4FHBD

Enhancing dhfr catalysis by binding of an allosteric regulator nanobody (nb179)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
125
Chain Sequence
QLQESGGGLVQAGGSLRLSCEASGRTFSSYAMGWFRQAPERDFVAVISWSGSNTYYADSAKGRFTISRDNAKNTVYLQMNSLKPEDTAIYYCAAPGRPHGSSWSLNKKGQGYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic analysis of allosteric and non-allosteric effects arising from nanobody binding to two epitopes of the dihyrofolate reductase of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/protein binding
molecule keywords Dihydrofolate reductase
total genus 30
structure length 125
sequence length 127
ec nomenclature
pdb deposition date 2012-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fhbD00
2FX9L 3CSBA 1T2XA 4HUMB 4I5BB 1FL6B 2D03H 1C8PA 3EDEA 1N2RA 1XGYL 4OD1L 2WBWB 1CGTA 4GUPB 4HKJB 1J0JA 2WLZA 3EDFA 4K8RH 5J1AA 2ZOKA 5K9KA 1LWRA 1LDPH 3T2OA 4N0YL 5I71B 1ZA3B 2VH5H 3PWPA 1JGUH 4J3VA 1FNHA 4LLQA 4Z7VE 2GFBB 1C5DA 2JCCA 4MB4A 1XR9A 3WXVL 5IB2B 5KVDH 1JZ7A 1J1PH 1WJ3A 5GJTH 1VA9A 1QKZH 2YC1B 3R0NA 1T7VA 3TCLA 1G7IA 1HDMA 4Y1AB 3ARFC 4YEEA 1T80A 1MAJA 1NCCL 5C9JA 5LXGH 4F2MA 2VDKH 2XRAH 3KPTA 1FN4B 4PR5A 2GIYA 5A43C 3O6FD 4G5ZL 5LQBH 5J7CC 3SGJC 4H0HB 5EA0L 4MA3B 5SWSA 2NW3B 1N59B 1S9XA 2PF6A 1ADQL 4PBVC 4XHQA 1BQHG 4I0CC 4MB3A 1DFBL 4BZ1H 1EZVY 1EFXD 4YE4L 2LVCA 5C0EA 5DD6A 3CFKA 4JGUA 4XXDB 4ZFZA 3X13A 3ARTA 5IESH 3C2SA 5D7IF 3LKPA 4TVPE 4A2MA 4IOSD 1BREA 4Y4KC 1VKXB 1H15A 2DQJL 1YEHH 2EIBA 3TBVB 3SO3B 1ZVSB 4ZAKD 5CEYB 4ERSH 1CLOH 2ADFH 1EBPA 3D39D 4NUJB 5D5ME 4C83A 2IC2A 2UV3A 3T09A 4JRXB 4LHUG 3PXHA 2F5BH 2AP2A 2ATKA 3NAAL 1UJTA 3B2VH 2IALA 1IGYA 3H2WA 4KJQC 2G9HA 2ZUWA 3NFPA 4F9LC 3MRDB 4ZS7H 3RDTA 5D6DC 