4FHAA

Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
310
structure length
306
Chain Sequence
SYQDLKECKIITAFITPFHEDGSINFDAIPALIEHLLAHHTDGILLAGTTAESPTLTHDEELELFAAVQKVVNGRVPLIAGVGTNDTRDSIEFVKEVAEFGGFAAGLAIVPYYNKPSQEGMYQHFKAIADASDLPIIIYNIPGRVVVELTPETMLRLADHPNIIGVECTSLANMAYLIEHKPEEFLIYTGEDGDAFHAMNLGADGVISVASHTNGDEMHEMFTAIAESDMKKAAAIQRKFIPKVNALFSYPSPAPVKAILNYMGFEAGPTRLPLVPAPEEDVKRIIKVVVDGDYEATVTGVLRPDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure, Function, Stability and Knockout Phenotype of Dihydrodipicolinate Synthase from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
molecule tags Lyase
molecule keywords Dihydrodipicolinate synthase
total genus 105
structure length 306
sequence length 310
chains with identical sequence B
ec nomenclature ec 4.2.1.52: Transferred entry: 4.3.3.7.
pdb deposition date 2012-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 4fhaA00
5MHBA 5DCDA 3MP3A 4AH7A 3G0SA 3G1YA 2GUUA 4LS1A 4LTSA 3WK2A 3IV3A 2VEMA 2Y7DA 1L6SA 1PHQA 3W85A 2CU0A 5DXXA 2A2IA 2PRLA 3EEGA 2V2HA 2JGQA 2R8WA 3RF9A 3O63A 3TIMA 3S1VA 1T96A 1OK6A 2GJLA 2RHGA 5FF2A 3P67A 1TPVA 3W72A 1UUOA 3YPIA 3ZWTA 5AHLA 1OFOA 4L4LA 1HO1A 5D33A 4FF7A 1KTNA 1TYGA 2YW3A 3IEBA 4NJGA 3TXZA 3LCFA 3PBUA 2AGKA 1W37A 4LVAA 4NQ1A 3C6CA 3Q58A 5CSRA 3NQGA 2YCEA 3UWQA 1PCWA 4LY8A 1BWKA 4DF2A 1XL9A 3HGRA 4E0CA 1JRBA 3EXTA 3K30A 2V81A 3STCA 1LORA 3ANYA 3DFQA 5H91A 2OZ0A 1V7YA 1H51A 3A22A 1TV5A 4FXSA 4WY0F 3BG3A 3DBPA 3STFA 3TNOA 4AWTA 3C4UA 5C2XA 2DJLA 4ORMA 1KFJA 4O1DA 2JKEA 2XFWA 2JBMA 4MZYA 1I2QA 2V5BA 1EWEA 3NEVA 4JYEA 1Q6QA 4LV9A 5H2ZA 2FPTA 4OWGA 4LVDA 1D3HA 1QMLA 2HS8A 2DZUA 2YR1A 5IBXA 4ZQOA 1SO5A 4UTTC 5IM51 2ZRVA 5EY5A 5G5IA 1NAL1 1NSJA 1CW2A 1FXQA 1XI3A 4P2VA 1O60A 1I8JA 2CLLA 5AOUA 4UR7A 4OE7A 1S3HA 3PC0A 1FWTA 2V82A 1A53A 5CSSA 4O4WA 3E49A 4X3ZA 5K4ZA 1RQHA 5F4SA 3LHUA 5U4NA 2QCNA 4JGDA 3ABRA 2C3ZA 2AQWA 1ME7A 1R2RA 3C52A 4JS3A 3F4WA 3TQKA 3PF3A 4GBUA 4FNUA 4ML9A 4BF9A 5DCEA 3TSMA 3CM4A 3GDKA 2CW6A 1GYLA 3L68A 2G97A 2E5DA 3TX9A 3IGXA 1MEHA 3LHVA 3TAKA 3W7IA 3S6DA 3TUUA 1YTDA 3GXTA 1GQNA 3M5YA 3GAKA 3W7KA 1WBHA 1H60A 4JDBA 2H8ZA 2B0MA 3GB6A 3SGUA 4DO4A 1XDMA 4MLRA 4JTUA 5C6MA 1C9DA 1FWWA 1B9BA 1OX4B 2CLIA 3M44A 3VKJA 1LOQA 3W7HA 2UV8G 4PCFA 3LV6A 4QAIA 3FIGA 1Z42A 2ZTJA 4UC5A 4IMCA 3LDVA 3W87A 3TCEA 3PBYA 3B0VC 4QITA 2FLIA 1G67A 3B06A 1RQEA 1SR9A 1G4TA 3NQ2A 4O28A 1GVRA 3N73A 3UXAA 3I7RA 3T7VA 1T99A 1SZGA 1K8XA 4CQAA 3S5NA 1QDSA 1LLZA 3QSTA 1PV8A 2VOMA 1RV8A 3ZFHA 4HNNA 4UTJA 5LNUA 4IX0A 4GUHA 4AHQA 1EP2A 1SUXA 1FCUA 5BW6A 2LLEA 2YPIA 1JCXA 2VFDA 3TFXA 2VXNA 3NPWA 4AEOA 5KMYA 1DOSA 3I6RA 4K8EA 1GG0A 4XKYA 6ALDA 1EA0A 4I7VA 2QUUA 3BW4A 1IXNA 1H7PA 3IIOA 2RFGA 4JX4A 4FHAA 3W1MA 4K7VA 4TR9A 3GR8A 3G22A 3W2LA 5K9CA 5AHIA 1H7WA 4R33A 4ZQPA 1VYRA 2Z0IA 1GVQA 3TH6A 3CB8A 1SZEA 1KLYA 1KV5A 5F1VA 2YSWA 5BMXA 4MZ8A 5J5DA 4EVZA 4WZHA 3LX9A 1FUYA 4UUIA 3PR2A 2RH9A 3NQEA 4MLJA 4IMDA 2Z6JA 3IIXA 4IPJA 3OIXA 4OGZA 4UMBA 4UTTA 1MEIA 4M5PA 3S1XA 1A5BA 4FX7A 2VENA 1DJQA 3W7QA 3UY7A 4UNKA 1MXSA 1TV8A 4AF0A 1RD5A 3IGUA 3LRMA 4LC8A 3G24A 4XTIA 1OX5A 2ZZ3A 1DJNA 3R5EA 1NF0A 1JULA 1KM4A 2WSQA 4D2JA 2QCFA 4QNWA 4UMCA 2BTMA 3LCXA 3KVLA 4MYAA 5F4WA 5G1YA 4DO6A 3BG9A 3DI1A 1SW7A 4JEQA 5FESA 2CZ5A 2Q3RA 1KM2A 3LCWA 5AHEA 4DBEA 3O1NA 1YDVA 1R30A 2CZEA 3EXSA 3QPZA 4HT3A 3T44A 1EB3A 1ICPA 2BZNA 4UFLA 2CLFA 3FJLA 2CWNA 1VRDA 4O19A 3L21A 4TIMA 1KTCA 4AWSA 4HNVA 2QCCA 1XBXA 2YFOA 4S1FA 5AC7A 3W2MA 4H3DA 1AW2A 1JR1A 1OFQA 3NNTA 3O8AA 3LHTA 2ZTKA 1TQXA 4BR1A 1OFPA 1OYAA 1GVFA 4LS2A 3JS3A 3OEXA 4MIMA 1IIHA 3I7SA 3EWXA 3W07A 3TW6A 5DN1A 3LHYA 1AL7A 4CQ8A 4WUIA 5EBUA 4FX6M 2VEKA 3TAOA 4CCEA 4O18A 3M47A 1I2PA 4EOUA 5AHFA 3VE9A 4ONVA 1B4EA 4GC4A 4OBTA 4CQ9A 3W9ZA 2YXGA 3EKLA 3BO9A 4DQWA 3GR7A 3B8DA 3OG3A 3IVTA 1DKWA 1RPXA 3F03K 3W1RA 3M5XA 2YYTA 4MFDA 2HSAA 3FKRA 4CLMA 4L4MA 4NU7A 1VLIA 1KFCA 2A21A 4UTWA 4MKNA 2JKAA 1HFBA 1OFAA 3CHVA 4GWEA 3W1AA 2RKXA 1LYXA 3TMQA 2YYUA 2B7PA 1GWJA 4IQLA 4NJHA 4AXKA 4POCA 3Q2DA 4NT0A 2OMAA 2E09A 1ADOA 4E38A 3DKLA 2E5BA 3A23A 2QUVA 2VEPA 4UTHA 5ABTA 1GYNA 4JIPA 1FCQA 2E6DA 1CI1A 1HO4A 1W1ZA 3L5LA 4Y9AA 3ATZA 2ZZ7A 1WBJA 2ZZ1A 2P10A 3W7PA 4CNPA 1W3IA 4A2RA 1LBMA 1TREA 1SZNA 5F2MA 5SWUA 1RR2A 3HQ1A 3EXRA 1MO0A 3LTYA 1KM5A 1XBYA 4LUJA 4NJKA 1LRQA 5CZSA 1F73A 3ATYA 5LNSA 3GNNA 2WQPA 3M7WA 5F2LA 2NZLA 4U28A 4UMAA 1HL2A 1TTJA 1W0MA 2A1YA 2FDSA 3QH2A 3RLVA 1TCDA 1GTHA 1SW3A 5AN7A 3W71A 3PVFA 1R47A 2R91A 3CC1A 5D30A 4JICA 1UUMA 2O7SA 3S5OA 1RZMA 3R12A 4M6QA 4BI5A 4TX9A 1ZCOA 2A4AA 2DJXA 3TJLA 3DENA 3ABSA 2RDUA 3W74A 1S5VA 5D04C 4ADTA 1H62A 4FIQA 1F5ZA 4O1CA 3LI1A 1FCVA 4WY0B 2CFFA 2DZSA 3STEA 2B4GA 1JJKA 1TPDA 1YTEA 2J24A 2ISSA 4LU0A 2E1DA 2EKCA 3MJYA 1YYAA 4NVTA 4O8RA 1U83A 3A24A 3H55A 3VNDA 3KHJA 4IUOA 4NJJA 1UBSA 2Y70A 3Q94A 1QPOA 1Y0EA 2ATSA 1M6JA 3RLUA 1YPFA 1F6PA 4I7WA 4LT9A 5EKYA 3M16A 1AMKA 2Z1BA 1XCFA 4R53A 4LVFA 2Y85A 3SW6A 3T78A 3FJ6A 5CPLA 4MY9A 3W7CA 2O7QA 4LV4A 2WKJA 1K3UA 4Z1DA 3G0UA 3BGGA 3USBA 1LP6A 1V5XA 3G1HA 3S5ZA 1GVSA 5KZMA 2CLHA 2QDHA 1QWGA 3W2KA 2WNZA 4ADUA 1YDNA 1TPWA 