AYBA 2V6AA 3CHDA 3NQCA 3VCRA 1S5WA 4EF8A 1WXYA 4FX8A 1VYSX 1UZ4A 2V63A 4GO8A 1GJUA 2WMHA 4GPNA 2BB0A 4OV9A 3GB6A 2XIJA 3NCOA 1E0UA 1KLYA 1XIBA 4XD4A 3W23A 3E0IA 2KX9A 1BTCA 2Z2UA 3BG5A 5I79A 1LOQA 1OQFA 1K7FA 2VEFA 1CB7B 5KETA 3GTFA 3UJEA 3CYJA 4B5WA 3JZUA 4AD4A 4A8NA 5HNRA 4IQEA 4UNIA 4HNCA 4NZ1A 3T2QA 3LHUA 3ONBA 3F5LA 1SZEA 5BRBA 4H8NA 4KCVA 5C70A 2L5HA 3ARZA 2UV8G 2P8CA 3GXMA 3KVKA 2NSOA 3GDKA 3NGFA 4TOQA 3W4RA 1HNYA 5FIPA 2C1GA 1G01A 1GHRA 1BF6A 1TJRA 4W86A 2R94A 3SO7A 4WVXA 2GSJA 5BOEA 4L4OA 3OZPA 2LLEA 4GYJA 3CLMA 1ZY9A 3BLKA 1HKMA 1O12A 1ZBKA 3GZ3A 5DELA 3CXOA 1F73A 4LTSA 1HJQA 3MVIA 3URNA 2Y1HA 1BF2A 4UB9A 2BFGA 1QPRA 4Y9NA 3GXNA 4Q4MA 3L0KA 1IGSA 1GPFA 3PULA 3UWUA 2R91A 2J79A 1NQ6A 4OBRA 4J2PA 3NYDA 2WMJA 5I78A 2VGIA 3GK0A 1JG9A 1UKQA 3F03K 3QMSA 1ZUAX 3TSMA 4ACYA 1VFFA 4TTUA 3VYLA 2CXEA 4U31A 1WPCA 1FP9A 2JIWA 2BVTA 3B9AA 4NZ4A 1GJWA 2V5LA 1JXJA 4ZO6A 4AZGA 1YNPA 1FH7A 2PC4A 3OOQA 4QG8A 2V5CA 2J9YA 4YL2A 4Z1BA 3T4CA 2ZZ2A 3IK4A 1EGMA 2I1OA 5G4HC 2XG9A 4GYFA 2QUUA 1LQAA 1T96A 3NQAA 4GNVA 1UR3M 4RZ6A 3RCMA 1BVZA 4AX6A 3VNIA 4GJIA 4JEQA 2O9RA 1W32A 3OZOA 3OGRA 3WKZA 3CZJA 4MJ2A 3ME3A 4UQBA 1M68A 1TWWA 1H11A 2Y88A 3NZ1A 2XWEA 1JZ4A 3W00A 4QNEA 5T26A 1DVJA 3GFYA 3ZVHA 4F40A 2PGRA 1DJIA 5C9RA 4HCLA 4FXSA 1GYNA 3MSGA 3S47A 5LNWA 1PJ9A 3AC0A 1ZAIA 1LG1A 1JNDA 2E5DA 4V27A 4MWAC 3M0VA 3W6YA 4JTLA 5IOBA 5DX7A 4F0KA 4I9TA 1E73M 1OINA 3TP4A 2J4GA 1DL3A 3F5JA 3UWWA 1HT6A 3DC0A 3G1YA 1L6WA 3SR7A 1K3UA 2HK0A 3AISA 3I65A 4AB4A 2ADAA 3KTSA 3L21A 4GBDA 3RXZA 3TV8A 3W83A 5HPOA 2POZA 2DIEA 2JE8A 4XVDA 1XG3A 4S1FA 2WKJA 2VD8A 1Q5MA 3VNMA 1RZMA 3ELFA 3VIFA 1FX6A 2FZNA 1TELA 2E9BA 5U7SA 3QH2A 1MRAA 3GHRA 4UQ9A 4Y9MA 4CLMA 4HK6A 3AIBA 1QW9A 3V0UA 2JK2A 1RJRA 3SSZA 4FAMA 3U9IA 3WD4A 3EEZA 1F4HA 2XINA 2GJLA 3AXHA 3GDTA 4J2MA 1XLMA 2F9RA 1KTBA 5LYRA 5M1TA 3WQ4A 2QMJA 4Y9OA 1KBKA 1HGWA 1CBGA 4S2CA 4AF0A 2WNZA 3SEPA 1DWFM 5I07A 2INFA 5J8LA 4Y7EA 5FEXA 4H9TA 2ZADA 3GIQA 3E38A 3K1GA 9RUBA 3B3DA 1GEHA 5IM51 4YVVA 5LNUA 1HZYA 2EXOA 3WY1A 2ZWYA 3BGGA 5GNYA 2GJRA 3MU7A 2XN1A 3LENA 5C6MA 4LUYA 1OADA 3WNMA 3AUOA 2GK1B 3KDNA 1LG2A 2VCBA 3GSMA 3CQJA 3PTDA 1D3CA 1XFBA 1VQTA 4PSPA 4DI9A 3UW6A 3SCUA 3ARUA 5KZEA 2WJFA 3TH6A 2ZZ1A 2HPMA 2X42A 1TSIA 3KW3A 3LBMA 4FR1A 5AHLA 4C1NA 4CCEA 2X0HA 1X1ZA 1UMLA 3LHZA 4RUBA 3AIEA 1Q45A 1KFCA 2GVLA 3AMLA 2W67A 4Q3MA 2J8GA 7ENLA 3B97A 2MNRA 1GHSA 4GI9A 3C5QA 2VI0A 3D6NA 4P7RA 2X1RA 1A5NC 1PKMA 1B90A 5XIAA 4QTGA 5E09A 4E2BA 1FY6A 4UTWC 3NG3A 4WIWA 1OD0A 1UWAA 4NG3A 4P2VA 3GXTA 3N29A 1A49A 3MYPA 3T42A 3O6CA 3SFWA 4NJIA 3EB3A 2YSWA 1OEPA 4P7QA 4P7LA 3IPWA 2VOTA 3ARXA 3IIXA 4ML9A 2CNCA 4UFJA 3LMZA 4DF2A 3BZJA 2CEQA 1XSIA 3QZAA 1E1CB 3MKKA 4DM1A 4EANA 