1CT8A 2X09A 4DQOH 1FORL 5HHVL 1RZ7L 4TUJA 4GRLC 4XPTH 4GXVL 1NDMB 2NW3A 1JPFA 1QFWM 3L3IA 1UKQA 4EBQH 4EI5D 1CFTB 1AC6A 4S1QL 3QIBB 4FTVE 3BW9B 4RGMC 1HHJA 1W0YT 1A6AB 3VH8G 3CMOH 1DVFC 1S5IH 4RIRB 4NCC2 3CDGA 3QJFA 5HXMA 3MV9D 1JGVL 1L6XA 2DKMA 4JHZA 4HH9A 2R1XB 5BZDB 4YHNB 2DLGA 1VFAA 3QO1B 3MRQB 4JDZB 3KPMB 1VSCA 2BHZA 1S78C 1NGYB 1RHFA 3CX5J 2VZ1A 3MLVH 5GSRA 5I71C 3EYUL 2NX5D 3G6DH 4GXUN 2DIJA 4LSSH 2C1PB 5ICXA 1NCAL 3GGWA 4RISL 2X4UB 3C60B 5D1XB 5JOPD 3M07A 3OTTA 1TLKA 3DVFA 4HFWA 3CIQA 3OGCB 2WP3O 2V2XA 3DUUA 4OZIB 4Q58C 4WV1B 2GAZB 3ZE2E 1WBXB 2NY2B 2P1YA 4NNXB 3O6FA 4X5XA 1PG7X 4UIMB 1V7NH 4PRPE 3MLZH 4OZIE 1CZ8L 5DUBA 2IANB 3LQAL 2BRRL 4YZFF 4OM0L 1T1YB 5F6IB 1YDPA 3O2DH 3QPXH 5DVKA 1U92B 4JM2C 2IPTH 5HPOA 3SDXE 3LN9A 4RGNC 2HJLA 4U05A 1AJ7L 2NY7L 4PJGF 1L7IH 4Y5VB 1QBBA 5IVXB 4MXWH 4ZUTB 1IC4H 2IFFH 1HYRC 5EZOH 5JUEL 4O2EB 2XQYK 3UJJH 3JV0A 4S1DD 5A3IC 4MLSA 2DQDL 5H8DA 2JJTA 4M9PA 1KC5H 1KB5L 1C5BL 5DHYA 5HHPB 2FO4A 4P5KA 4PD4J 3UTPE 4ZSOB 4K2UH 4X8JA 1TFHA 2YK1H 3VXRB 4P9HH 3AS1A 2V17H 5HI4C 3SDDC 1MHPH 5FYLD 2NY2C 1OAZL 2V2XB 1GPOH 3CK0L 5A40E 3AMLA 5F21B 1RZKH 1D9KD 3BGFC 5I1KH 1U95B 4RNRB 1NCBL 1PDKA 4J2XA 4P0DA 3GJFB 3VWJB 4I48B 2OYPA 4GKOA 4HS6A 4IIQA 5HGBA 4GS7C 4BA8A 2B39A 3INUL 1FNSL 1OQOA 4Y88A 2IPKA 5TDOA 3VXQA 2FR4B 2Q8BH 1ZSDB 4BQCA 3T0EE 3MREB 1L6ZA 5E6YA 3J8F7 5GGUA 3LN5A 4EN3C 5HTSA 3PE9A 3PL6C 5D9SB 1PY4A 5GGVH 2IAMC 2JIXA 4W6YB 4NDMB 2VDLL 1QFPA 2L4OA 4DTGH 4PJ5B 3BPLC 4PUBH 5ESQA 4NN5C 5IBUB 3HC3H 4G8GD 4HWBA 2JTDA 1QO3B 1OGTB 1AGFB 1RUQL 4KAQH 1ORQB 3GIZH 3GSUB 5DJCA 3GJEA 35C8H 5L9DL 3V5KA 4XB7A 4Q2ZB 3HE6A 3D39A 1FPTH 2R15A 5JDSA 2XQBL 3RBSA 3VXOB 4G8FB 1X6NA 3A6CL 5I9QB 5C0FB 3FOMA 1MCJA 4X0KB 5D5MF 