3KXQA 3NDOA 1ONRA 3HG4A 4HNTA 3WJWA 4A29A 1ML1A 3S42A 3UD6A 4N6FA 2NUYA 1XM3A 4HHPA 1K03A 2CLOA 2W79A 1JCJA 3SFKA 3P61A 2Y7EA 1ZNNA 1L2UA 1LZOA 2X16A 2E68A 3DKJA 5F4XA 4MYXA 4YWIA 3W88A 3LBCA 3CIWA 1DBTA 4QIUA 1TJRA 3A5FA 1TB3A 3PB2A 2XN1A 4JDYA 4FXRA 5E93A 3O6YX 5HJLA 2DZPA 2EGZA 2C13A 3EKZA 3QPYA 3GLCA 4O17A 3P7YA 1UCWA 2H3BA 4IOTA 4KFPA 1AK5A 1TPC1 3UPBA 1I4NA 1H50A 1G69A 4IXXA 3KRUA 3QQ0A 3N9SA 2NUXA 2C14A 4HPXA 4JTHA 5L6UA 5G4EA 1WX0A 4PH6A 3VFLA 3PG8A 5BMWA 2YGYA 3CEPA 1EP1A 4KFNA 4UTWC 1KM3A 4PTNA 3BW3A 3KOFA 3R89A 3CT7A 3UXDA 1W5QA 1TPFA 2AAMA 3U6WA 3NL6A 2BLEA 3THAA 4IX2A 4GUFA 2ISWA 3TK7A 1LTDA 2D73A 3TFCA 1BWLA 2OT1A 5D2YA 2A7PA 2ZCGA 5DBUA 1XUUA 3I68A 5AYZA 2EAWA 2J6XA 1F74A 1FQ0A 3G3DA 4M7SA 2QAFA 4TMCA 3N19B 3BV4A 4HIBA 4A3UA 3E9AA 3EWUA 1ICSA 1DVJA 1FWNA 4Q33A 4ZZ9A 2ISVA 3NGJA 3W76A 3LOTA 1ME8A 1SU5A 5CZJA 3QF0A 2NWSA 4JXCA 1YADA 4N9BA 2NX3A 5TQLA 4KWVA 1T0OA 4BWLA 3S9YA 3L5MA 2HTMA 5C55A 4NNBA 4DPPA 2F84A 4RCXA 1VCFA 1F76A 4E2BA 2C16A 1ICQA 2Y62A 5G2WA 2NXGA 1SFJA 3FFSA 1QCWA 1W5PA 1JUBA 3IIVA 3MI3A 4LS0A 4LWWA 4AHPA 3VCRA 5D2VA 1GG1A 3LCLA 1GVOA 3BVJA 3KRSA 1JCLA 5C5YA 3CLMA 2C0AA 3P81A 2QUTA 3EWZA 4TO8A 2W6RA 1OYBA 4O54A 4CCCA 3BLIA 3MWAA 2QCHA 3P8JA 1LRTA 1SZFA 1J2WA 4PODA 3UPWA 1UB3A 2QF7A 2FPYA 4O11A 4Z1AA 5LGXA 1B57A 1KBIA 1PE1A 4K37A 3Q37A 5U7SA 2GOUA 4WXYA 1LM1A 4N4PA 2YFNA 1QOQA 1LBLA 2WOQA 2TPSA 3LXBA 3KAOA 2X1RA 5HR7A 1VJIA 3NM1A 1AW1A 5FF4A 3NQ7A 2X2GA 1N7KA 5K3VA 3C2EA 1TV7A 3E02A 5CGQA 1ZY9A 4NX5A 3P80A 2FFCA 2A5HA 1GZGA 2Z2UA 1G4SA 1BKSA 4ADSA 2ZRXA 1OF8A 3VI2A 3W22A 3V75A 4JY8A 2ZZ2A 4DXVA 1H7OA 5D32A 4XTDA 3LHZA 1IXOA 1R2TA 1W5MA 2GVJA 3E12A 3DHFA 3NZ1A 3W1UA 1PS9A 3MYOA 2CLEA 3P62A 2FPVA 2B7NA 3N3MA 1H63A 1K7XA 1G4PA 3B0PA 3TQVA 4WY0A 3EX6A 3DFNA 2XN0A 3M5VA 4WXZA 5CPNA 2WO5A 4NZFA 4LVGA 3IVUA 4IGHA 4UTLA 2CLMA 1JUKA 3L0GA 1TIMA 2DORA 1H1YA 3P74A 3MHFA 4G1KA 2GVLA 3MHGA 4NXKA 4NX0A 3IIPA 2BWGA 3DHDA 1SSGA 1TMHA 1NFBA 3NL2A 2RDTA 4JTGA 3NAVA 2C19A 1EUNA 4GNJA 1VC4A 2IQTA 1SO6A 2WV8A 4UTKA 1FDJA 4DO5A 1YLVA 3TDFA 3HPXA 3NA8A 2I1OA 3WK0A 1EP3A 5G4WA 3P84A 2J27A 2PE4A 3G8EA 4S2CA 3W1PA 3T40A 2NWRA 1XFBA 1T8XA 1WYIA 2WJZA 5KITA 3MUXA 4PA8A 3FOKA 3WK3A 3BGJA 2G5WA 4Z0JA 2Y89A 1FDZA 3P8IA 3QQ1A 2VFHA 3GVGA 1S5TA 2QJHA 4DBDA 1K8YA 5KSWA 1TPEA 2ZRZA 1J4EA 1XC4A 2YZRA 3V1PA 1DQXA 3C2OA 4A2SA 5G2IA 3EWWA 3KFTA 3B03A 3TXVA 3D0CA 4ZQRA 1NEYA 1S5WA 4I9AA 5HQEA 4DF1A 4A22A 1DHPA 3M5ZA 3NQAA 1U5JA 3BPWA 3ZR4A 3NQMA 2X1UA 2ZA1A 4OQVA 4Y8FA 3G8RA 3H53A 3CU2A 5AHNA 1L9WA 4GRSA 4O13A 3LHWA 3TROA 3PSVA 2J9ZA 3ABQA 3G1DA 4YCOA 4NUWA 1FCBA 3GDMA 1GEQA 2ABAA 1VLWA 4K38A 3RU6A 4K7YA 4HN4A 2ZRWA 3BK0A 2ZDRA 3W7JA 1OFRA 3NYZA 2E6AA 5HULA 3FEMA 1TTQA 1TRDA 2YDAA 4FEZA 1JCYA 2C18A 3PY2A 2V8ZA 4RZ5A 2WSYA 2J9XA 1A5CA 2JK2A 5KZEA 3T55A 1H1ZA 4JIQA 5C54A 4MVAA 3W1LA 5HUOA 1QFEA 4UFMA 2VFEA 3W3OA 1L6WA 5FEWA 1W5NA 3HF3A 4K36A 2NX1A 3NO5A 3NQCA 1Z41A 3LV5A 5BNKA 4IWWA 3TC7A 3TMLA 2QR6A 5DCBA 1XDLA 3UWWA 4TMBA 3IVSA 4JTSA 3MMTA 3W1QA 1BEUA 3EWYA 1QPNA 4O12A 4ORIA 4JTKA 2TSYA 3WJXA 3HMJG 1JRCA 2ZQ0A 4JNMA 4EF8A 1SW0A 3A21A 5J5RA 2FIQA 4HKPA 4BFAA 1GTEA 4N6EA 2QKFA 2QCEA 3QMTA 1YTKA 2WSRA 3DGRA 3LXCA 5DLCA 3HPSA 4RXFA 5I3FA 4IPIA 1EUAA 1O4UA 3G1FA 2J9YA 2Q8LA 1SFLA 5LSMA 1K7FA 3PB0A 1WOAA 3NM3A 4UTIA 1THFD 2PCQA 1G6CA 4PC8A 4UNLA 1MSSA 3M1ZA 1LCOA 3P60A 4K6AA 3TSBA 2DZVA 1X1ZA 3NVTA 3GNDA 4Y6GA 1W56A 3GK0A 4B5NA 1WQ5A 5CZTA 2OJPA 3ELFA 2EPHA 5A5WA 4O52A 4ZVJA 3HJZA 1XBZA 3DI0A 2JGYA 2G95A 5HUPA 4GUIA 1ME9A 4H6KA 4NZJA 2E6YA 1IF2A 2C6QA 2RDWA 3N14A 2X1SA 1KTBA 2NXIA 2OX1A 3IIZA 4WJEA 1D9EA 3QJAA 2ZRUA 4ICNA 3OHIA 1IXQA 1YDOA 4ZQMA 3O05A 4O57A 2GVGA 2H3DA 2V30A 1GT8A 3TR2A 4Z1BA 4NNCA 4NXSA 3QC3A 4UFIA 1H7RA 4UR8A 3NL3A 3PUOA 2V9DA 1RVGA 4DEFA 4YXGA 4EWND 2OCZA 4RK8A 1L6YA 1ZJIA 1TPH1 2DP3A 3NQ6A 1LDCA 3LCGA 3TQ0A 1N8FA 1JQVA 1F6KA 2V5LA 3ZS4A 5LHEA 1KW1A 5AHMA 4Q4KA 1VHNA 3NXFA 2ZBTA 1K8ZA 5T26A 3M6YA 3ABOA 1JVNA 3QRHA 3STGA 1FDYA 1TO3A 1C8VA 4O1BA 1LBFA 2TRSA 3NZRA 4FNQA 1P0NA 1XBVA 4IMFA 1VZWA 5KZDA 1KBJA 5F1UA 3OVPA 3L66A 1OX6A 4AF0B 1FWSA 5CG7A 3TSDA 1QOPA 2CZFA 2VEIA 1TQJA 3G3MA 4MOZA 2ZA2A 4QNEA 1K02A 2R94A 1P1XA 1YXYA 1EEPA 1FX6A 4MY1A 3GDRA 3B04A 4OV9A 3QYQA 1KM1A 4AVFA 4QM1A 4JTFA 4JN6A 5DY3A 1TSIA 4JTLA 1Q6OA 2QCLA 1UJPA 4KWWA 2Y7FA 3TC6A 2A0NA 3SECA 3I7QA 1VYPX 2ZZ6A 2Y63A 1A5AA 5K4XA 5FI8A 4CCDA 4FIRA 5BOOA 2DZTA 2NUWA 2BSLA 4X2RA 3M0ZA 3HIJA 3UNDA 5LNWA 4XZ9A 4FO4A 1WAUA 3RFAA 5KINA 1CX9A 4GUGA 1H61A 4M7TA 3W7DA 3UY8A 3C56A 1KFEA 3N2XA 5HNRA 5DELA 1YPIA 1F7BA 3AJXA 3EB2A 3G1AA 3WFAA 4OV4A 5K7JA 2ALDA 4HSOA 2X1TA 1TTIA 5LKYA 1M5WA 4O10A 4BK9A 3UQNA 3MHUA 4ZQCA 2GQAA 5AB3A 5D2TA 5FF0A 2YX0A 3HGOA 3UWYA 5AC6A 3CPRA 3SZ8A 4UFJA 5AYYA 4FNTA 3DAQA 4UCGA 4LVBA 5LZLA 5D37A 3PBVA 4AAJA 3RMJA 1JQXA 3C2FA 2HS6A 4YMZA 4JY9A 4OU1A 4J9JA 5I3HA 3W84A 2QCDB 3L5AA 1VHCA 3W7OA 1WA3A 5DBTA 3HGJA 1C29A 1EPXA 3U8GA 3GAYA 5TIMA 2ABBA 4I7UA 3O07A 3AO0A 4HPJA 2PRMA 1E51A 3KRZA 3QFEA 3JRKA 3PBWA 1KFBA 4R7JA 4YCPA 1HG3A 4UIOA 4X9SA 3DXIA 3W23A 4WD0A 5CKSA 3EX2A 4AWUA 3M41A 3HB9A 3W6YA 5D05A 