5DCEA 1H62A 3EMCA 4XSLA 3APGA 2JKAA 2WPBA 3K4AA 3LTPA 4UFKA 4MPQA 4LVGA 2ZTKA 2YDAA 4TV6A 4IQJA 3DGRA 1G9HA 3RK8A 1NH6A 1P0EA 4HN4A 4CQCA 3B0VC 3NPUA 4MB4A 1S5NA 3HG3A 5AC5A 1J5SA 2YCKX 4H04A 5AB3A 4YLWA 3PC0A 2XVKA 2Y62A 3BSMA 3CB3A 3T81A 3ARPA 3BO9A 3DZ1A 3KCJA 7A3HA 3N2TA 3VGEA 1LYXA 2REQB 4C90A 3LLFA 4MWAD 2H8ZA 3MSYA 1XSKA 2BASA 3TTOA 4ERGA 5D9MA 3NOEA 3NPWA 2CU0A 2OSXA 1WDDA 3WUEA 1F05A 2YXOA 1KM0A 5IFPA 4F9JA 4NYYA 3PZ9A 3LXAA 2PWDA 4FZIA 4C7FA 3P7YA 1XBYA 1QPQA 4LB3A 4Y9AA 3A4XA 3PVFA 4PUWA 1A4MA 4W85A 3REQB 1W9DM 4GWEA 3BG9A 3RPMA 3TAOA 1EH9A 2TRSA 1E5JA 2PDWA 1B9BA 3DG7A 3PWIA 1KBIA 4JTRA 4UNLA 1UJQA 3BJFA 4DO7A 4GUHA 3ZSSA 1F8MA 1QNRA 3IK2A 5C2XA 4RNFA 4DELA 1YEYA 2C14A 1E6QM 4IIBA 4EXAA 3LTYA 1BKHA 1P48A 3NQBA 3A4WA 2AL2B 3EGJA 4UFHA 1W9XA 5H2ZA 3MWCA 4MZ8A 3ITVA 2XTKA 3QPEA 4O0KA 1KB3A 1J0JA 1US3A 4AD1A 1KRMA 4X3ZA 3PUOA 1V5XA 3OBEA 4QG9A 4PMVA 1QOPA 3QVQA 3RHGA 3WO8A 4PE8A 3WD1A 3CUHA 1S3TC 2YZ5A 4KRTA 3SECA 2Z00A 1FRBA 4PMUA 2PGWA 3RLHA 1NFPA 3DYOA 3N2MA 3RG6A 2VRKA 1TJ2A 4A29A 4ECLA 4HZMA 2XVGA 1QNPA 3LXBA 2HNHA 3BTNA 3MMTA 1FXPA 4EPKA 4QJ5B 1WB0A 5B80A 4O1CA 1YTEA 1UUQA 2PF0A 1W1VA 2ZUNA 2QCCA 1RHCA 3IJ8A 2J88A 3CASA 4KEUA 2E28A 2GVJA 4AXNA 3C56A 3AUJA 4RZ4A 3QGAC 4HHPA 3W2UA 2EO7A 3OG3A 1V51A 2P0IA 4CCZA 4D72A 2PP1A 4WSKA 3U5YA 2X30A 3E49A 3ATZA 3OBAA 3P8JA 3AROA 1J9YA 4M80A 4B90A 2WPGA 1PYMA 1KM1A 1ALDA 3BOXA 2ACUA 1YBQA 2GGGA 5FF0A 2DT0A 3AXKA 4PB3A 5AYYA 3WJYA 3ZIZA 1KFWA 1WX0A 2WMFA 1GOOA 1ISWA 1ICSA 1OC6A 2QCDA 2PWHA 4CD4A 2BTMA 4ZODA 5G1TA 2QQ6A 3ARYA 1QPOA 3WMCA 3HOJA 2HVNA 3DFYA 3AYTA 2WW5A 3PB0A 4E2OA 5LXEA 3W2LA 4I6KA 1H49A 4L7ZA 3AJ7A 2B0MA 1VEMA 1R3QA 2Y7EA 2ZRUA 1FWNA 3E74A 3NZRA 1YW1A 2V5DA 4DWSA 2ZRZA 4R85A 3S0CA 3AYSA 4FNPA 3S5ZA 4FOJA 1TWZA 2GGEA 2A4AA 4BI5A 5DMNA 3CHVA 4NAEB 1TPVA 2NVCA 4GQ0A 4GRSA 3MKVA 5CSRA 1KTCA 4PCNA 1UASA 4FK9A 1PX4A 1WOAA 1TB3A 4IFRA 3Q58A 4HOXA 4J3VA 1K8ZA 4C6EA 1ZS2A 1GKRA 1O66A 4QITA 5GPRA 4S3CA 3U7BA 2HS6A 3OP2A 2WMKA 4DBSA 5T9CE 5A2CA 4FR6A 1UR2A 4PMYA 3MP3A 1BXBA 3UF9A 4J4KA 1WKFA 4ICMA 4AD3A 2HPIA 3MSDA 4AUBA 2W3ZA 1HP4A 1WCGA 4S3JA 3WLNA 3PBVA 4YYFA 1CW2A 3DFPA 5HAOA 1QK0A 1Q6CA 4AD0A 3K1DA 3LERA 4LBRA 2OWXA 3WJSA 4HYRA 1C3FA 4GI6A 4M24A 1AJ2A 2GGJA 4J27A 1TTPA 1W9BM 1XKJA 4AVNA 3U0HA 3DGBA 4LUTB 2FPVA 1JCTA 1C8XA 2A85A 4I9JA 4OHQA 1VD6A 3VOGA 4FIQA 4LFYA 2Y24A 1Q6EA 2QJJA 4CN1A 3PZMA 3SUUA 1LWIA 3CS2A 1YPFA 3K46A 3B8IA 3FFSA 2CZVA 3O8AA 3QV8A 1UKPA 1Q7MA 3W74A 3BARA 5AHMA 4MB3A 2PF8A 3H53A 1WOBA 2YR1A 3HQPA 5JH2A 3DI0A 2TPSA 3NQ2A 3E6EA 4US5A 2CLOA 4H6QA 4GO9A 1XG4A 1SFJA 3NM1A 3LXCA 1OX4B 5BXSA 4N9CA 1XCXA 3SRFA 1B31A 4JHMA 2VEPA 3UJ2A 4C6QA 2C3ZA 2VC9A 4UTLA 4JFSA 3P74A 1W6TA 1JR1A 1Q7QA 