4ZPVA 4P99A 3CAFA 1N64L 1BP3B 3VFNA 3UPCA 3E6HB 4N68A 4PY7A 4P23D 1TTFA 2RAMA 2A1WL 1A7QL 5GS0C 5I1HH 2EE9A 3LRHA 3WSQL 5EIIA 1KGCD 3H7BB 5I6XB 4LIQL 4FQQA 5HHQB 2SEBA 2QQNL 2Q86B 1MCHA 4WCYL 3KPOB 1T5WB 3M1BB 4RCAA 3FQRB 1SEQL 5FB8B 2YD8A 2OK0L 2YRPA 5EBGA 3RP1A 3WDHA 1ED3A 5DXWA 4QXGL 3VCLA 1EK3A 4IRSC 1FLRH 1XF3A 1YJDH 2RB8A 3CPLA 3ULSA 4CU7A 2HRPL 2B4CL 1PBYA 4H25B 3UZEA 1JMZA 4CKVX 4BFGA 4M6MH 43CAB 4HFUH 1WUNT 5GRZA 1BOGB 5B39G 2EE3A 5DVOA 3VXSE 1UYWL 1BMGA 5DFVC 3T4AB 5FAAA 8FABA 1ZGLA 4OKVB 5EULV 1IM9B 1G0YR 1QEWB 3K2MC 1X5JA 5IMOB 1DE4B 1NGXB 4ZFFA 3NPSC 3MLWH 1X5YA 3NIFF 4DJMA 1T0NB 3QIBD 1IZJA 5GGRB 1NPUA 3O3AA 3RTQA 4L9LA 1JE6A 4NO0D 2FCBA 1RUMH 3QQ3B 4F8TA 4M7KH 5BXFB 4S10A 4H20H 3ET9F 5AYUL 5DO2C 3OAYH 4WNQB 4YQXL 5L88H 2FH6A 3MLWL 1JTOA 4PY7B 4EN3B 1EEZB 2Y7QB 4P4RB 1IAOA 2C3WA 2VL4A 1T1WB 3HZVA 2Y9RT 1KB9J 1NH6A 5ALBH 3CLFH 3WV0A 4P4KC 3K4DA 3SCMB 3VJ6A 4YHPB 5CJ8A 3ARFB 5F3HB 1PKQA 1T20B 2PO6D 5D1QB 4FABH 2FBJL 2OCFD 3F58L 3T4YA 2J6EL 2CJUH 1LE5B 3C8HA 5I17A 2OK0H 5IFJA 3KLSA 5HGAB 4P2QB 1U2HA 1PQZA 5DTFB 4WDIB 5F7LB 3GSWB 3MRHA 3TPKA 1K6QL 1AO7E 2VISB 1T1ZA 3FQXB 1RIUL 4PJHA 3SHSA 1S9YA 1G7QB 5DSCB 2O93L 1Q0XL 4ZFFB 3OQ3B 2MHAB 3H8NA 2NY0B 3T0XA 2D7PA 4X7TA 4XCYA 4MJID 3JWNC 1N64H 4XBGB 5T5NG 4WI9A 3SDXA 5KTEL 1JV5B 3VFPB 2D7OA 1FGNH 2X42A 4WEBL 4RQQB 5I75C 4ALAH 4I3SH 1G0XA 1RUPL 3EYOB 5JMRA 1EA9C 4BFIB 1P1ZA 3GNML 4R0LC 2OR8A 1P9MA 1BVLB 1ZHNB 2VMFA 3GIZL 1CG9A 4PRBB 1PYWB 2ADGA 1IC7H 3D48R 4PRIE 4WTZG 1HN1A 4V1DA 4JM4H 3FN9A 3FQUA 4F33B 1DBAL 4ZD3H 2D7TL 2Z4QA 3LZFH 2VDLH 2CKBB 3BESR 3E3QE 4OQTA 3VU2A 4QHNA 3U0TB 2VLJB 5E8OB 5ADOH 4P9MH 1QA9A 4BSWB 3P4NB 1DE4A 5GGTA 5HDQL 3VI4F 2FATH 2Q8BL 3D18B 3U30C 4JQVA 