3HG2A 3CQ0A 5G1TA 1NVMA 5AFDA 3QW4B 3OVQA 1ZAJA 3PUEA 3E96A 5AYXA 3R13A 4ALDA 3CWOX 1F2JA 2DZXA 3SIZA 4QQ3A 5HWMA 3NPUA 1VYSX 3GZ3A 4Y96A 2Y6ZA 1QAPA 4LNYA 3H54A 4PFMA 1KM0A 4LRTA 2NLIA 2Q3OA 1IGSA 3S1UA 3L0KA 3S5YA 1O95A 2W0UA 1ZALA 2VC6A 3W7LA 1IIGA 1B4KA 1OJXA 4O4VA 4BI6A 3NL5A 1OG0A 3HPZA 3NG3A 3LRKA 4M19A 5FF3A 4AB4A 4RR4A 5HWJA 5L9FA 3CWNA 1BTMA 2V2DA 3MBFA 1OVDA 4Z08A 1H7XA 3LTPA 1M7PA 2A7RA 1PHWA 3S8HA 1Q6LA 2E6FA 2TYSA 1FXPA 1PIIA 1KFKA 3C61A 1O94A 5FEPA 1GJPA 4UTUA 3DFTA 3NQFA 3CTLA 3M43A 4Q32A 3PS7A 3BG5A 1ZENA 1P5BA 1TPUA 2BXVA 3TE9A 1VCGA 1VQTA 2Y7GA 1MZHA 4Z0SA 3LRLA 3G1SA 5E1QA 4JX5A 4YLWA 3UZJA 4NJIA 3DZ1A 4Z1CA 3W7NA 1SO3A 2A7NA 2NV2A 3RNDA 5HINA 3UYCA 5EPDA 2CZDA 3SY5A 3BLEA 4BWLC 3FYOA 3TV8A 3FLUA 3DFOA 4XWUA 3BW2A 4GFSA 1GOXA 2GQ9A 1GPWA 4JYDA 3C3NA 2NV1A 5K2ZA 4N9DA 1DV7A 2V2CA 3LB0A 5HMSA 3IRDA 3L9CA 4M6VA 2EHHA 4QISA 1ZHAA 5D02A 4LRSA 4QJ1A 4HNUA 1F05A 1D3GA 1VS1A 4P61A 1NF7A 4O14A 2Y61A 4GJ1A 3PAJA 4RJEA 1QNVA 1B3OA 1KFLA 3GKFA 3MW7A 2I9EA 5HWNA 2QAPA 4O16A 4WX2A 1I2OA 1XUZA 2H90A 3W7RA 1M7OA 3O16A 4JYFA 4WOZA 4U4MA 1G7VA 1KA9F 1X8FA 4K39A 2B7QA 5LGZA 2HMCA 3KX6A 3GXPA 3L2IA 3NQVA 3GX9A 4ZQNA 1FBAA 3SSJA 3LCIA 2ZFAA 4S2BA 4M6PA 3S0CA 4PL1A 2QCGA 1OX4A 5DXYA 4FX8A 2WPBA 1ZAIA 3O15A 2GJNA 1Q45A 5A8GA 2QJIA 5F2GA 8TIMA 2VKZG 3PM6A 3UWVA 1MEWA 2P0OA 4PL2A 4HSNA 4TU1A 1PL9A 5CPMA 3RK8A 3UWZA 4DPQA 3PG9A 1OYCA 3W86A 4KFOA 1X6UA 2F7FA 1ZFJA 1A50A 3G1VA 4UXDA 2C1HA 4MJZA 3BARA 1VR6A 3OA3A 2QDGA 4IXHA 4NNAA 4N2YA 3S1WA 1HUVA 1H7NA 3F1QA 3WJSA 5D38A 5EMUA 2FJKA 1AL8A 1HTIA 3OVRA 3W2UA 2EF9A 3WK1A 2Y88A 3HG3A 3LBMA 3LXAA 2VFIA 1YXCA 3SGZA 3QMRA 2FTPA 1QPQA 2X30A 2DZWA 3BLFA 2E77A 1W5OA 4IMEA 2VFFA 4LOCA 1R46A 4UFHA 2FB2A 3FA5A 3R2GA 3N2MA 4A21A 1JUEA 5D03A 4JTJA 2GPTA 2A6NA 3VE7A 3FKKA 4YL2A 1Z48A 1W3TA 3R8RA 4JX6A 4O0KA 4RZ4A 1H5YA 3PUDA 1XKYA 3B4UA 3QM3A 4RZ6A 1QR7A 2C15A 3MP5A 3CIXA 5FEZA 3C2VA 2A85A 3EX4A 2ATMA 1J5TA 5I3IA 2WNQA 2FQIA 3DU0A 3HO8A 3LLFA 3W1NA 3LLDA 5F2IA 3SI9A 4N9EA 1VCVA 5BRBA 4FNPA 3E0IA 3N34A 4XUGA 2P1FA 2B7OA 4GXMA 1DL3A 1X7FA 4IJBA 5E0KA 5FEXA 1O5XA 4FB7A 2I14A 4BI7A 3OBKA 1AW5A 2PRHA 5I3JA 1G4EA 3G18A 3DH7A 2CLKA 5FF7A 3SR7A 4R34A 2V0TA 3C2RA 3P5YA 4XBKA 1TRIA 3NOEA 5DY2A 3LI0A 3TA6A 3GIYA 4ZMGA 3DFSA 1PVNA 3KVJA 2R14A 1QPRA 5LNRA 2FB3A 1QO5A 1Z44A 4MUZA 4N02A 3HGSA 4JTTA 3NPXA 4N9CA 4WQ6A 3QMSA 1W3NA 4LW7A 2QCMA 4O0ZA 2QJGA 2JKPA 3HOJA 4RLIA 3NPVA 3KVKA 3LERA 5KTLA 1OFDA 3W2JA 4E2DA 4CNNA 4EIVA 4KKXA 3O6DA 4OT7A 7TIMA 1Q6RA 4ZL1A 5K9XA 4AHOA 1RQBA 5CPOA 1TJPA 3W7EA 1FY6A 3GDTA 3TKFA 1ZAHA 3MI6A 1VPXA 5EYWA 3LGEA 3LTSA 4O53A 4O15A 4RV8A 5K9DA 3P5ZA 1IXPA 3LM7A 3M9YA 2H8XA 2ZRYA 1LRNA 5AC8A 5IBXC 3MI2A 4WOQA 1W31A 1EIXA 1X1OA 1OF6A 3W1TA 3GDLA 3O06A 3L65A 4O50A 3GXNA 1OABA 3N9RA 1DQWA 1TPB1 2G96A 3QSRA 5CZ0A 4GE8A 2QEZA 3B05A 3CEUA 3TJXA 1LROA 3QEZA 3ZWSA 2KZHA 2OT0A 3W73A 3B0UX 3JR2A 1LLWA 1EWDA 1Q3NA 5GVJA 1G7UA 4FNRA 1AG1O 3EX1A 3GYEA 1W8SA 3O6CA 1SO4A 1YXDA 1PCKA 4K8HA 1VH7A 4XQ6A 4UFKA 4QSHA 1WV2A 4MJMA 4LUIA 3GKAA 3FS2A 3IGSA 1KLZA 3NQ8A 4N4QA 4JTEA 3MBDA 2GQ8A 4MY8A 3LCHA 5HR6A 1N55A 1FWRA 4XBSA 4MFEA 2A6LA 3W70A 3MYPA 3INPA 3L0NA 4IMGA 1OHLA 3EX3A 1I2RA 3KVMA 5D2WA 1WXJA 2QCDA 3PSWA 5EL1A 1P4CA 5D2XA 1W54A 2ZZ4A 1I45A 3PULA 2WNNA 2H6RA 1ALDA 3DFPA 5D09A 1KV8A 3W2NA 1SSDA 1WOBA 5LHFA 3QZEA 2XN2A 4LC6A 2Z6IA 3UZ5A 4RXGA 4AMAA 4Y90A 3EWBX 3HG5A 3MP4A 4O1AA 3HBLA 4JR5A 4CNOA 2J88A 4PEKA 1TTPA 6TIMA 3MO7A 4JTIA 4OHQA 4C1LA 1UASA 4RKAA 1JCNA 1LOLA 3TW7A 4H4IA 2ZA3A 2VELA 3FYPA 5LNVA 4JD4A 1R2SA 3C8FA 3A5VA 2NX9A 4FNSA 3WJZA 1QO2A 3F4NA 3WJYA 3I65A 4C1KA 3W83A 1SQ7A 1OFEA 1SPQA 1KM6A 2ZYFA 1XXXA 3G0XA 1A5SA 3G1XA 2BX7A 2NXHA 1WDWA 4UTMA 4X22A 3PWAA 2Q8ZA 3QW3A 2PC4A 3UWUA 3A9IA 3W75A 1VGAA 3NQDA 3T4CA 1OFBA 1I2NA 1O5KA 4MZ1A 1JCMP 5G2HA 3THQA 2ZZ5A 3U2OA 4EF9A 2VFGA 3W1XA 5I3GA 4RX0A 2DU2A 3P82A 5TBOA 3TU9A 4MPQA 3SJ3A 1P0KA 4GUJA 3W7GA 3W7MA 4W9TA 1DORA 4DELA 1K7EA 3L67A 3NR0A 2E5CA 4DF0A 5I3KA 1OK4A 1EX5A 3C0JA 4XKYB 5EA9A 2TMDA 2PURA 2YW4A 1LOSA
chains in the Genus database with same CATH superfamily
2WC3A 5DCDA 1F4AA 5CLTA 3G0SA 3WMBA 2WZIA 1VFSA 4UOQA 3B4YA 3OQ8A 1L6SA 1GQIA 3W85A 5M5DA 4A3RA 2PGEA 3QN3A 1FKXA 5EB8A 2PRLA 2V2HA 2WCAA 1IEWA 2GJLA 3P67A 1TPVA 1LG2A 3YPIA 4HMCA 3N11A 3ZWTA 3W27A 3QR0A 3CMFA 4L4LA 5H8PA 4FOUA 5D33A 1KTNA 1TYGA 4NJGA 4X60A 3PBUA 3C6CA 3Q58A 4YPJA 1S1RA 2QV4A 3H4XA 2V81A 4KRTA 3STCA 3ANYA 1V7YA 4WY0F 3STFA 4AWTA 5LA2A 4HGXA 1B1YA 2XFWA 2V5BA 1Q6QA 4E2VA 1OC6A 1CYGA 2XINA 4LVDA 4DJED 4D6IA 3BL3A 4IT1A 3ERPA 4F79A 2V3DA 3OTRA 1XCWA 3REQB 4HQVA 3CWHA 1DIDA 4HK5A 1W3HA 3QR1A 1L8NA 5A94A 1IV8A 1CW2A 1NSJA 4P2VA 1OCQA 5CSSA 4L6DA 3B0YA 4XZWA 1JPHA 3UG5A 1RQHA 2WZHA 1MXGA 3VD7A 3ABRA 3C52A 3F4WA 2QIWA 3MDUA 5LXEA 4BF9A 2J6VA 3HFYA 1NTHA 1GYLA 3VXGA 1Y5XA 3SCSA 1Z69A 2E3ZA 3WL1A 1ONWA 3W7IA 3CXOA 3TUUA 3OGRA 1GQNA 3GAKA 1ZQ5A 1WBHA 2WVVB 1MUCA 3B3DA 1TVPA 6PTDA 2F61A 4M80A 4MWAD 1B9BA 3TQPA 3WENA 3UVAA 1S2WA 2V38A 5JBEA 1R0MA 2GVEA 3DYMA 1Z42A 3MMWA 2ZTJA 1MQPA 3LDVA 3VA8A 3B0VC 2QJMA 1JAEA 1G4TA 5T9CE 3NQ2A 1Z9AA 