3VDHA 4LC6A 2WHJA 1RP8A 1TO3A 3O9NA 4XZNX 3SQSA 3WD3A 3N11A 4JTAA 4WXZA 2DIJA 3OHMB 3MV01 3RR4A 4GXMA 3L12A 5DMMA 2OG9A 1AW5A 2ABAA 5C0QA 1P7TB 3SN4A 3VFCA 2PBGA 4NP7A 3G1RA 1HVQA 3MPGA 2XZ7A 1HN1A 4HYWA 5A6TC 2BOFX 4IGNA 4UC5A 1C7TA 2X05A 5IXEA 2PDUA 3O2LA 4N4PA 1T8QA 3MMUA 4S39A 4IMGA 1YIXA 1Q6GA 3C3UA 1EQCA 5HPCA 3POCA 2DU2A 3VE9A 4JTQA 2X7WA 4FNUA 4PUDA 3N18A 1UH2A 4DUOA 4J40A 2WOQA 3G0UA 3GUWA 1H50A 1DQWA 4J28A 1SFLA 3HMCA 1HF6A 1K9FA 4Z1CA 4LC8A 3M0JA 2BV9A 2ZBTA 3PBUA 1JUEA 3RX3A 3SCNA 4K36A 1YADA 1VHNA 2XSAA 1R7AA 1W3KA 3WLOA 4AZ7A 2PLMA 5CBBA 3BOFA 1RQBA 1W8SA 3LTSA 2CERA 2Q3RA 4KEZA 3PK7A 1AQFA 3A4JA 3IGXA 1JDCA 1EGVA 1SO3A 3N2CA 3KCOA 1W91A 2HXTA 4NRSA 4NAFB 3F2BA 3EWZA 4MB1A 3M7SA 3OIHA 1QK2A 2CBJA 1Y65A 5D4YA 5CJNA 2BWGA 3CUXA 2PBOA 5XIMA 4DJEA 1FWAC 4FS9A 4F48A 2VR5A 1CWYA 3TOYA 2D2GA 2CLEA 1S2TA 4L1XA 1TJ0A 2A3AA 1XRSA 4O57A 1F9CA 1IXNA 1EO5A 3NM3A 2PDQA 2X41A 1WV2A 3LBOA 3QSTA 4KWVA 2G50A 1EX1A 3TWBA 5AVHA 1R47A 3KZPA 1DEDA 5HWJA 1XYBA 2Q8XA 3V3WA 1EWEA 2Z4GA 4IF2A 4Q7NA 4GFSA 3F2CA 1WO2A 1XPGA 3VZZA 3ZT6A 4U2YA 4R27A 1EL3A 4N9BA 3H55A 4HQVA 4M6PA 3WH6A 1TJ1A 4EK7A 3LCIA 3QOKA 3A9IA 4NJHA 3DHFA 2B7OA 1XGZA 2UY5A 1V0KA 1GK8A 1KXQA 3R2GA 4C1KA 1JYNA 1R2RA 4QROA 3N25A 1XH1A 4H2HA 1BWKA 3HZ3A 3A4AA 2VGGA 3PHAA 1XCWA 3T8QA 4GNJA 3T09A 2R8WA 5AN7A 5KTLA 4WF7A 3AAMA 1B3VA 2VC7A 3C0JA 4B4FA 1WZAA 1OG6A 1JFXA 4QQ3A 5DY3A 4B15A 1Q13A 1UOZA 3U4FA 1H0GA 3M0IA 3BWWA 3ARRA 2G3NA 2AMXA 2UBPC 3ZVIA 1JPMA 2OWWA 3Q4DA 1QO2A 3PSVA 3L2LA 4RW5A 2Y63A 1QFEA 3EDDA 3P8IA 3URAA 4UQDA 1X6LA 4PGLA 4MNMA 3MKCA 1OF6A 4LUSB 5F2IA 1TCDA 1FWCC 2ZFAA 1XQKA 3D5HA 1XRTA 2D2OA 1S1RA 1US0A 3B4UA 1S2AA 2PFHA 1LL4A 2V2DA 2PU1A 2PTXA 1AW1A 1VFHA 3C86A 1FUYA 3GQYA 4JCMA 3V35A 2V67A 4IMFA 3BQ5A 4K8GA 5JU6A 3OW1A 4H00A 4POCA 3UCCA 3WBAA 4IOTA 1EJSC 1VFOA 1M9HA 4H41A 1VAHA 4JEJA 2GQ9A 4JYEA 3CPGA 1OD8A 2QCGA 5RUBA 3PJWA 3N2OA 1VBJA 3G1VA 1YHTA 5LNVA 2VX7A 2F6XA 4PCPA 1YXDA 2YX0A 4IQLA 4IPPA 4H1ZA 1K9EA 1HG3A 4DWDA 1ISXA 2DJLA 4QEEA 1AA1B 4CNPA 3NWRA 1WP6A 2BVDA 3GD6A 5G2IA 2AQVA 3WLHA 4J3XA 3HPXA 2EGZA 1JI2A 3KM8A 1XIEA 3DX5A 3QEZA 1Z6KA 3EB2A 1X8FA 2ZE0A 1H7NA 2PSNA 1OJXA 1CXFA 1Z48A 2H6RA 4JAWA 4ENLA 1YTDA 5CSYA 5HQLA 4O8AA 2QHAA 1KM5A 1JPHA 2ACQA 1TA3B 4H9ZA 4GC3A 2CZDA 2QCEA 2DH2A 5HK4A 1ML1A 1RK6A 3M4HA 3WQCA 1QU4A 3V0TA 4CQAA 1D8WA 1HL9A 4AWTA 1D9EA 4TX9A 4RXFA 2FPYA 2CZFA 3G8RA 4ADUA 4R9OA 2FMOA 2W63A 4KFOA 2Z2BA 1BYAA 3WLRA 5A8GA 1PZ3A 3CAKA 3B8DA 2QLYA 4N6FA 4NL1A 1D3HA 1GVFA 3LV6A 2VL4A 1ADDA 2ZKMX 4K7YA 1VIWA 1BLIA 4HA1A 3MP5A 4F9DA 1J0IA 3N6QA 1TV5A 2YOCA 2OLHA 4GQRA 3W7MA 3W1RA 3AFBA 1PZ0A 1VBGA 2F2HA 1TR1A 5I5RA 4NJJA 5FF7A 1IT7A 3EDJA 1E9LA 5EFDA 4JX5A 3NL2A 1XIMA 