4HAGA 3V4VL 1KULA 3GRWL 3HRPA 4GRWE 3DROA 1OLZA 3O4LD 4M7LT 1KIUA 2Y07L 4UOW1 1KJ2A 3U4EA 5IW6B 5LAXB 1GPOL 5BW7C 3I9GH 2AXGA 3PDDA 3L7FA 4JANB 4XXCA 4F7CA 4ACPA 1U8PA 1X5HA 4EXKA 1WWCA 5GQBA 4P9HL 1YMMA 3AREA 4BFIA 4N5UA 4GQ9H 4UU9A 4M5ZL 1ZA6A 4IJ3C 4YIQA 3SY0A 3H9HB 4L8CA 1MWAH 3QHFH 1J11A 2B1HH 3LQZA 2VLLB 4JN2A 1V3MA 5F96H 4MXWL 2NY4C 5DF0A 4KKAD 2G2RA 4X6EB 1JGEA 2YEZB 1DJSA 1F42A 3P4LA 4OFDA 4NKIL 1PQZB 2AV1B 5IBTH 1LP9F 2VABA 5TPWL 4U1LA 4ODXA 1JYXA 4HT1H 4LKCB 3EOAA 4HWEL 3MNWA 5FYJE 3LQAH 4R7DB 4APQD 4U1JB 5DMGC 4E42A 5JDJA 1S7XA 3VFSA 3FN0H 5L2JB 3CU1A 2Y6SD 4PRAA 2FYYB 5F7EH 3WNMA 4U3CA 2XA8L 4IEFB 3MMEA 1N0XL 3ZYJA 3TO2B 4YDVB 3BZDA 4GRWH 4Q9QL 2DQIH 3ZDXF 5CS7A 5EOCL 2BY2A 5JHLL 2Y5EA 4PGDB 1XGPB 3O6LL 3WN5A 3KYKL 5EO0B 4WW1B 4ZS6C 1CQKA 5H94A 4AIOA 2E7CA 3ETBF 5ERWB 3QDGE 3H6JA 4YHOH 3MJ9L 5CD3A 3RBGA 4IRJB 1XGUA 3L3DB 4LASL 3PP3H 2ERJB 2AGJL 3WNPA 4UQ2A 3D3VB 3MRPB 5E7FA 1S5IL 1IEAA 3SKNB 4QGYA 3TO4C 3BEVB 3DV4B 1NC4D 2QSCL 3FRPG 4GXUM 1BIHA 5GS1B 4WW2A 4FFWD 5E6IB 4LPWA 5C08B 1MOEA 4U3HA 4JFYB 5L7XL 3LKPB 2IAMB 5JHDE 4XP9H 4PJEB 5C0JA 1FLTX 3BYYA 1QFWL 1SMAA 3MMEB 2I60L 3I02A 5KSUA 1UXWA 2PXYC 1V5JA 1EEYB 4KJPC 5AYQA 2GSGB 3RVUC 4MAUL 3SQOL 3P4MB 4NQXB 2FBOJ 3P0VL 5C0EB 1T1XA 1RAMA 3B2VL 2Y72A 4HC1H 4NRYB 4OBRA 5I76B 5CKGA 1WCBB 4CVZB 1Q8MA 2AERT 2BXZA 4KVNL 1LMKA 2OR9H 4OLVL 4LNRA 3U82B 4K3DH 3GSNL 4U1NA 4XZUA 3EOAB 2R1YB 3DURA 2QKIA 4Z9KB 2K7QA 1NAMA 5KSBE 4LHUA 4D94A 4EI6A 3WKML 4HS6B 1QLFA 2J88L 1YEKL 5KVFH 1AXSB 3WFHB 3C2AL 1BQUA 4GSDL 5I1EH 1CXKA 5IHUL 3GMPB 4U6HB 3ZLQC 5HDBE 5EA0H 2G9HB 3VFTA 2ZUUA 4MNHB 1S5HB 5LQBL 4FZEL 3HZKB 2VDKL 1S3KH 4XNXH 1YEEH 2YD2A 4H26B 4F57H 5JIPA 3SKUD 3H9SA 1S9KC 4YZFE 1GIGL 2HVKB 