3D46A 3BMXA 5LA0A 2ICSA 4CQAA 1K8XA 3S5NA 3N9KA 1BQGA 1LLZA 1PKYA 3R0KA 3AXMA 1KR1A 1RV8A 3OLIA 2WBGA 4UTJA 3EAUA 4S3GA 4AHQA 2GJRA 5BW6A 1FCUA 2YPIA 1JCXA 2VFDA 2Z4GA 4K8EA 1R85A 6ALDA 4XKYA 3PFMA 1IXNA 1H7PA 1Q6FA 1Q8AA 4JX4A 1DWIM 3H70A 3THDA 1UHVA 2H9AA 4TR9A 3ITLA 3G22A 3W2LA 4RDVA 3AS3A 4UOJA 1NOUA 2F6XA 3TH6A 1KV5A 3UXIA 5I00A 4MZ8A 4D9PA 1J6OA 4WZHA 1XICA 2FDMA 3V0UA 2PDUA 3FCPA 1V3IA 4EPKA 4AD4A 4WGHA 4ZE4A 1E56A 3R10A 3NQEA 3A4JA 2I7GA 4IH3A 2XIMA 4UMBA 4UTTA 1MEIA 1LWHA 2VENA 1OB0A 3UY7A 2DT0A 4GQBA 5IHSA 1J93A 4AF0A 3IGUA 3LRMA 1P0EA 3WQCA 1IT8A 1DJNA 3L4WA 1NF0A 3QTGA 3UVIA 5I7GA 3BC9A 2WSQA 4QNWA 3E2QA 2PDPA 4LYPA 4UMCA 4FK9A 3SN0A 3AHVA 4IG2A 3QBUA 3GH4A 2WM1A 4GVHA 1SW7A 4JEQA 5D9OA 5AHEA 3S3GA 5FESA 2GGHA 1XIDA 3TTEA 3O1NA 4MKVA 5EGRA 3UERA 1YDVA 1JI1A 1ISYA 3CYVA 4J5NA 3EXSA 4R88A 4RNIA 1ELSA 3T44A 1V79A 3O7UA 1Q6CA 3GBDA 7ENLA 3ZO9A 3FDKA 3KTXA 4E3TA 4WVXA 1PDYA 4AWSA 4AEEA 4S1FA 3W2MA 4BR1A 3EWXA 3LHYA 4CQ8A 4WUIA 3ISIX 2OVLA 2VEKA 3Q4DA 4W93A 4GI8A 2PTXA 1SZRA 4W88A 4WSHA 4L9YA 2O9OA 3M47A 5CGTA 5AHFA 3VE9A 4ONVA 3WQOA 3W9ZA 2XZ9A 1Q7QA 1E5JA 4WJ8A 4FS9A 3ITCA 3WFLA 4DQWA 4LXFA 3VILA 2E67A 1WDQA 4GK8A 4ZFCA 9XIMA 2HSAA 3GVRA 4L4MA 4L65A 4UTWA 2JKAA 1XF0A 4UWMA 4AZCA 3W1AA 3C0QA 2RKXA 3ZJ8A 4FLSA 4PMUA 1MQQA 1GWJA 2GZXA 4IQLA 2DUZA 4NJHA 2JQXA 2UBPC 2QF8A 4S3CA 4U10A 4POCA 1XQLA 2OMAA 1EFZA 2YL5A 2E09A 4E38A 3AS0A 3M0YA 2PP0A 4MADA 1HO4A 1GOQA 2EG6A 1SMDA 4Y9AA 1I0DA 2BGQA 2VVSA 4Q7BA 3E2VA 2ZZ1A 1WZMA 2P10A 4JKMA 3SRDA 1JZ5A 1OC5A 2HPIA 3WQPA 2EQDA 3BXWA 5SWUA 2OEMA 3EXRA 2XVNA 1LRQA 5CC3A 3ATYA 5LNSA 1DJGA 2ESCA 3VKDA 4V33A 2WQPA 5F2LA 4AZGA 4U28A 1X7IA 2VGIA 1TJ2A 4QRNA 1VPYA 5HQMA 2YCLB 3QV6A 1YHTA 1UUMA 2O7SA 1Q4NX 1DWGM 4R5EA 4DO7A 1MXDA 3F5KA 4M6QA 3GVWA 3DENA 3KOYA 1BYDA 3H4WA 2RDUA 2XM1A 2P50A 5D04C 4M81A 1QHOA 1P7TA 4PCNA 1H62A 4UZUA 2IQ0A 2JFEX 4O1CA 1FCVA 3N6QA 3ZOAA 4G56A 4UQAA 1YX1A 1YTEA 2ISSA 4XZHA 2QJJA 4NVTA 3F4DA 1E55A 3KHJA 3ARZA 1HW6A 3Q94A 1QPOA 2XGIA 5ABFB 3DESA 1Y0EA 2VZSA 2ATSA 5A6BD 1DWHM 3RLUA 1YPFA 1BVWA 4EACA 5EKYA 2YLAA 3ZVHA 1AMKA 4PN2A 4RDZA 3RILA 4R53A 4LVFA 3A4XA 3SW6A 2WSKA 4C65A 3CHCA 4CQDA 1JG9A 3K4AA 3USBA 3HZ3A 3MKCA 2ISFA 2D2GA 3S5ZA 4XSLA 3RUBL 3E6EA 3W2KA 4US6A 2WNZA 1B3WA 5EMKA 3H2MA 1PXGA 4RPPA 1QW7A 1V0NA 4A29A 2OQHA 1ML1A 2DT1A 3CUJA 2NUYA 1XM3A 4HHPA 2DZBA 4MB4A 1O68A 1JCJA 3WLPA 1YBQB 4AY8A 1E9YB 3BSMA 3SCNA 4C6BA 4XZNX 2A3BA 2E0PA 3W88A 2Y0FA 3LBCA 3CIWA 4KERA 3S6TA 2FVLA 1XLBA 2XN1A 3NVDA 1G5AA 1NDYA 1NDZA 5HJLA 2EGZA 3CTTA 1ADDA 2CHOA 4PUWA 4LUYA 4DAFA 1CECA 4GCXA 2PP1A 4V1YA 1TPC1 3UPBA 9CGTA 4NAEA 2BHUA 1Z89A 3UPMA 5CEWA 2NSXA 1GONA 4JTHA 3CEPA 5ECVA 1HKVA 3F4VA 3KOFA 5A6LA 3VKBA 1TPFA 4QQUA 4GYFA 4PRRA 3THAA 4C90A 1CB2A 2ISWA 4TUFA 2E4TA 3TFCA 1BWLA 3FGCA 3GNRA 3WH7A 1XUUA 1F74A 4ZOAA 3W00A 3LUTA 3QHMA 3BV4A 3KDNA 3CL8A 4R9XA 1DVJA 1FWNA 1YW1A 2A3HA 3W76A 3PHAA 4B5UA 1I1WA 1IE7C 3AOFA 2I5IA 5CZJA 4JIRA 4CKQA 2DQWA 2NX3A 4JOMA 4Z17A 3IARA 1XLGA 3T2QA 5C55A 4NZ3A 3AS1A 4NNBA 4RCXA 1VCFA 5JH1A 2J7CA 2OZTA 4H6EA 2WM0A 4LWWA 3MI3A 4L56A 4AHPA 3EDFA 3SCPA 3VCRA 4LCRA 4WLCA 4C7FA 1O1ZA 3IAQA 2W4XA 3EPMA 1RVKA 2QUTA 4LPCA 3SCOA 4KMQA 5H8MA 1SJDA 2NT0A 4ZO8A 2G4JA 2XGZA 1LRTA 3UPWA 3MMUA 2Z7GA 3LENA 1TV2A 1PE1A 1TR9A 2GUYA 5U7SA 2W63A 1UC5A 2YFNA 4CD7A 4YVXA 2TPSA 2X1RA 3R11A 4I6KA 3IV8A 2X2GA 1N7KA 5K3VA 3CZ8A 3E02A 3HM7A 3NGFA 4NP7A 3CJPA 3WBAA 2DW6A 2YCKX 4HU0A 2FFCA 1N8WA 3DFYA 1G4SA 1BKSA 2BB0A 4ADSA 1BRLB 2ZRXA 1OF8A 4XBJA 1J12A 1H7OA 2XVPA 1W5MA 3WDIA 3NZ1A 3VDAA 4EXQA 5I5RA 4MWAA 3VIHA 2B7NA 3N3MA 2VYOA 3B0PA 3SQMA 4WY0A 3MDWA 2C91A 1W9XA 3IVUA 3BUVA 4WCJA 4NYYA 2DORA 3RGTA 2VZVA 1EH9A 4GG9A 4G1KA 2GVLA 4NX0A 4TXEA 4UBPC 3WD3A 4C6NA 3IIPA 3WLTA 2HDJA 3BZGA 2OR2A 1FHLA 4HK7A 1NFBA 5BOEA 3V5CA 2RDTA 2VJXA 3C2YA 1EUNA 1JPMA 2NW0A 4QHRA 4NZCA 3K8LA 2C71A 2WV8A 4HBKA 4NYUA 4DO5A 2Z2AA 1XYZA 1JIBA 3SRFA 4D6EA 4W5ZA 4JL2A 2PE4A 3N4EA 1OG6A 1WYIA 4MSSA 3FOKA 3CAQA 3ZT6A 2MNRA 2IKGA 3CUIA 2G5WA 4Z0JA 4IPNB 3S46A 4D8AA 1S5TA 2X0YA 2QJHA 1K8YA 3SO7A 1TPEA 3PZTA 4GGHA 5G2IA 3QY6A 2ZXAA 1KFWA 2I5QA 2QUMA 2XFFA 4ACYA 1NQ6A 4KEZA 4B3ZA 1DHPA 3NQAA 3ZR4A 3ITXA 3IPWA 2JE8A 2X1UA 3H53A 2D0FA 4RE0A 2DH2A 5C70A 1FWAC 1PZ2A 2ZE0A 1FCBA 3O9NA 1OCBA 3GDMA 3H12A 3H2NA 4K7YA 2ZRWA 8XIAA 4IP7A 1RK6A 2W67A 1J0KA 4ZODA 2YDAA 3H22A 2C18A 1RH9A 5JBFA 3T2PA 4S3DA 2GVYA 1CDGA 2VQTA 2FFIA 2YB1A 1RCQA 3AJ7A 1VJZA 4QX4A 2X0SA 2P8CA 5HUOA 1QFEA 4JPGA 4QJ3B 3LY0A 2BY3A 2DFAA 3PP7A 4XD3A 5E9XA 5FEWA 4F0SA 4YTQA 3H6OA 3VM5A 3NO5A 1Z41A 4F0HA 3BH4A 4RNJA 3IK2A 2J8FA 4ZSTA 3TMLA 1HF6A 2QR6A 4GISA 5DCBA 3T2OA 3IVSA 3KP0A 3MMTA 1QPNA 2A3EA 4O12A 2Q01A 2EG7A 1QW8A 3VIJA 4QLKA 3WD2A 3HMJG 1JRCA 2GJPA 2P88A 4EF8A 1SW0A 3V0TA 1TG7A 2FIQA 4HKPA 4KT2A 1TWWA 1XKJA 2SFPA 1GJUA 2YCIX 4ATLA 1UD8A 4XO7A 2OQYA 3HPSA 3KOXA 1K6WA 4FAMA 2BVWA 1NOFA 1E0WA 2Q8LA 5LSMA 3PB0A 1IQ8A 2PAJA 3OGSA 4E8DA 2YL9A 1G6CA 2DT3A 4CCZA 3M1ZA 3VNZA 3EB3A 1NWTA 3EWDA 3TN6A 2OYMA 3O0FA 3GNDA 4Y6GA 3VMPA 1WQ5A 4FSAA 5I06A 4E2OA 3DI0A 3PTMA 4A8NA 2PTWA 4JFVA 2PEVA 4GUIA 1RJQA 2C6QA 