1UWUA 2WO5A 1ECQA 1OVDA 3W1TA 4O19A 4HCHA 1MMFA 4GXPA 1J10A 3NQGA 5T8GA 3WBWA 7REQB 3KOXA 5JVLA 5REQA 3VOHA 3AALA 3DKLA 1L8PA 3STGA 4Z42C 1EIXA 4N0RA 3EZ4A 1XH0A 3CZEA 4IIDA 2PWFA 1TWSA 4PMZA 5E0CA 2WBGA 3PUGA 4DUWA 3DFNA 1OT2A 3DFSA 1ZRQA 4NI3A 4XZ9A 4GI4A 1JYXA 1V0NA 4P8VA 1BFNA 5I3HA 3I6TA 3FYPA 3H12A 1W56A 1EPVA 2JQXA 2YXGA 3KXQA 1TV7A 1XPYA 3PWGA 4D6CA 2X8RA 3UU0A 2PCQA 5D03A 4PN2A 1JPDX 3ZJKA 5KZ6A 3SADA 1PUDA 3THCA 1FKWA 3AHZA 3FXGA 3WYZA 4RDWA 4M82A 1LL7A 3KBWA 3KZSA 2VCCA 3P0XA 3W73A 5BROA 5BMXA 2DZAA 4GI8A 4XKYA 5C2CA 5I7GA 5KEZA 4HP5A 3BLEA 4IMCA 1WYIA 2CHRA 1IT0A 1OFDA 4C5YA 3TTQA 4AZCA 1PTAA 2DP3A 2Z7KA 3RLVA 4GISA 4AAJA 1PIFA 2FTYA 1GVYA 4B3KA 3UVIA 4PSRA 1B4KA 3TYDA 3UG5A 3N3MA 4J5NA 5I24A 1E0XA 3TU9A 1O95A 3G6LA 5SWUA 3IV8A 1TZ7A 3JZEA 1XUZA 1K7EA 4QCFA 1LT7A 2BDQA 3ITCA 3UR7A 2O92A 4QJ3B 3AMGA 1KM4A 3SCSA 3WDIA 4AIUA 2OR2A 3NQ7A 5L9FA 4F79A 4DN1A 2J7EA 4FMVA 4JTJA 1SJDA 3W7CA 4CCCA 4WDTA 3IRSA 4B4HA 4GY7A 4ICCX 3P5ZA 4O0QA 4P5UA 4S2BA 4PUJA 2DFAA 4UZSA 3PN8A 3WH8A 3TQ0A 3GG8A 4L6DA 3R0UA 2WNWA 1TV3A 4M1RA 2VZOA 1Z69A 3KTXA 2POTA 4JTCA 1DORA 4XAPA 5C71A 1F6PA 4TVCA 2WVTA 1SZGA 3RNDA 3WL1A 2V3GA 1MEWA 1H5YA 3M0MA 3XIMA 4C6IA 3FSTA 3W1LA 3U6WA 3LCFA 4QJ4B 2PS2A 2VUNA 3KL5A 1V6TA 5TQLA 3RRXA 5I2UA 4YTRA 2BGQA 4YXGA 3DBNA 4OUEA 4RDYA 2IMRA 1DWHM 2QDHA 3C52A 3HA1A 2E40A 4RE4A 3U7VA 3S2MA 4A3YA 4F0HA 1WZKA 1BQCA 1TVPA 4PMDA 3ARVA 3W7QA 4MWAB 3UPMA 1R2SA 3CH0A 5AHIA 3W0KA 3BCDA 3EAUA 1ZJIA 3GR7A 4KH2A 4WJ8A 4PBEA 1DTNA 4R3UA 3ALFA 3KRZA 1YTKA 1VZWA 4XD5A 1NF0A 1OGBA 4WGXA 2VXNA 2HEJA 3P5YA 1R3RA 1VBUA 3HIJA 4DWSC 2WK2A 3LPGA 3GH4A 2NQ9A 5I3JA 1BXCA 1K02A 2YGYA 4RPPA 1QI5A 1QR7A 3EX6A 1XX1A 3GXPA 3MUIA 3OZMA 3MCMA 3RMEA 1ZP4A 2DVUA 4AXKA 3VFLA 2DIKA 3ECQA 4LANA 3CWHA 5B7ZA 1S3HA 3EX2A 4PC8A 2GVGA 2FHBA 3GWQA 2NQZA 1OWQA 1WKDA 1ISYA 3GNPA 3COTA 3OODA 4PFHA 3MZ2A 1SSDA 3ES8A 3Q65A 4J3SA 4DUVA 1K7XA 1OCJA 1LUCB 1XR2A 2A1YA 2QF8A 4KRZA 5A6JA 2VC6A 2R6OA 3W87A 4ACZA 1WKYA 3GXFA 1U1JA 1CX9A 3MMWA 4O15A 2W66A 5D2TA 3B0XA 3B8SA 5DANA 2A3BA 1OFRA 1Q6DA 4LSBA 1K8XA 4O10A 3WUFA 1O94A 4IT1A 4MIMA 3DFOA 2XYLA 5EBAA 2XIQA 2YLAA 4ORIA 2DV0A 3U2ZA 4HA0A 3F5KA 1FFRA 1DJGA 1MI3A 5BRQA 1UPPA 1TTJA 3QQ0A 4UFMA 4DRSA 4ERAA 3OVPA 1TTIA 2AAAA 1W3HA 1TX2A 3GNNA 5LA0A 1L9WA 3SIMA 5AC6A 3UZYA 4ES4A 4XBSA 3QTGA 3M7WA 1FWDC 2ODOA 4CUCA 4D1JA 4LALA 4GC4A 4A8IA 1EJWC 4X2RA 2B31A 4JIHA 4KERA 3H2EA 5K4XA 5CPTA 3WIJA 4UQEA 3LCLA 1H51A 2WVUA 1XDLA 1LBFA 3SRDA 1T5AA 4GFIA 2WQPA 1U1UA 9XIAA 2HBXA 3MCNA 3TLLA 4GJJA 2WSPA 2W79A 1LL6A 1CT5A 1YPXA 4D6FA 3R0DA 2BY1A 2WNNA 3MY9A 2ZX5A 1P0KA 3B0UX 1GW1A 1PDZA 4HOZA 5K3VA 4PUEA 1BTMA 1P1XA 3DYMA 5A6MA 2X1UA 3OYXA 4K3ZA 1WXJA 2HK1A 3VTRA 