4LPCA 3SPVB 1XGTB 3LPWA 2ZCKL 1CGSL 1BZ9B 1F58H 3ZKQD 2ZUVA 1I3RA 4KHXH 4NSKB 1BBJB 4OGAD 4QRPD 2MCG1 3BP4A 1D7FA 3QNXA 3UC0L 4OZFH 3VH8A 3TA3C 4ODWA 4LEOA 1FE8L 3EO0B 4LCIH 2XN9E 3DRQB 1MNUL 1U58A 2QSQA 1JHKH 2BOBB 4LSVL 1ZMYA 4HPOH 3TN0D 2BNRA 2EH7H 5C71A 3FO9A 3V52H 3I75B 4BJLA 3PJSA 3B9VA 1ACYL 3O9WD 5IBLD 5FKPB 1ZTXH 3SO3C 3S9DB 2A6DA 4MNGB 2D03L 4PJIE 1OAQL 2OMNA 4IRSD 5I1JH 3IJHB 4QO1A 4WTXA 2F74B 4HIJA 1HH9B 2CDFA 1P4LA 2YA1A 4ONGH 1IQDA 3D9AH 3BMVA 1S9VB 5DWUH 3ARGB 3BIKB 5MERB 1P6FA 2ADIA 2C4FT 1YUHA 2MKWA 3BE1L 4OIIH 4P3DB 3ARFD 4D9RD 5E5MB 1IM9D 3QUMH 4I3RH 3DXAA 1HNGA 3F8UB 5D5MB 5DK2A 5E8DH 5CIPB 1JFQH 4U1GB 5EPMA 4CJ0A 4UI2A 5F6HJ 1DLHA 1MLCB 4XVJH 5KSBF 1U42A 5LGKA 4M43L 4WIQA 3SPVA 3GGWB 2A9NH 1QSEB 4YC2C 5DR5H 3LQAC 4JO4H 1NMCC 4NUGH 2CO7B 3LKNA 3SE3A 5E95B 2FO1A 1MHCB 4XHJD 1AY1H 1GGYA 3Q5YA 5KVEH 2A6JA 5IR1B 2CIKB 1EFQA 5B38G 4PJCE 3BRFA 1KLGA 4N8VB 3CFIC 1BQHA 3G6JB 3OR7A 1W8NA 4DN4L 4UV4L 2Y06H 5CJBA 4NFDA 1JZ8A 4NN7B 2EYRA 3MGTB 1E4JA 4NT6B 1U8JB 3SE8L 2HKHH 1PKOA 4ZFOB 4ODHL 1H3UA 1GGCL 4HWNA 4JVWA 5EU6B 1IGFL 3W11C 1KACB 2FR4A 1A64A 5D2NC 1DQTA 3TYFA 3FRUB 1CE6A 1PKQB 1OGAE 2CIIA 1PLGH 5CBEA 1YUHB 4J8RB 2UY6A 1LE9A 5EZIL 1RD6A 3BWAA 5I8EB 2BY3A 1CLZL 3ARWA 3TBSB 4FQHB 2GHWB 1KYOK 3GJFA 5DC4B 1CD0A 4J6RH 2HJFB 3DVNB 5E99L 4BFEA 2APFA 4M6OL 1U2CA 3G04A 4RWYL 4NM4H 4PJEF 5EZJA 4WY7H 5JOFB 4JHAH 3IJYB 1LNUB 4UIKH 5JLZA 3LEVL 3OKDA 4M8VA 4OF0A 5FM5M 2Z8WC 1NEZG 5IWLC 2GITB 1U8HA 1XGQA 4BQ8A 1UCTA 3BRDA 4FFYH 4NHCL 5I30L 4H1LB 2ORBH 1EGJA 1WV7T 3ALXA 1YEIH 3GSVA 3FQNA 1CS6A 1NBYB 2R0LH 2FIKB 5A16B 2KQNA 4KHTL 5FIEA 1JPGB 3P77A 5FYLH 4LCCC 4OJFL 3GDBA 3MOAL 5MERA 3SDYL 5EWIL 2YUZA 2VLJD 1MHHA 4I9WE 2Y1VA 4QGTA 5D6CA 