2RDWA 3IIZA 4YU1A 5LIYX 3QJAA 4ICNA 5D9PA 1ZUAX 3VIKA 2D20A 1R86A 3WH5A 2DZAA 4Z42C 1ODUA 5DRIA 4O57A 2CKRA 2H3DA 1XLEA 2WB5A 4B5SA 4H9YA 2V30A 3D3AA 4UFIA 4XVEA 4AYGA 1L6YA 2Y4SA 2FGBA 1ZJIA 2ZADA 3NQ6A 5FCZA 5I3DA 3WY1A 4NILA 3LCGA 4A05A 1JQVA 4HJWA 3K4DA 1F6KA 1JEZA 2O9TA 3R8HA 1EYEA 2ZBTA 4O1EA 1JVNA 3QRHA 3STGA 4QDMA 5HNNA 4P8VA 4P8UA 1DQUA 4O1BA 1JYNA 4IIFA 4IMFA 1VZWA 2IKHA 5F1UA 2W92A 4I5UA 5FJPA 5CG7A 4NAEB 4GIEA 4Y9MA 4A3QA 3G3MA 1V6UA 4MOZA 2ZA2A 5BWFA 4HU3A 4QNEA 1K02A 3E0VA 1YXYA 1EEPA 2PI6A 3UP8A 5GJPA 4H2HA 3BLDA 3JVAA 3GHUA 4PUDA 4JTLA 1Q6OA 4MDOA 1UJPA 2FMNA 1UR1A 5E6YA 3F4CA 1ODZA 4LEQA 1A5AA 2RDXA 2QLYA 4CCDA 1HJWA 2NUWA 3W4RA 1RY0A 3ONCA 3M0ZA 1DJYA 2DSWA 4XZ9A 1E3ZA 4FO4A 3GFZA 4ECLA 3W7DA 4V15A 1KFEA 2ZXDA 5DELA 3VIGA 1F7BA 1X6NA 3AJXA 3WFAA 2Z1WA 3VC5A 1WPCA 1UR9A 1M5WA 4CNTA 3UQNA 3MHUA 5AB3A 3HGOA 3ZR6A 2TODA 4AU0A 4UCGA 3H8AA 4KEVA 3TONA 3PBVA 3GHTA 5GQBA 3A13A 4JTAA 4OU1A 4J9JA 1WDPA 2GSEA 2BBFA 3H21A 1UD6A 2G0WA 3CPUA 2V63A 3U8GA 3K13A 3TZNA 1XIMA 5TIMA 4I7UA 2PC8A 3O07A 1JDEA 2XPKA 2PGFA 2AAAA 3KRZA 1YNPA 2Y8KA 3WUBA 4DRSA 3LMZA 3CUHA 2D0HA 1RHCA 3UFYA 1E9IA 2R1PA 2IQDA 4X9SA 4GX8A 1BYCA 2G3JA 5G4HC 1H0GA 1RLCL 5CKSA 3EX2A 4Y2WA 2YIHA 5D9MA 3M41A 4H9VA 5D05A 1YE6A 1XLKA 3HG2A 4EXBA 5AFDA 1NFGA 3P0WA 2D3LA 4B5XA 3N3TA 1I9CB 1PUDA 4DM2A 1F2JA 1RAKA 4JAWA 1WUEA 4DI9A 2PDYA 3FHQA 5EMYA 1D2KA 3QVQA 2Y6ZA 4US5D 4PFMA 1AZ2A 1KO0A 3W81A 1PJ9A 2PWEA 2AMXA 3L0KA 3S5YA 3VNYA 4HZ6A 4K2SA 1P0DA 2EBNA 2VC6A 1E9LA 3W7LA 2FJUB 3QHNA 1V6YA 4O4VA 4BI6A 1MRAA 1OG0A 3HPZA 3N4AA 3LRKA 1W1IE 3M64A 3KM8A 3STPA 3ZIZA 1OIFA 1H7XA 3LTPA 1M7PA 5C8BB 3I3DA 4DJDA 4OIFA 4PMOA 2TYSA 4ZCWA 1PIIA 2PWVA 1JNEA 2W5FA 1A3HA 4PSRA 4F48A 2PCEA 4Q32A 1F9CA 5KZ6A 1ZLPA 3D5HA 1VCGA 3CPGA 2Y7GA 4C5YA 3ARRA 2FZMA 1QASA 3DZ1A 4Z1CA 1M9HA 3PTDA 1SJBA 5C9RA 1SO3A 4S23A 1NELA 2NV2A 4NAFB 1U1UA 5HINA 3UYCA 5EPDA 2QHAA 3AIEA 4H2CA 2HE5A 1UD2A 4LEFA 4UQBA 2EPMX 3FYOA 3FLUA 3BW2A 5T91A 4J2PA 2XIIA 4JIEA 2NV1A 4GMEA 3WBXA 4F0KA 3N29A 2CBIA 4AC7C 1ZHAA 4ZFMA 5G1MA 5D02A 4QJ1A 3QV7A 4P61A 4S3BA 1RXOB 3WFZA 3PAJA 4CUCA 3P3BA 3GKFA 2QAPA 4WX2A 4JTQA 1TV3A 2ZC8A 4RNHA 1M7OA 3WQVA 2UWFA 3T42A 4U4MA 5EMMA 1L6FA 3H24A 1V51A 2B7QA 1ITCA 2XVKA 1XC6A 4AX7A 3KX6A 4H04A 1UW9A 1X6LA 1LUCA 3W38A 1PZ3A 1R3QA 2BVTA 5DFAA 3TWBA 1MRQA 1EJSC 4X9YA 4FX8A 3URAA 5GNXA 2GJNA 2X8RA 1AH0A 2QJIA 4XK2A 4TU1A 2ANUA 1HVXA 5CPMA 3RK8A 1UR0A 4OECA 1JXKA 4H00A 1ZFJA 3G1VA 4MJZA 2QDGA 4NNAA 4N2YA 4GOAA 1AJZA 3RX2A 1H7NA 3DG3A 3WJSA 4PRTA 3S9IA 5D38A 3EBVA 4KWUA 3EWCA 2Y88A 1JAKA 3CK5A 3B8UA 3HFTA 3NDYA 3SGZA 3K8MA 1B30A 2E77A 2HISA 3CZLA 2VFFA 4IMEA 4XAYA 4LOCA 4UFHA 1R46A 4JTJA 1J18A 2A6NA 4GQRA 1OZQA 1Q13A 3KOZA 1H2JA 4XAPA 4RZ4A 4NF7A 5FSEC 3I3BA 5HMEA 3RO6A 3PUDA 1XKYA 5JBDA 3PZVA 2A85A 3BOXA 2OLHA 3LK6A 1A5KC 1J5TA 1PX4A 2FQIA 1GPFA 3W1NA 4XZMX 1XLHA 3SI9A 1BYAA 5BRBA 2ZX9A 4FNPA 3E0IA 4XUGA 1PYMA 4IF2A 1DL3A 1X7FA 2P3ZA 5FEXA 4H9XA 4FB7A 1KKOA 1VFUA 1O66A 1V02A 3WQEA 4TVDA 2PUZA 1VBHA 3DH7A 3AXKA 1JPIA 3LI0A 5ABFA 3GIYA 4J3UA 4P8XA 2PBOA 1PVNA 3EOUA 3KVJA 2J74A 5LNRA 1HVQA 3R43A 2ZDSA 4RZBA 3TZFA 2FB3A 4N02A 1US3A 5H6HA 2CXEA 1EKOA 4B90A 4JTTA 5MKGB 4WQ6A 3QMSA 4O0ZA 1OCJA 2QJGA 2PA6A 3LGDA 1UYQA 4RLIA 2INFA 1QBBA 1OFDA 2HWGA 3L4UA 4O1FA 4CNNA 4YVPA 4KKXA 3ARYA 5K9XA 4AHOA 5CPOA 4KWSA 3W7EA 1FY6A 1EGMA 1Y8BA 2OXNA 5CPSA 1VPXA 4TVUA 2DVTA 3VKAA 4O15A 3SY8A 2EKGA 3AIRA 3IJ8A 3P14A 4KF1A 3OW1A 4J40A 3IUIA 5AC8A 3U5UA 5E0CA 1RPKA 1M53A 4HHLA 1X1OA 4NZ4A 2IUZA 2VZTA 3KWSA 9XIAA 3H26A 3ANUA 3FSUA 1TPB1 3PTKA 1GGOA 4PUJA 3MSRA 1KCZA 4DVOA 4HNCA 3VOFA 2XDFA 3CEUA 2CBUA 4QS5A 3MCOA 4DZIA 4M3PA 1U5VA 1AG1O 1W8SA 3L12A 5XINA 3SCRA 4XQ6A 4MJMA 2ZICA 4LUIA 3NQ8A 3GHSA 2YBUA 4REQB 4MY8A 1LL4A 3CV7A 3WLHA 4C6LA 1RCOB 2W62A 3BICA 2IW0A 1I2RA 4H7VA 4YYFA 3KVMA 3DBNA 3EMQA 3B97A 1WXJA 2QCDA 4KGLA 1JNDA 5EL1A 1P4CA 4IUGA 1W54A 4E4PA 5BROA 3GTIA 4B16A 3ZVHB 4LC6A 4M8UA 1OGGA 1H41A 3HG5A 3MP4A 4HTBA 4O1AA 3HBLA 4JR5A 4N42A 4CNOA 4PEKA 4O8AA 2WJDA 1UR3M 4OJYA 1JCNA 1LOLA 2DIKA 3DG6A 3POHA 2HNHA 4WKHA 1VP5A 3GXIA 4FNSA 4U5KA 3AU2A 3F4NA 1ECEA 3I65A 3V0SA 2OLSA 3W83A 2O56A 3V36A 3GXDA 1AH3A 3CV2A 1A5SA 2NXHA 5CXPA 2X05A 4EPEC 1OT2A 1HKKA 4X22A 1HJSA 1MZRA 3A9IA 2V5JA 3VNIA 3T4CA 1OFBA 2G3FA 3VZXA 1KQYA 4IIDA 2ZZ5A 2Z1SA 5I3GA 4RX0A 1NP0A 2J79A 4MPQA 4GUJA 4IQDA 5IDIA 3W7GA 5B80A 1AMYA 4W9TA 4J4KA 1G01A 4DELA 1S38A 3L67A 1MDRA 3NR0A 2E5CA 4B2DA 1P7TB 3C0JA 4XKYB 1FWHC 3QY8A 2YW4A 2WC4A 5MHBA 3APYA 3MP3A 4AH7A 1A47A 7TAAA 2GUUA 4LS1A 3H2OA 2F38A 4K68A 4LTSA 3IV3A 1L8PA 3WIJA 1KC7A 2J8TA 4DJDC 2VEMA 1AVAA 3VOJA 2RJHA 3UZZA 2QGHA 2CU0A 5DXXA 3BOFA 3RF9A 1T96A 2RHGA 1EJUC 2FZBA 2QVNA 1EHAA 1EQPA 1Q6GA 5AHLA 4X2PA 1UP3A 3TXZA 1EX1A 1UZDA 1W37A 1OEPA 3GH7A 2YCEA 3F2CA 3HGRA 4MB1A 4DUVA 3K30A 1HN1A 1M01A 5H91A 3A22A 2GGIA 2PZNA 2IPJA 3VOCA 8RUCA 1R3VA 4ORMA 3GC2A 3OP2A 2G41A 4MNLA 4JYEA 4XZBA 3HV8A 1DJHA 1V77A 4YNGA 2DZUA 2YR1A 4YJ5A 5IBXA 3M0LA 1F61A 2ZRVA 5EY5A 1NAL1 1FXQA 1O60A 4UR7A 1W1TA 3KCJA 1FWTA 1UD5A 7REQA 3XIMA 4X3ZA 4F9JA 3UWEA 4JGDA 3RX4A 5FJUA 