3WN6A 3S4TA 1KM6A 3W37A 1SFSA 3LRLA 1ZBWA 3FV9A 3EX1A 3GVGA 3B06A 1J5TA 1H2JA 3UCQA 3LHVA 3D3AA 2XJ7A 2WSKA 1D2KA 2DZPA 5EA9A 2YL9A 3STPA 4PBFA 5F7UA 3G1XA 3NVDA 5JBEA 3NGJA 3WFAA 2C6QA 3IAQA 3W22A 5BOOA 3OA3A 2OO6A 2ZA3A 3LZ3A 2NZLA 4LAOA 1VIZA 1XLDA 2VZUA 3SQLA 2D0HA 3EKGA 2J8TA 5DMYA 2OKOA 5AVNA 1E3ZA 1HO1A 1N2VA 1R3YA 1P5BA 2E5BA 3ZR6A 2X7VA 4AU0A 1UBSA 2C13A 5FAGA 1VCFA 3GVQA 1EB3A 2DSWA 5EBUA 3BICA 4A3QA 4YVPA 5CEWA 2GGHA 3W1XA 4HNLA 4DWSD 3W7HA 4BK9A 4IL2A 3OBKA 4WZHA 5A8QA 3WF2A 4DQWA 2XN2A 1EC9A 3CWOX 1SW0A 3BMWA 1PZ2A 4KQNA 1XI3A 1JVNA 2GSEA 3ZM8A 4PODA 3WBEA 3D47A 2ZC8A 3I10A 2J27A 1TPEA 4QLLA 4LRSA 1IQ8A 4G5DA 4LNCA 1GWJA 5EMLA 3TXZA 2YFOA 1FBAA 1XYFA 4CNUA 4IUGA 1RBOB 4DO6A 4F0SA 3AIUA 2XWDA 5IHRA 3VC6A 4FEZA 4UTJA 1TE1A 4GINA 1HVXA 4F4RA 2OQYA 4MG4A 3VKKA 1R8LA 1CPUA 3RITA 1GVIA 3L9CA 2CW6A 1REQB 1OYAA 2VEIA 1WDQA 3EDKA 3L4WA 3BAWA 4QSHA 4O16A 4DBWA 1F3XA 4YN5A 2KZHA 2IPGA 3A24A 1P6CA 4RR4A 3M0ZA 1XISA 3EKZA 2EQDA 3W9ZA 1QI4A 5FEZA 2WCGA 4M81A 5CJ5A 1BKSA 2VR4A 3VNYA 3UZWA 4Q8OA 2G0WA 1GG1A 4HJFA 4EF9A 3G1HA 1NDVA 3WEOA 1FXQA 3VGFA 3KVLA 3KUMA 4DBEA 4ALDA 3OB8A 2UY4A 2PWEA 3N19B 2PC8A 4PA8A 1VB9A 4BQ3A 5CGMA 5I6SA 4IG2B 1I1WA 3RGTA 1KRCC 4JNYA 3PZGA 3R0KA 1SO6A 1GT8A 3NQ8A 1A5LC 1V3JA 4MY9A 1N8FA 5A6LA 4XWUA 2G3IA 1LWHA 2QIWA 1OFBA 2XN0A 4H9MA 1RALA 2WLZA 3TC3A 5HNTA 1BG9A 1V0MA 2HE8A 4UXDA 5AZ0A 1Y5WA 3MCOA 3PF3A 1LM1A 4IJCA 2YLLA 2B4GA 1EJXC 1A0EA 1BRLB 1Q4WA 3SGUA 2XVNA 4BI6A 4C6NA 4RE3A 4B3ZA 3E1F1 2WKGA 4Y8FA 4FA3A 8A3HA 5A6AA 4PUNA 5CQ1A 3T78A 3NDYA 1XL9A 2PD5A 4PZVA 4C6OA 3FLUA 4HYVA 4WY0A 4CQDA 2ZXDA 1RP9A 4C65A 1XGEA 3MANA 1XS2A 3R8HA 2BBFA 5LZLA 4F0MA 1RBLA 1QNQA 3ZR4A 4D8ZA 3S1UA 2FDSA 3KBNA 4A3RA 5C9WA 1M03A 3G3DA 2JGYA 2J74A 3QLDA 1LT8A 4ZXLA 4JIQA 3R13A 4GUFA 4FLSA 4LNYA 5CCZA 1RA0A 1CECA 4YIWA 2WZIA 1F6KA 1R7OA 1SW3A 4UMBA 2UWFA 5EFFA 4LEQA 4DNHA 5CSUA 5D09A 2NQ5A 3EEGA 2J7HA 4JOMA 5TNVA 4IX0A 1VLIA 3EOSA 3CB8A 3GVVA 4U28A 1M7PA 4O17A 3QY7A 3SN0A 1OIFA 1Z7AA 1MZHA 1EX5A 4OVXA 2ACRA 3ZYZA 2QDEA 2VFEA 2JIEA 2CLHA 1E6RA 4R53A 3GU9A 1CENA 4NZ3A 1AMKA 2VELA 3VNLA 3VD7A 1B2YA 1MNSA 1TV8A 3RM9A 4AZHA 3OIXA 1L6YA 2NLYA 1A5MC 1XDJA 2P3EA 4OECA 5DBTA 1UR4A 2BMBA 1XLGA 3XINA 4W7VA 4PEKA 5I00A 1RQEA 3UERA 3ITTA 3WD2A 3V5FA 2H9AB 3PTMA 3VO0A 1LLOA 2VFFA 4U4MA 4IFKA 2VCAA 3TN3A 1EYWA 3DHDA 3LEPA 1MFUA 3TYAA 2J66A 3IJLA 1U33A 3HBLA 3FA4A 1XYCA 4B92A 1ONXA 2D73A 1J18A 1VPXA 2PZ0A 3GVWA 1K77A 1CGVA 2PEVA 1EUAA 5LKYA 3MUZ1 1PX3A 1KTNA 3ITLA 3SGZA 4Q4RA 2A6LA 3DC8A 3WH7A 2YPIA 5F1VA 3BJSA 2OEMA 1RY0A 3PJTA 3QN3A 3T0CA 3CZLA 2CXGA 4D6HA 3E3HA 1AJ0A 2E7FA 2P1FA 1NOWA 2WCSA 4UTMA 3IJDA 2JKEA 2GJXA 1VJIA 1DTUA 4IIFA 1JZ2A 2X1TA 5FJUA 4MSSA 3TXVA 