5IJKA 5TE4L 3Q3GA 4J23A 4O02L 5CBEB 3EHBC 3QEQD 3UBXA 2EH8H 1O0VA 4OF6A 3LHPH 1KJ2L 3Q5TA 3T0EA 4YDKL 5EBLA 1U8MA 3PWJA 2JLLA 4PJDE 5FO9A 2J8HA 1K3ZA 5FA3A 5ISZB 3WIFA 3WNLA 1TZGL 3QO0B 3OG6B 4MX7B 4HXAL 1FG2B 3Q2CA 4PP2A 1CDJA 2O5YL 4O51A 2AJXH 1WC7A 4XHJC 5SX4I 1JWMB 4R90H 5ICZA 3V7MA 1A7RH 2GUOB 4Q74A 4CN4A 4MZ2A 3HC4L 1MLBA 4Z0XB 3STLB 4Q6YA 3OR6A 3TCXA 2VERN 1PZUB 4Y5XB 5JQHC 1M05B 1PZ5A 1VFBA 2O5ZH 1OAXL 4H8WL 1G7JA 4HGWB 1IBGH 4G8IB 4P5TA 4XBGA 3QUZC 3N06B 3MA7B 2A73B 5D7LD 3RFZC 2PTUA 1E27B 3WJJC 4QTIL 2MFNA 5F89A 3ULUC 2AJZB 4RFOH 3RIAK 4GFTB 4NP4H 5C0GB 1KPUA 4R4FL 3QXVA 4L29A 1FFRA 4RRPG 2VLLA 1NKRA 5HI4D 3SCMA 1M6OA 2O26U 3KJ4C 4Z0BH 1W0WB 3IDJB 1JF1A 4QRRD 4XCNB 3VRJB 2OJZL 3NA9L 5C0RH 2AJ3B 4P2RA 4APQC 2XN9A 1FVCA 2ADJA 3LB6D 3GK8L 2VLKE 2CUIA 2VDNL 1IGJA 2HT2C 5T1LD 5A2LH 2ZSVA 4EDXA 3P30H 4HIXH 4YBLB 5E9DA 3O3EB 3O2DA 5IG7B 2ENSA 5HVFB 4YFEA 1BFTA 5DHVA 4Y4FC 4ZXBA 4O51B 3NIGF 3ULUL 5KG9A 1YY9D 2YSSB 2A6IA 4TVSa 3B5HA 4ZOAA 4M00A 2XFXB 4GJTB 5K93A 4OCXH 4Y16A 3K8LA 1ZT4A 1OT1A 2C26A 4CVUA 2BSED 4WO4A 1QSED 3RWDA 4ZS6D 4TVPH 3TVMB 5T33H 4ZDHB 2X4RA 5BOZG 3HI6H 3D85D 1UB5A 2DLTA 1MHHB 4PRHD 1K5NA 4WY7L 4YDLB 3WN5B 2HP4A 3PWUB 1MFEL 4OFYA 1U3ZA 5FO8B 2BVOB 2N56A 1EHNA 4HWZA 4WGVB 3TZVA 5CD3B 1M6OB 4MJ5A 4FQXB 2OZ4L 1WWBX 2AJ3A 2YD4A 4PJAE 3RU8L 3WS3A 2NR6D 2JKXA 1U8QB 3CVIL 4ELME 3QI9B 4F9LA 1K4DB 3DRTB 3NCYP 4R3SA 4XC1L 2N4IA 1LO5B 4Q0XH 2HKHL 5FUCE 1WFTA 1QFUH 4XCYB 3AM8A 5FGCB 5HY9A 4G9FE 3LCYA 3MCLH 3SBWA 5DJ2A 1RY7B 2V2WB 2FSEB 5C0AD 2HJKA 3NVQA 1F3JB 3IJSB 3P73B 4DW2L 5C0IA 4Z7WA 3OKNA 2OL3A 3SE9L 3DTXA 1MWAA 3L1OL 3B9DA 3GZKA 4KVCH 3L3HB 1NJ9B 4HUXB 1MJJB 1Q9WB 2GFBA 5JIKA 4CNIB 4PJXF 2P44B 3DROB 4OLUL 3OF6A 