1HZYA 1R3WA 1VBUA 1A5MC 2JF7A 2XSBA 4LSBA 1ME7A 1R2RA 3LNPA 3TQKA 1VIZA 1WE5A 3PF3A 4GBUA 3O2LA 5M1TA 4AISA 3L68A 2G97A 1MEHA 1P6BA 3U9IA 3TAKA 3S6DA 4U31A 4GQ0A 1DP0A 3M5YA 4B3KA 3B8VA 1H60A 2B0MA 3GB6A 1XDMA 4JTUA 3HQNA 1TA3A 1C9DA 2GSHA 3VKJA 1JZ2A 4PCFA 3RM4A 3LV6A 3NSXA 4QAIA 3QV9A 1MDLA 1J6PA 4FXFA 4UC5A 1R38A 3ITOA 5BOFA 3PBYA 3T6CA 4QITA 1G67A 4O28A 3T9PA 1GVRA 4RPQA 3D47A 1UP2A 2AQVA 1QDSA 4LAUA 3QSTA 1PV8A 1R7OA 3UZYA 1IWPA 3ZFHA 3MZ2A 1AQ0A 3H2CA 1BVZA 5GJNA 2LLEA 1GHRA 5KMYA 4DY1A 3NPWA 3VCCA 4I7VA 2QUUA 5E5CA 3K1GA 3VUPA 2RFGA 2VTFA 4FHAA 1HKIA 4NZ5A 4JCMA 2NQZA 3GR8A 5A8MA 1UWTA 3WDRA 5A8PA 1GQLA 1OCNA 5ABGA 3URBA 4R33A 4ZQPA 4AD5A 1GVQA 4EK7A 1SZEA 1QXLA 1KLYA 4V27A 4YTRA 4C6PA 1YIXA 3FA4A 1FUYA 4UUIA 4GI4A 1EJVC 3PR2A 1XQKA 4MLJA 4OGZA 3CMJA 3AMCA 4M5PA 3N25A 4FX7A 1OWQA 1SMAA 1Y5VA 3OIHA 4MWAB 3VC6A 3W7QA 1MXSA 3CQJA 1TV8A 1RD5A 4GI6A 3WMSA 3G24A 5E09A 2X09A 4XTIA 3TN4A 2D1ZA 3GR4A 4DX3A 4PUNA 4UNIA 3SIMA 2HCVA 2QCFA 4KETA 4MYAA 5G1YA 1KB3A 1NH6A 3BG9A 5DT5A 2CZ5A 1KM2A 3PANA 1SR0A 1R30A 2VRQA 1ZZMA 8CGTA 4H19A 3OZOA 4ZB5A 3EA1A 1L2QA 4HT3A 1Q63A 2OZ3A 4QTGA 1EB3A 1ICPA 3NURA 3VTRA 1X1NA 2AL2B 3FJLA 2CLPA 2O92A 3ARQA 3I4KA 3BURA 3VOHA 3V7PA 4HNVA 1XBXA 2CCRA 2HRWA 5AC7A 4HN8A 1ESWA 1R8LA 3SEPA 4H3DA 1AW2A 1OFQA 5BWAA 1OYAA 3EDKA 3OEXA 3T8LA 1IIHA 4IQJA 5DN1A 1PO9A 2JEPA 3LG3A 1C93A 3TAOA 4Z2HA 3LPGA 1DWFM 2BMBA 1JD7A 1JFXA 2ZE3A 3WLQA 3RJXA 3BJTA 1DWJM 1HL8A 4GC4A 3S2LA 3EKLA 2PLCA 4D1IA 2OELA 3B8DA 4RE3A 1DKWA 1RPXA 3F03K 3H2AA 3M5XA 3WQ5A 1J0HA 1QI4A 1BD0A 1CPUA 1D8CA 1AQFA 3RITA 3QOMA 1HFBA 1OFAA 2YL8A 3CHVA 4GWEA 2XFRA 3BE7A 5KEZA 3UEQA 5JUVA 1LYXA 1TMQA 2A3LA 2B7PA 3PZ9A 4C6IA 3NSNA 3ALGA 2AKZA 3WF0A 4C7DA 2V6AA 1DWAM 1PAMA 5I0DA 4DNHA 3D3FA 3AHYA 4XB3A 1R5YA 1B5TA 1FCQA 4H8UA 3W25A 4A35A 1UROA 3CS2A 1DE5A 6A3HA 4PR4A 2GSJA 3V3WA 1N82A 4GGBA 2OB3A 3W7PA 1OBAA 1HQTA 2PWUA 2WANA 4IPLA 2YZ5A 1W3IA 4XG1A 4A2RA 3FVMA 2O55A 1SZNA 3VNJA 5AVHA 4EWJA 1RR2A 3KS6A 2WWDA 3HQ1A 1E6XM 1KM5A 1XBYA 1BVNP 2HZGA 2NQJA 3TYAA 2O4MA 4PGLA 3NZPA 4Z1YA 4G6CA 2GOKA 4C91A 1TTJA 2A1YA 2FDSA 2BP1A 1TCDA 2PDNA 2GGGA 1GTHA 1SW3A 3NZQA 3BQ5A 3EOLA 4V28A 1QI0A 4GVFA 3CC1A 2XWEA 1UOZA 4OUEA 2J25A 3LEPA 1RZMA 3KTCA 2WSPA 5FD0A 3RN6A 2DIJA 3ABSA 3DX5A 1TJ1A 2GDUA 1S5VA 2EJ1A 4FIQA 1BXNA 1F5ZA 3LI1A 4DB7A 2G4FA 2B4GA 1RK5A 3U4AA 1TPDA 2Z1VA 4P7NA 3COTA 4HOWA 3RM8A 1AQHA 1U83A 3A24A 1Q6EA 3H55A 1O12A 1UBSA 1QI5A 3M0MA 3MZNA 1M6JA 4LT9A 1XYBA 4GJJA 1F6YA 2D2JA 3XINA 1FH8A 2Y85A 3ZR5A 2D24A 3W7CA 3KWXA 1K3UA 4Z1DA 3G0UA 4CEXC 5A6KA 3HPFA 1J0JA 3IWPA 1V5XA 1UOKA 4JTDA 3AISA 3ARSA 1GVSA 4M29A 1QWGA 4GLEA 3GWQA 4ERIA 4ADUA 1TPWA 3GXMA 3NDOA 4HNTA 3WJWA 3T0DA 1V3LA 1MVYA 1XGEA 1K03A 2CLOA 2W79A 2DQXA 3SFKA 4KBXA 4INFA 1L2UA 2NQ9A 3JZEA 5A6BA 3GXFA 3W28A 3DKJA 5DT7A 4MYXA 4YWIA 2PDKA 4Q3MA 1H4PA 3RRAA 3I6TA 4HNOA 3SADA 3O6YX 3TYUA 4Q8WA 3QPYA 4E4UA 2XM2A 3NZGA 4UTFA 2H3BA 2JIEA 4ATWA 4ZBCA 4GO9A 1I4NA 3W02A 1NIUA 1H50A 1G69A 3QLLA 4IXXA 1FH9A 1C7TA 1UH4A 2C1GA 2C14A 5L6UA 4KEUA 3WLRA 2NQLA 3VFLA 3PG8A 5BMWA 2YGYA 1EBGA 1EP1A 1KM3A 2UY4A 3A64A 3RHGA 2WHMA 2WVVA 1W5QA 4UR9A 2Y5JA 4FLOA 3VGEA 4E4FA 3IK4A 4GYKA 4HZ8A 4IX2A 4GUFA 3N17A 2B31A 2A7PA 1E6ZA 6ENLA 5AYZA 2J7FA 2HVNA 2QMJA 2EAWA 2CESA 1BWVA 1CGUA 1V02E 2QAFA 3QYSA 3LZ5A 4B2DD 3E9AA 3WLOA 1UPPA 3R94A 3GQYA 4BY3A 3QF0A 1YADA 3U48A 4ZXOA 4BWLA 2D23A 2HTMA 2V5CA 5HJXA 4FMVA 4I9TA 4R7WA 1F76A 4P8WA 3U3HA 4E2BA 1UIPA 3IIVA 3UGVA 4OBRA 1DIOA 3WEZA 5D2VA 3QTPA 4CD5A 4DJEA 3FXGA 2E7FA 1EYWA 2NQHA 2NQ5A 3CBWA 4H7CA 3DGBA 4CCCA 3RMEA 2QYGA 3P8JA 1V08A 4F8XA 3SUVA 2FPYA 1KCLA 2JALA 3R7MA 1TX2A 1W3KA 1KBIA 4URIA 3RPMA 3Q37A 2GOUA 1G1YA 1LM1A 4PUMA 1DXIA 3UNTA 3UESA 1QOQA 1LBLA 4C1NA 3FA3A 3MPGA 1R3RA 3VZZA 3HPAA 3NM1A 3NQ7A 4GNVA 4Q8MA 4P7OA 1RBOB 1ZY9A 3IANA 4NX5A 2OWWA 4PBGA 4RNFA 4DAIA 2XU2A 3P80A 2FYMA 3E38A 2ZUTA 4JY8A 2PDIA 3QGKC 4XTDA 2VZOA 2GVJA 3E12A 5EBAA 4GFIA 4G1NA 3U7VA 2CLEA 2X41A 2X7WA 1R7AA 1G4PA 1TA3B 3EX6A 3DFNA 3UG4A 5CPNA 1IEIA 1A5UA 4LVGA 4PMDA 4QR6A 3L0GA 2QS8A 1H1YA 1P43A 2VX7A 2PU1A 3MHGA 4NXKA 2PTZA 3SJNA 5C2CA 2I17A 2OWCA 1TMHA 4IIBA 1XIGA 3CO8A 3QKZA 3QR3A 2IPGA 1CIUA 4FA3A 2HQAA 4OOUA 3T0TA 5E6ZA 4UTKA 3M0JA 4QE5A 1E4LA 4CU8A 3WDHA 3WK0A 4EPBC 1HGWA 1EP3A 1DIEA 2J27A 4J28A 4BHYA 1QK2A 4S2CA 2NWRA 3CL6A 4D6CA 5KITA 2Z24A 3W53A 4PA8A 4C6MA 1Q8JA 3WK3A 2J7DA 5FL0A 1YNYA 1UQZA 4HCDA 2OFJA 2Y89A 4PMNA 1XRSA 3WLKX 1OADA 5AYBA 5HAOA 1J4EA 2YZRA 3V1PA 3ITTA 1EC8A 3EWWA 1IYXA 3B03A 3HN3A 4U33A 1LT7A 2HJPA 5HQEA 4A22A 1U5JA 3PJTA 3UETA 3B9AA 2HROA 1AFSA 2ZA1A 4OQVA 5AHNA 1L9WA 4GRSA 4I8YA 3G1DA 4YCOA 4NUWA 1ZS2A 4K38A 3RU6A 2QPUA 1KRCC 3VKKA 1FWGC 3DYOA 5HULA 1TTQA 1TRDA 4FEZA 2L5HA 1A3XA 2J7GA 3L2LA 3AWOA 2OEJA 1SM9A 2VGFA 4H9TA 4HHMA 5I07A 2Z2BA 1CGXA 1S5NA 5KZEA 3T55A 1H1ZA 4MHBA 4WF7A 4UFMA 5C2GA 2VFEA 2POZA 3VIMA 1SJCA 1XGDA 3HF3A 1VPQA 3LV5A 4QE4A 3B0XA 2FTYA 2VD8A 2WLYA 4C6EA 2KX9A 1B90A 3UWWA 4PBFA 3GU9A 2ZUUA 3W1QA 2BHYA 3EWYA 2XVGA 4B4FA 4F0LA 1XGZA 1NP2A 4NIRA 2WCGA 4QCEA 2ACRA 2TSYA 3WEOA 1UD4A 4IFOA 3WJXA 4I6VA 5I03A 3SAZA 