1IZJA 4GIEA 3B9NA 1ZAHA 2D1ZA 3RFAA 3KFTA 1VP5A 1FKXA 4H7CA 1E70M 2P10A 3VMNA 4KW2A 4GH1A 1E6NA 1E1CA 1ZPTA 3HTWA 4IMAA 1J11A 3L5MA 1NP2A 1P6WA 1RVGA 1QOQA 2XUCA 3CUJA 2VFHA 4XKMA 4CGTA 4RE0A 4WKAA 2V81A 4UQAA 4AD5A 1EHNA 1TUXA 3T9PA 5MKGA 4U2ZA 4BQ4A 2CZ5A 3W1MA 4EPEC 2QVNA 3TNOA 2FHFA 3KS6A 5F2LA 2VFDA 4LJ3A 4GIYA 4MPKA 5FEWA 4DY1A 1JZ7A 1XWYA 4JTSA 1NF7A 3WLTA 2BGNE 4TR9A 3H2OA 4XIMA 4GUGA 4B3LA 2GYIA 2FHCA 1CLXA 8CGTA 4C6BA 3THQA 1QVBA 1GZGA 3O06A 3AIRA 1X6NA 5FSDC 4N9EA 1DXEA 2YL6A 3E5BA 4Z0SA 4AVFA 2W61A 2OOGA 4CKQA 4JFWA 3G22A 3H4WA 3TROA 3HU7A 1EBHA 5LIKX 3VGHA 1VCGA 4DJDA 3UESA 3I3BA 5DEZA 3M0LA 3VCNA 3L66A 3FVMA 3QSRA 2WB5A 4PL1A 2WLYA 1NOUA 4O12A 2Q8ZA 4OQVA 1XLHA 3FDGA 2ZUSA 3GRIA 3H21A 4AISA 3BH4A 1EA0A 2QDGA 4FXFA 1MNZA 3PZNA 4J7RA 4UIOA 4LRTA 4OBTA 4W5ZA 5KINA 4FSAA 3TYZA 3A12A 1PSCA 4WR3A 2AL2A 1EF2A 5M17A 4HZ6A 5D9OA 4GZIA 2C71A 4XO6A 3PFMA 2XHYA 4UOZA 1H61A 4O18A 3TMQA 5CC3A 2ZX9A 5BNKA 1ESWA 2GVYA 4QBXA 4HNUA 2JF7A 1TTQA 4Z2LA 4RV8A 2HZGA 3BW2A 3H2AA 4PTMA 4HU8A 4YJ5A 1FHDA 2RGMA 3MTWA 1JNEA 1OX6A 1T6MA 1E56A 4TV5A 1DOSA 1W3NA 1KXHA 1QW8A 4YS1A 4HU4A 3ZVHB 1P0BA 3TYEA 1SZFA 4EAYA 1NM9A 2NWSA 2DH3A 4UNKA 5AYZA 1PIIA 3C0LA 2C1HA 4DXVA 3BLOA 1K4GA 4YMZA 4IGMA 4UTKA 1JDEA 3CIXA 1Q3NA 1E6XM 1ENUA 3HFTA 2O0TA 3HGSA 5TD4A 4AHOA 5J04A 2A7NA 3B8VA 1KNWA 3T1GA 4QAIA 2EPKX 1WDRA 2DSZA 2Y2WA 1U5VA 2YBVA 3GXDA 4NUWA 4HHMA 1PL9A 3JR2A 3WK1A 5HOSA 2Y0FA 3BURA 1MDLA 4U3AA 5DQPA 4E38A 3E2QA 4C6CA 3U2CA 5D05A 1F3TA 4L9ZA 2ZUVA 1ITCA 1GQNA 4B9YA 1ODZA 1JCXA 2R1KA 3PS7A 3ZO9A 1H1ZA 5IRPA 3CIVA 1V03A 4LEFA 3PNUA 4UUIA 3IV3A 5D37A 1MXDA 4MZ1A 1HP5A 4GG9A 4PMJA 2INZA 2PLKA 3IACA 2CFFA 4XZLX 3GX9A 1T7LA 4HMNA 3LYEA 1UG6A 2WV8A 3AYVA 2IKIA 3CQ0A 3UD6A 1OT1A 1PHQA 4MYAA 3BW3A 3QRHA 5BU6A 3A5FA 5FESA 3CM4A 3S5SA 4AF0B 4LV4A 5XINA 3R7MA 3WDPP 3WNKA 3AS1A 2QGYA 3GDLA 2ISVA 1HQTA 2VOMA 3HURA 3NQVA 2ON3A 4H6RA 4NAEA 1FHUA 1YDNA 2QUNA 3SGGA 2BODX 3CHFA 4BQ2A 3LQGA 3TQPA 3C2FA 4FALA 3CWNA 1AG1O 3FA5A 4I5UA 3WLJA 2ZRWA 4O1AA 3LK6A 4C6DA 1W5MA 3N14A 1JZ3A 3AXXA 2ZC1A 2CBIA 4IGSA 1ZCCA 2ZUMA 2QV5A 4MY1A 3SRHA 3RO6A 3LMYA 3K4WA 4CNSA 4M5PA 3VIPA 1W0MA 8RUCA 3CTLA 4GABA 2XFWA 3IEBA 1OFAA 1UR1A 4MLRA 3TCSA 2EG6A 4K7VA 3NAVA 3DG6A 2E1DA 4WKFA 1IYXA 5L6UA 1PE1A 1WQ5A 4N6EA 1XFCA 1W1PA 4XZMX 4L4PA 3TJIA 4ZTXA 2WC3A 3MUAA 2V3FA 1WDWA 2A3HA 5EGRA 1TPFA 3ABRA 4JL1A 4C1LA 2YW3A 2QKFA 4K6AA 3BDKA 4UQCA 1AODA 3B8TA 3LNPA 1KM2A 4WEVX 1OGSA 3CT2A 3OTRA 4CU8A 5BWAA 4GUIA 2TODA 5HJLA 1IXOA 2OVLA 2BHZA 3W1PA 5BXPA 3KOYA 2ZDSA 2OB3A 2YL8A 2OXNA 1MFVA 2VFGA 6ALDA 5BW6A 1XIGA 3ZOAA 2VEKA 3NA8A 4NRRA 4ML4A 4HPGA 1A5OC 4OKDA 2BG5A 1BPLB 4ZO7A 1E4LA 1LLWA 3WCZA 3M5ZA 3BCJA 4G2DA 2OKTA 6REQA 