3VZYA 3DC8A 1EJ7L 4K1WA 2OYLA 4BFAA 1GTEA 1T7LA 2QKFA 4N6EA 2QCEA 2ZX8A 4R85A 2Z1KA 3IJ7A 4QBXA 5DLCA 4C1NB 5I3FA 5C9WA 3VAVA 3G1FA 2QGYA 1WOAA 4UTIA 1W32A 4PC8A 3P60A 4AZIA 2DZVA 1X1ZA 4LB3A 1UP0A 1R6WA 3W82A 3R0UA 3VMOA 4B5NA 1BYBA 2OJPA 4C60A 2EPHA 4AXNA 4O52A 3AQUA 5A8QA 1DTNA 2JGYA 3SCTA 1E6RA 2G95A 1P48A 1FP8A 4JKKA 2XFYA 4H6KA 1RJRA 2X0HA 3LN3A 3OPSA 1HKJA 2OOGA 2ZRUA 2GFTA 5HPCA 3AALA 3Q45A 3S2MA 4ZQMA 2DDXA 4Q7IA 5CC6A 2DH3A 1YRRA 3PJXA 2GVGA 4P7RA 4IFRA 3CQKA 4Z1BA 5FIPA 4NNCA 1MQRA 3QC3A 1S2VA 1H7RA 2V9DA 4LF1A 4TV5A 1US0A 4XAFA 4DEFA 4Q8VA 1SGJA 3KOWA 4RK8A 3WLIA 3GG8A 1J01A 2D3NA 2DP3A 3ZVIA 1LDCA 2NVDA 3TQ0A 4LH8A 5LXXA 2IXUA 2V5LA 3ZS4A 5E0FA 2ADAA 4IZGA 4Q4KA 5A2CA 3CT2A 1VHNA 2XZ7A 3WMLA 4Q8TA 3M6YA 2BOEX 4CEUC 1GKPA 3AZRA 2V68A 1TO3A 3CH0A 4X61A 2CETA 1C8VA 1C9WA 1LBFA 1WKFA 4FNQA 1ZJAA 2X2YA 1C8XA 2WJEA 3BSHA 2VUYA 1KBJA 1XRTA 3N6JA 1OX6A 1F3EA 3C86A 1FWSA 1F07A 3RXZA 4AF0B 3TSDA 5I09A 2CZFA 2VEIA 1BAGA 4W7VA 3VGHA 5IOBA 2HXTA 1TQJA 3E3HA 1TZ7A 3LPPA 3WNLA 1EXBA 4OV9A 2BHZA 1KM1A 3SB0A 4GD0A 4AVFA 4Q4SA 3P0XA 4Q8OA 5DY3A 1TSIA 4BEUA 4KWWA 1E4IA 2A0NA 2A3CA 1Q5MA 1VYPX 2DSKA 2ZZ6A 3W6MA 4XVDA 4YHGA 3VPLA 1MFUA 3HIJA 3IACA 3RFAA 3V1HA 2J77A 1CX9A 3UY8A 3WQ8A 3MV11 3N2XA 2F6KA 3G1AA 1CBGA 1IR1A 1QWKA 5K7JA 2ALDA 1TTIA 7A3HA 2H9AB 4O10A 5JIPA 2Q71A 3EGJA 3M0HA 2YX0A 3UWYA 1W1PA 3CPRA 4FNTA 3VK5A 5D37A 4ZENA 1BSIA 1CZ1A 1EZ2A 2DEPA 1UMLA 3VM7A 4FP1A 4JY9A 4YVVA 5I3HA 4IJCA 5BU9A 3IJ6A 3AC0A 5DMLA 1EPXA 1K6AA 3GTHA 4I8DA 3B9OA 3MMDA 2E8YA 3VIFA 3UZXA 4HJFA 4HPJA 1EGZA 5EFFA 1KRBC 2GWGA 6CGTA 3RAOA 3HTWA 1EJRC 4YCPA 3FAXA 1IHIA 3L4ZA 3DXIA 1KCKA 4PB5A 3MANA 5CBJA 1XH2A 2NSOA 3TVAA 3HB9A 5ECUA 1UH3A 3Q65A 3DUGA 1GKQA 5G1TA 1NVMA 3QW4B 2OKTA 3OVQA 1FWCC 2J8GA 3BAYA 1UJQA 3ARPA 4ALDA 3CWOX 4I9MA 2CEQA 2GQ3A 1XW8A 3U57A 3GZ3A 4P7LA 3OZYA 1G94A 1WB0A 3AWNA 3VGDA 4GIAA 1KM0A 1POJA 2NLIA 1GVIA 3DHPA 3SN1A 4W84A 1O95A 2W0UA 2D69A 4F2TA 1O7AA 4JFUA 5FF3A 4AB4A 5HBFA 4PMRA 5HWJA 1BTMA 4F4RA 2V2DA 3MBFA 2W61A 4QROA 4XZLX 2A7RA 1LL7A 1Q6LA 1E0XA 1BKHA 3WNOA 1FXPA 1KFKA 3PPHA 3C61A 1XR2A 5I23A 3GY1A 5FEPA 3UR7A 4DN1A 2UY3A 1E4NA 1EHNA 3QV8A 1P5BA 2I5GA 4MGGA 5CSUA 2A79A 1VQTA 3CASA 2QZRA 3RCYA 3G1SA 4F66A 4JX5A 3UU0A 4W5UA 5EMLA 1BTCA 2QIIA 5HANA 2OEKA 2AL2A 3WDQA 3LLXA 2ZX6A 3SY5A 4AYSA 3BLEA 4BWLC 4HZMA 2RJGA 1NWSA 3DFOA 1UZ4A 2ZIDA 4XWUA 3VMNA 4GFSA 5C7VA 4B9YA 3VGBA 3WX7A 2V2CA 4AQLA 3A9BA 4M6VA 2EHHA 3KZPA 3PBMA 4HNUA 1F05A 1D3GA 1NF7A 4O14A 4GJ1A 1U1JA 3V5FA 3OYZA 1QNVA 1B3OA 1KFLA 4UQEA 2FKPA 3LSCA 2I9EA 4W89A 5HWNA 1OZMA 2PWDA 2H90A 3UG3A 4AIBA 4JYFA 4PTMA 1X8FA 4K39A 1GW1A 2HMCA 3K2GA 4L5ZA 4CVWA 3KRBA 4ZQNA 1FBAA 2ZFAA 4S2BA 1FTXA 1IWBA 2QCGA 1OX4A 3GVQA 1EIBA 4MTVA 5BYWA 1PTDA 5A8GA 4M24A 8TIMA 4J35A 2VKZG 1LQ2A 3PM6A 1XYFA 2P0OA 3OLGA 3PG9A 1OYCA 1X6UA 1E0UA 5TD4A 1A50A 1J5SA 5AC4A 1DYSA 2R82A 4F0MA 3ECQA 3OA3A 2GDQA 3QKEA 5LYRA 1XSKA 3S1WA 1K4GA 1HUVA 5EMUA 5HMFA 1AL8A 1W2VA 3WK1A 3HG3A 3LBMA 3LXAA 1XPGA 2WC7A 3TN3A 2DZWA 1ZBCA 4S3KA 2QUNA 4A8LA 3UYIA 4FLQA 3OB8A 4CD6A 3AIQA 4A21A 4TVCA 1HGYA 2GPTA 3IJLA 4PFHA 4EAYA 3RLGA 5BU6A 1FKWA 1RA5A 3MTWA 3VABA 2VD9A 3OYXA 3I3EA 3B4UA 1EOKA 4RZ6A 1QR7A 3PPCA 3MP5A 3MUIA 4XAZA 1XHGA 5FEZA 2QV5A 3U0HA 1HJQA 1LG1A 1VKFA 1R9ZA 4L80A 3HO8A 3LLFA 3LLDA 5F2IA 3NO1A 4XIMA 1VCVA 5T9BG 1UQYA 2B7OA 4GXMA 3NDZA 3AICA 4IJBA 5E0KA 1O5XA 3T0AA 3ME3A 3LYEA 5I3JA 1G4EA 4J2MA 2OGYA 3SR7A 3VDBA 3C2RA 3CQHA 3TYBA 4XBKA 1TRIA 3LS9A 3TA6A 1VFOA 4GVIA 3DFSA 1JYXA 3NFUA 3BQ6A 2R14A 3EDJA 1IGWA 1QO5A 4KCUA 4DBSA 2V3EA 4EAMA 1XD1A 2JKPA 1W9BM 1VRXA 1BQCA 2W3ZA 2YOCA 4DLMA 3NPVA 2CWXA 4DBUA 4KH2A 5TNVA 3W2JA 4E2DA 3O6DA 7TIMA 1KBLA 2FZNA 1EDTA 1ZAHA 3H23A 1RBAA 1UZHA 5EYWA 1IZCA 3LGEA 4O53A 4RE2A 4IG2B 4RV8A 1IXPA 3M9YA 2J75A 8XIMA 5JH2A 5IBXC 3DN5A 3MI2A 2J62A 4S3EA 4WOQA 1W31A 1EIXA 4GYPA 1OF6A 3W1TA 4UZSA 2PDQA 1HX0A 4AZ6A 1WXZA 1DQWA 4M1BA 4LALA 3P6LA 4GE8A 2RGLA 2QEZA 2XIJA 1DJWA 4GZ7A 2XGBA 3TJXA 3QEZA 2UY5A 2OT0A 3S2NA 1UPMB 1EEXA 5GVJA 1G7UA 4JQ1A 1PKLA 2BNJA 3GYEA 3S4TA 1VH7A 3R58A 3TYCA 3FS2A 2E9MA 4N4QA 4JTEA 4H01A 3WDPP 3BMVA 3G1RA 1IT0A 2GQ8A 2Z7KA 1N55A 1FWRA 3N2TA 4MFEA 1V3MA 1JZ8A 4ILSA 3B40A 4IMGA 3RM9A 4P5UA 3EX3A 4NI3A 1XS2A 4LBSA 1PEZA 4PRWA 3WNPA 1SYTA 1VIWA 4W8LA 3KBNA 1GQJA 3R79A 2ZUSA 1MNZA 3PSWA 3FYYA 3N15A 1PB0A 3AIWA 2ZZ4A 1I45A 3PULA 3ZM8A 5D09A 1KV8A 2VNCA 5CC5A 3QZEA 4L7ZA 3TP4A 2Z6IA 1UWRA 4RXGA 3F7JA 1ISXA 3T09A 1T41A 3VKCA 3DECA 1XWYA 3ARTA 3POCA 2DGAA 6TIMA 4AG0A 4AD0A 1UASA 2HK0A 4RKAA 3TW7A 4H4IA 2VELA 3FYPA 5LNVA 5BCAA 1R2SA 3C8FA 3A5VA 2NX9A 3SCWA 2WPGA 1GOOA 4W8BA 1SQ7A 3APGA 1OFEA 4ZOEA 4QJ5B 4NY2A 3VIOA 4D8LA 1WDWA 3PNZA 1RCXB 4UTMA 3E2SA 4Q4PA 1QNSA 1Y65A 2RUSA 3PWAA 2Q8ZA 3VD4A 3W75A 3BCJA 2XVLA 3NQDA 1O5KA 4MZ1A 1TCMA 1VBGA 3THQA 3KCLA 1FFRA 1ITQA 4DWSC 3P82A 3SUUA 2DY3A 3TU9A 1VJSA 1BGGA 3SJ3A 5LIKX 3W7MA 2P0IA 1K7EA 3VIIA 1CXHA 4DF0A 2ZC1A 1DPMA 5I3KA 1WDSA 2OSXA 1W6TA 1B3YA 5EA9A 2PURA 3TLQA 1LOSA 3AMGA 3G1YA 1T5AA 4DYEA 2F2KA 3WK2A 1DTUA 2WVUA 3NIYA 4G7EB 4LNCA 1PHQA 2QXWA 4M82A 4DJEC 3EEGA 3V16A 2JGQA 2R8WA 3TIMA 1RP8A 3TR9A 1OK6A 4S3JA 3W29A 1UUOA 3WNKA 3CL7A 4FF7A 4W8AA 1XCXA 2YW3A 3GDBA 2QDEA 4LVAA 4NQ1A 3MT1A 4DXXA 3WKZA 4XSMA 2XH2A 3NOYA 1PCWA 4DWSA 4AEFA 3SCUA 4DF2A 2VGBA 3UXKA 1XL9A 4E0CA 1M41A 1Y7VA 1JRBA 4WDTA 5LIXX 3DFQA 1GORA 2OZ0A 1H51A 1CTNA 1TV5A 3BG3A 3DBPA 3H2EA 4IP5A 2ZUMA 3WNNA 1KFJA 4S38A 2JKEA 2JBMA 1I2QA 2PDJA 4P7QA 3MS8A 3TOPA 1EWEA 3ZJKA 4AC1X 2NVAA 3ZT5A 2FPTA 4OWGA 4EKJA 4QXIA 2VO5A 2VUNA 1QMLA 4IIHA 2HS8A 3J7HA 4ZQOA 1SO5A 3AXXA 3PZMA 1ZPTA 5HOSA 1U5HA 1Z3NA 5XIMA 4UTTC 5IM51 1OQFA 1NFPA 5G5IA 1XI3A 1I8JA 5AOUA 2GL5A 2VX5A 2V82A 4HMNA 2J7EA 1A53A 5K4ZA 2FZ8A 3WQ6A 1BSLA 3LHUA 5U4NA 1AJ2A 1SVDA 4LAKA 4JS3A 4GXWA 3FN9A 5HATA 4ML9A 5DO8A 5DCEA 4NRSA 3CM4A 1AODA 1RJPA 3TX9A 3IGXA 2GWNA 3LHVA 2DT2A 4LUSA 4KESA 2WYSA 3W7KA 3S2JA 4ZEPA 1UMYA 3BCDA 1CXEA 4DO4A 1DIKA 1IEXA 3II1A 2O9PA 1OX4B 5HA7A 2CLIA 1LOQA 1J11A 1DHKA 4IMCA 4AZHA 3W87A 3ARXA 1LLOA 2FLIA 1SFSA 1RQEA 2PDWA 1KD0A 3N73A 4AVOA 2F9RA 3SSZA 1SZGA 3ICJA 2WMKA 5LNUA 4IX0A 5IDZA 1SUXA 2WMHA 4TX6A 1EO5A 1Y5WA 3I6RA 5BXRA 5CJ5A 1GG0A 1EA0A 5BRPA 4MPKA 4DBWA 4A8RA 3IIOA 1CGVA 3QPEA 5DF0A 1MW3A 3U2EA 1ADSA 2DSUA 4BKNA 1PIFA 3MU7A 5F1VA 2DPEA 2YSWA 4DHGA 5BMXA 1E9ZB 5DRCA 5J5DA 4EVZA 3M0XA 1E43A 1J2BA 3GFXA 4RE4A 2RH9A 4BF5A 3OIXA 3THCA 3S1XA 1J0YA 4QDPA 1A5BA 1DJQA 1CGTA 1TFVA 4UNKA 3KEHA 5FAJA 4E3VA 3EZ4A 1OX5A 2WHKA 5AECA 3ZSTA 1FHVA 4MAZA 1KM4A 3E0WA 1B31A 3IJIA 2BTMA 3LCXA 3KVLA 5F4WA 1D3CA 3DI1A 2PBGA 4QFUA 3PAOA 2Q3RA 3LCWA 1JF5A 3L7RA 1TWZA 4ZB0A 1PKNA 4QEHA 4Q6JA 2VC5A 3QPZA 4KCWA 1OIMA 2CLFA 4MB3A 3WN6A 3KL5A 3L21A 3C5QA 4AVNA 4LYKA 3AS2A 4M51A 4TIMA 1KTCA 4DUWA 1B3VA 2QCCA 5C7HA 3LHTA 3O8AA 2E9BA 1JXJA 3QQWA 1OFPA 4LS2A 2VC9A 2WBKA 3JS3A 4KIEA 4MIMA 3KCOA 5GJMA 3JW7A 3I7SA 3W07A 3TW6A 3AHXA 5EBUA 2HVOA 5A8OA 3FDGA 4O18A 4MDPA 4EOUA 3QGAC 4AMCA 2YDSA 3CUZA 2YXGA 3BO9A 3GR7A 3AMKA 3W1RA 2YYTA 4NHVA 2ONEA 1OD8A 4PMZA 1GJWA 2YDRA 4MJ4A 1AA1B 1ZU8A 1VLIA 4GY1A 4QGCA 2A21A 1RUSA 1JDDA 4MKNA 1S2TA 2B81A 3M0VA 3OJGA 3TMQA 2E8ZA 4AXKA 4QG9A 2W66A 4PTXA 2CZVA 3Q2DA 2WW5A 4NT0A 2VQUA 1NJJA 4HOZA 1S2CA 1ADOA 3DKLA 4KRUA 4PB3A 3A23A 4H7ZA 2QUVA 1RBLA 1GYNA 3N12A 4JIPA 2HNEA 3OO2A 1J0ZA 4HOXA 1CLXA 1W1ZA 1EJXC 3L5LA 4CU6A 3S6OA 3ATZA 3G6LA 1WBJA 4O0QA 1M7XA 2WNWA 1JI2A 3L4XA 2QW5A 3EMCA 1LBMA 1QW9A 4JFTA 5F2MA 2BGNE 3KBJA 3TOYA 1Q66A 4NJKA 1F73A 1VEMA 1NM9A 1TE1A 3M7WA 3PPFA 4UMAA 1W0MA 3QH2A 3WF1A 1Q6DA 4ZE5A 4EX4A 5AN7A 3W71A 1KRMA 1R47A 5D30A 4JICA 1GHSA 1UKTA 1ZCOA 2DJXA 2E1WA 5GNZA 4DI8A 3CV1A 3FAWA 2OKOA 3BAIA 3T4WA 2GGEA 1QNRA 1PX3A 3HQPA 3EMZA 2CFFA 1JJKA 2J24A 4LU0A 2E1DA 2EKCA 1HJVA 2PWGA 3SUTA 2R1KA 3M46A 1EZWA 2G3NA 4PEEA 4IUOA 1EOMA 3LSBA 3GW0A 1QNOA 5IHRA 3K4WA 4XX6A 1CLKA 1F6PA 1RSCA 1ZGDA 2Z1BA 1XCFA 4WGXA 3FJ6A 4ICCX 5CPLA 4MY9A 3NSMA 3ITYA 2O7QA 4LV4A 2WKJA 3M7SA 4IGNA 5BRQA 1ONEA 4I9JA 1LP6A 4QCFA 2OGJA 5KZMA 1W91A 4IL2A 1B54A 1YDNA 3PJWA 1YNQA 4A4AA 4CN1A 2XSXA 3KXQA 3R6IA 3R8GA 3HG4A 3AHTA 2Y2WA 3UD6A 1POKA 3RCMA 4N6FA 4DM1A 4Z2LA 1KXVA 5A6JA 2OLAA 3TTOA 3P61A 2WMJA 3OLEA 1ZNNA 2HE8A 3MQTA 2FGLA 3VUSA 4AZCB 1LZOA 1ISZA 2X16A 5F4XA 1LUCB 1QJWA 3JZUA 4GC3A 3DIPA 2DIEA 2PFHA 3BJSA 1DBTA 1TJRA 3A5FA 3PB2A 4JDYA 4FXRA 4C6CA 5E93A 2Y8UA 3EKZA 3GLCA 4O17A 4FR1A 1O5QA 1QNPA 4U5IA 3UR5A 2ON3A 4M0XA 3QQ0A 1XRVA 5G4EA 1PDZA 4GJIA 3VU2A 4UTWC 2WMIA 4ACZB 2VT0A 1D7FA 3UXDA 1TZZA 3E5PA 3NL6A 4G8TA 1MNSA 4JBRA 2OU4A 3ABZA 3PWIA 3RR4A 3WQGA 5FAGA 1LTDA 2D73A 4J3WA 2OT1A 5D2YA 3WO8A 2ZCGA 2IPFA 5DBUA 1E72M 1FQ0A 4IL0A 1WKYA 3G3DA 4TMCA 4A3UA 2D2OA 3EWUA 1A5LC 3EDDA 2ISVA 4ZZ9A 3NGJA 2VHLA 1UKPA 3LOTA 1ME8A 1SU5A 3RO8A 2NWSA 4JXCA 1T40A 4F9DA 4N9BA 4BJHA 3TC3A 2QPSA 4KWVA 3WSUA 3S9YA 1V0MA 3KTSA 4DPPA 3BANA 1JGMA 2C16A 1ICQA 2OSYA 4LX4A 5G2WA 3LM3A 2NXGA 3FFSA 4LS0A 3QY7A 1JUBA 3CV6A 5D8WA 4WSKA 1XYAA 1EPVA 1GVOA 1NWRA 1YDYA 3BVJA 4NKCA 5C5YA 3C3UA 1SFTA 2C0AA 4R27A 1V6XA 2W6RA 1QRQA 3NYDA 3EDEA 4O54A 4AD2A 3T08A 1ISWA 1BG4A 4PODA 1UB3A 2QF7A 4Z1AA 4O11A 1CXIA 5LGXA 4K37A 1M65A 1DJIA 4N4PA 1WDDA 4HSHA 3BSGA 2MUCA 2WOQA 3ANVA 4FLRA 3LXBA 5MKGA 4EPDC 3CAVA 4XV0A 1VJIA 1AW1A 2EG8A 4HPHA 2XIOA 3C2EA 1TV7A 3PZNA 5CGQA 3WBYA 4J3TA 1JPKA 5DMNA 5CGMA 2Z2UA 4GO8A 2Q6ZA 5D32A 2R1LA 1IXOA 4Z2GA 1V0KA 3W1UA 1PS9A 3MYOA 2FPVA 1AQMA 2PSNA 2C0HA 4CU7A 1H63A 1NU5A 3UR2A 3TQVA 1I1XA 2XN0A 2BDQA 2OSWA 1OC7A 4IFKB 4IGMA 5CQ1A 1XV8A 3IUHA 2BODX 1XIJA 3BAXA 1TIMA 1XIIA 2BVYA 3P74A 4J7RA 4PTVA 1UWQA 2BWGA 4AIUA 3UW6A 3WF2A 3DHDA 4BQ4A 5CG0A 2Z29A 3KHDA 4DJFC 3NAVA 4LYQA 5A6TC 4YYCA 2C19A 1REQB 3E1F1 2ODOA 1Q4WA 3LU2A 3PPGA 2IQTA 4QS6A 4ZOBA 3AFBA 3ZZ1A 4KWOA 2XIBA 3NA8A 2I1OA 1PWMA 2WXDM 5G4WA 1A49A 2QNEA 4C6DA 1X97A 3W1PA 4H9UA 1XFBA 5JVLA 3MO4A 3WH9A 4UQCA 2VM8A 3GIPA 3VGFA 3BGJA 3T81A 3P8IA 2VFHA 4E8CA 1QTWA 5KSWA 1V93A 1XC4A 3U7BA 1DQXA 4Y7EA 1E15A 3AIUA 3KFTA 3TXVA 1NEYA 2WAGA 1S5WA 5A1AA 4ZB2A 3BPWA 3NQMA 1TIWA 1W8GA 4DNMA 3G8RA 2AGTA 3CU2A 5C9XA 1I75A 3TROA 3ABQA 1OINA 1MW2A 2BXYA 1P1MA 3BOLA 5HNUA 2PF8A 2ABAA 2FMOA 3BK0A 2ZDRA 1XIEA 4GXPA 3C8NA 4REQA 1GQKA 1L6GA 4Q22A 3PY2A 1TX0A 4RZ5A 2R1NA 2GUBA 4TX8A 4HA4A 2ISDA