4K39A 3DFHA 2VWSA 4FOKA 1A50A 1JUKA 1RJQA 3C8FA 2WMIA 3DCPA 4DNMA 2VVSA 4QS5A 5GJPA 3VA8A 2PA6A 1UKOA 1UC5A 3PFRA 2ZVRA 2V2HA 1PB0A 3II1A 1XKYA 2BLEA 4P61A 4K68A 1QO5A 5AY7A 3KS5A 3FAXA 5FAJA 1J01A 1OCQA 3RF9A 2ZDRA 1B9ZA 1Z41A 4LS0A 1NDWA 3GC5A 3TR9A 1L2UA 4MKNA 2CHNA 4EVZA 4HNOA 4RL3A 3RJYA 3RRAA 4GA8A 2PGFA 4IJBA 3KBSA 3GH5A 1FDZA 3ANYA 3H54A 4QHRA 1KO0A 2R14A 3W1QA 3E5PA 4HK7A 4R5EA 4IICA 3P62A 1B3XA 1JPIA 1NWUA 1WXZA 2HS8A 5A6BD 3VKDA 2WJZA 1QNVA 2WWDA 3EB4A 4XIAA 3N15A 5CG7A 3UZZA 3GM8A 2CLMA 2RH9A 2A5HA 1I75A 1RR2A 3N34A 1N7KA 1FTXA 3OA5A 4I8DA 3UWVA 3FOKA 3ANUA 4ZBCA 1VCVA 2JEPA 4JQ3A 5JIPA 1AJZA 3G24A 4JR5A 1V4YA 2Y5SA 5EMYA 3NTYA 4PRWA 4ROPA 3UT0A 3V1PA 1O68A 5G4EA 3VAVA 3P61A 2MANA 4HPNA 1ONWA 2GVEA 4IGHA 3WQVA 4ROQA 4JTKA 4KCWA 4IMDA 2RKXA 3TNBA 3UR8A 4ORMA 1YXYA 3VOIA 3TW7A 4TVDA 1VJSA 2E6AA 1VGAA 3T55A 4G1KA 2PLCA 1J93A 3IWPA 4LYRA 3WK0A 3NEHA 4IX2A 3UY7A 3TC6A 3LBCA 4K1WA 3LG3A 4RJEA 5EB8A 3WL0A 5FL0A 4E3TA 5LA1A 1G0CA 4GX9A 3FGCA 2PRLA 3TJXA 3LD5A 3VK5A 1S1PA 4CEXC 4DZHA 4J3WA 5C2GA 2DZVA 3TSBA 2G3FA 2WZHA 3VILA 2G3MA 4ZQOA 2E8YA 4OE7A 1B30A 1R3SA 4IZGA 4JIPA 5CZKA 3GH7A 5IBXA 4JCLA 2Z28A 3GTHA 1XLKA 3W28A 3SY1A 3SJ3A 2JFEX 1VKFA 1HJXA 2PDLA 3EDEA 2Y8KA 3LN3A 1FDYA 5ABFA 4OFCA 4B5NA 4RXGA 1EUNA 4S3FA 1YBQB 2PTDA 2SFPA 3LY0A 3ID7A 3PPFA 2OT1A 3GU2A 2A6NA 3GBDA 3TN4A 3VIHA 3LLDA 9CGTA 2VURA 4A22A 5DN1A 2QCDB 1KV5A 2J7FA 3R8RA 3MUXA 2YCLA 2Q3OA 3CNYA 4QISA 3NSNA 1SO4A 4RKAA 2YA2A 5LGXA 4PMQA 1E72M 3OG2A 1SO5A 2Z2AA 1EGZA 1KFKA 5AFDA 2D2JA 5A6SA 4XVEA 1PO9A 1SR9A 4WLCA 3CH9A 1QNOA 1SYTA 3QPZA 4DWSB 1E9ZB 4H7VA 4LY8A 4MKVA 3NQMA 2ZRXA 3CV6A 2DZTA 4BQ5A 2XIOA 3VIGA 3CBWA 1X96A 3TFXA 3WF4A 2EJAA 3THUA 3KP0A 4ZGYA 1K6AA 4NYUA 4R33A 1KR0A 3C3NA 1O60A 2EPLX 3VX1A 2H3DA 2P5NA 2J7BA 3GLCA 3MC5A 2OYLA 4JIIX 2Y6ZA 1TV4A 4GK8A 4L6HA 3W72A 4PMRA 4IPLA 3BUVA 3ITGA 1OZMA 4O1FA 3RLGA 1ZB5A 4P8XA 4GZ7A 4AC7C 3UZ5A 2DZSA 3QFEA 1UCWA 2AQOA 2YBUA 2Y5EA 4XBJA 1KFBA 4G9PA 5GJMA 4KETA 5DO8A 4KGLA 4LF2A 1HL8A 4OV4A 1XYAA 3D3FA 1XYZA 3S9IA 4H4IA 3THAA 4AY1A 4AZBA 3N4AA 1UB3A 2FZMA 2ESCA 3VPLA 1Q65A 2FYMA 3PANA 2DDXA 2XVLA 1CXEA 5IDZA 4LYQA 1XSJA 1PYFA 1Y7VA 3NURA 4QX4A 4Z1AA 3N13A 3W2JA 3R5EA 3VZYA 4KBXA 2YKKA 3HF3A 3ZSTA 3VGDA 3QKZA 4A3UA 3W53A 4U33A 1SMAA 5A5WA 3PPCA 4DI8A 4ZOCA 2A2IA 3LCHA 4X60A 2GUBA 3G0SA 3BLPX 4MJZA 5A8MA 5LNRA 5LNSA 4K8HA 1K8YA 3TN6A 3G1AA 1W8GA 3WQEA 4I9AA 5G2WA 1S5TA 5FSEC 3EPOA 1UZ1A 4ADSA 2PDBA 5KITA 3U57A 5DBUA 3C2EA 2J7DA 3AMDA 4Z08A 3VMPA 3T44A 1P6BA 1L6FA 4UBPC 2G4JA 1XGDA 5D33A 4FIRA 2Y85A 4Y96A 2VZSA 4G7EA 2E6YA 3UYCA 1GTHA 3A3XA 3QBUA 2WHMA 4S38A 3GC4A 2GJNA 1U30A 2WVVA 3NO1A 3GY1A 1VHCA 1XP3A 5FJTA 3KVMA 2J9ZA 1DJWA 1Y8BA 1LOSA 1EPXA 4PUUA 2EPOA 3NL3A 4AMAA 3QJAA 3F4WA 3AYRA 4BWLA 4PMXA 4LQ1A 4GYPA 1CNVA 4JQ4A 5HMFA 3CL8A 4S3GA 3AHYA 4CCDA 3VD5A 4GZEA 4DJFC 5JQ9A 1KKOA 1M01A 1KCZA 1XIDA 4DPPA 2PU0A 2VHLA 1ZNNA 5I3FA 3W27A 4XISA 4W8AA 3TJ4A 4LAUA 2O56A 3DYPA 1TRIA 4CN4A 3IJ6A 2DY3A 4UTTA 4C7DA 1FDJA 1FWBC 2VR2A 3TIMA 1UKTA 2OEKA 4M7SA 4ZE4A 2J6VA 3VCCA 4QNWA 3LM7A 1P0DA 1VBRA 2AQWA 1TR9A 1TYGA 1J2WA 2BVYA 3QHMA 2CLLA 4LU0A 3R6IA 3MUY1 4TU1A 1ZJAA 1NWSA 3CT7A 1BXNA 5DRCA 5CJMA 3QPYA 5CPSA 3RPDA 1IXPA 3E12A 3V1HA 3VKAA 5A8PA 5AKQA 3RIKA 1XF0A 1TPDA 3LPFA 4LS2A 1WAWA 2FB2A 1W5NA 4CD7A 2PDNA 3N9RA 4X63A 1PPIA 4ZZ9A 1F7BA 1IEWA 1MXGA 1QT1A 1MWOA 2QUMA 2EJ1A 3CV1A 1JF6A 2ZQ0A 4ZENA 3GE7A 1BD0A 3M0YA 1EZWA 1WKEA 3RX2A 3AIQA 1ZTVA 1B3YA 4ZSUA 7TAAA 2GLKA 1XBZA 2XGZA 2ASHA 3I3EA 1PIGA 4Z2IA 4CEUC 2QPUA 3TYUA 5M5DA 2QCNA 2DSUA 4BS0A 1FA2A 1ZBVA 3SZ8A 4DJDC 2ZXQA 3URBA 2OELA 3MI6A 3ZR5A 2XIBA 4LW7A 3KCLA 5CC7A 2BXZA 4L1WA 1R38A 4JXCA 5EU9A 3NO5A 3TE9A 4PUKA 3FYOA 4HPJA 3FA3A 1W54A 2IS7A 1V02E 2VGFA 4GH3A 3A23A 3SCQA 1GJPA 3KX6A 3PZVA 1V3HA 3GO2A 1E15A 1O4UA 5LA2A 4CU6A 5DCDA 3LPOA 3SCVA 1RPXA 4ADTA 2FJUB 4W7UA 1E40A 4GVHA 3R4IA 3MW7A 2PLJA 1E6PA 1TRDA 2CYGA 4CN6A 2GUUA 1LWJA 2VMFA 1OGGA 1YNQA 1R5YA 2UZ9A 2OOFA 1PVNA 4JKLA 3GIYA 3R1ZA 1VRXA 1L8NA 2NT0A 4QM1A 2RJHA 4F0LA 5JIWA 4AIEA 7PTDA 3AMKA 3LS9A 1J0KA 4MADA 2CWNA 1QWKA 4AZ6A 4DF0A 4N7QA 1Q8AA 2Z24A 4P7NA 1RCQA 3UYIA 4HGXA 4UZUA 5EPDA 1UWTA 3H2FA 2PDHA 5AYIA 1OIMA 2DUXA 1J0YA 1S46A 3DG3A 2Z1XA 1VC4A 2PTZA 5BZAA 4D6IA 3BOLA 2ZUWA 4YCPA 3LPPA 1NVMA 3CZ8A 4MFEA 4HVXA 3W7DA 4R7JA 4J1OA 1NDYA 1WBJA 3L0NA 1XC6A 3ES7A 4LB4A 4C91A 3I68A 8XIMA 4GVIA 4HA4A 2B7QA 3Q37A 4U5KA 5G4WA 4D6JA 3SCWA 1B54A 3S6OA 3ZMRA 3F2DA 2VGBA 1E6ZA 2WSYA 1S2UA 3FXYA 4QAWA 3GNOA 3H22A 4H8HA 2WWCA 4N42A 1IWBA 4DF1A 3CHCA 1VFTA 1TKKA 1IGWA 3QR3A 3NQFA 1B3WA 4DJFD 1R3WA 4ZB2A 5E6ZA 4BR1A 1IZKA 2HMCA 4MAZA 4NZ5A 3VIOA 3PNZA 1FCQA 3IUDA 2QUVA 5AHNA 4QE5A 1UR0A 2HRWA 3O07A 3BCFA 3B9DA 1J6PA 1W3TA 1CZ1A 4GQGA 1K1DA 2CETA 1CXLA 1F61A 1RLCL 3IS4A 4FLQA 4F2UA 3SCPA 2VENA 3PAJA 4ATDA 4YTTA 1PS9A 4HU3A 2NWRA 4JHOA 4L56A 4O1EA 4GVFA 3BW4A 1C7SA 5D2YA 3W7IA 4KRUA 8XIAA 2WKLA 3NPVA 3S5OA 4E3VA 5AZ1A 5GVJA 4PYSA 1DKWA 1LUCA 3KOZA 4MAVA 3I7RA 3H2NA 3GDMA 1JPKA 1VEOA 4JFVA 2OGYA 5JBDA 2ZZ3A 3CK5A 5DCBA 4GQBA 4QE4A 4OZOA 4PBGA 1KBLA 3AXIA 4JBRA 4RX0A 1IF2A 4D2JA 1DJXA 5DXXA 1UUMA 1VJZA 5D2VA 4IISA 1KW1A 1KRAC 4DLFA 3M5YA 1GOKA 1QW7A 1G1YA 2ZRYA 1NY1A 1UHVA 2WZTA 3O0KA 2Z27A 3HPFA 4JY8A 3WZ0E 4M6VA 3W1UA 1H7OA 2CBUA 1FQ0A 1PTGA 4C7GA 2O7SA 1TVLA 5E9XA 1T40A 4GYKA 1VFUA 4JS3A 1WUEA 4UR7A 1TV2A 1UPMB 1RQHA 1P1MA 1UZHA 2HDJA 5G1YA 4A8RA 1AFSA 5BOFA 1U2YA 2NUWA 3U5UA 4JTTA 3QHOA 5CC5A 3VX0A 3CJPA