1U3HA 1DLFL 3NIDE 3IS1X 4XTRC 2PN5A 4HJ0C 1J0KA 3VW3H 1HK6A 1VGEL 5KJRL 4M6NL 1OD9A 4L4JA 4PRHB 4IHOB 5D96C 2WINA 2VC2H 5DJAB 4HPYL 5B8CB 2PETA 3ARXA 1T7ZA 1Q38A 4GMTL 5DD6B 5JW5B 4S1SH 4Y16B 2HT3D 1GAFL 1ZTXL 3MODL 3OKYA 1ACYH 4HV8B 3G5YB 3X14A 5LGJA 4GQPH 4FTVA 3GUTA 3TVMA 4GAYA 3WIIL 1FL3B 3RZCC 5BS0A 1MNUH 1KJVB 4HUWA 3MA9L 2FHCA 1JWUA 4NJ9L 2DAVA 1AGCB 2KZWA 1VKXA 3OPZL 4ENEC 4JM2A 4X6CA 1CDYA 1R3LB 1SJHB 4QRRE 3IRPX 1X5FA 4WU5A 4PJXA 3D85A 2OJEB 4N0RA 4PGCB 4HG4K 1I8IA 5GGRY 1F11A 2DBJA 5DD0L 3B4NA 1U8OA 4P5TD 1BBJA 1N6QL 4KH2A 4LLQB 4NQED 4YDLC 2HFTA 1V05A 3MV7B 5FYKL 4OZHA 3FFDA 4M48H 5C9KA 15C8H 2DJUA 2EO9A 3VXSD 1YEEL 1FN4A 4M5YL 4OI8A 3GM0A 3RVUD 4I2XE 1GGIL 5HVWA 4P46A 4LCUB 2DYPB 3TLRA 4TPRH 4CDHA 4R2GC 1EJ6A 1BFOA 4WFHE 3SDAB 3W5NA 2GJZA 5BO1H 1NUDA 5CEZL 1CIDA 2F53E 4FQJL 2R0WL 4J4PA 1JNLH 4PR5B 5LCVH 4A6YB 3BDBA 2AEIT 1I3GL 4EI5C 3H9SE 5BZWA 4OB5L 4WI2A 3ZO0A 1AXSA 4WHYG 4KKLC 4TRPH 3F62A 4UDUB 2D0HA 3MUHL 3KPRD 3L95A 3MXWH 1CICA 2OR9L 3BEWA 2RCSL 1VADB 1Y0LA 3ARBA 4NN6C 5CBAB 5DVLA 2LQRA 4P2RE 3QG6B 1FAIH 2DQUL 1G9NC 4JDZA 4UB0L 3PL6A 2FECI 5F8RC 3DV6A 2OTUA 4S2SA 5DJ6B 3MV8E 2W0PA 3P0VH 5JMOC 3PGFH 5FUOL 4NBZB 4DUVA 3MBEB 3WO4B 4UBDC 5D2LA 1OSZB 4GRMB 3LKRB 5DD3H 4I8DA 3K1DA 2X89A 3VXRA 4ZUWB 2F5AL 4YO0A 4NJAH 3GMRB 4KWUA 3HE6C 4G8GE 2Z8SA 3L5XH 2JELH 2XG5A 5DMIH 2A6DB 5BV7C 4YFLI 5CWSA 3AREC 3WFDL 4DKAA 2IBZY 3I3DA 2I9LB 1FYTE 1TZHA 2PXYB 3GBLA 3TN0C 3C6SB 4IOIB 1RJLA 1HHHB 3B6SA 1TPXB 4ZOEA 1BD2E 3QFJB 4N90D 3KXFB 4TUOB 5KSUB 3TNMB 4FTVD 1TNNA 3GIVB 5DQJB 5JZ7C 1UWEL 4WHDA 4WV1A 5L2KD 5D7JD 3SJVA 3U7WH 2CSPA 1YECL 3DX8B 5C70A 4OZGB 4JPVL 3JVGC 3X3FH 4I0PD 5FHBH 3A6BH 5DMKB 5CKAA 1BWMA 4LOUC 5DUPL 3DUUB 3NFNA 2MQ3A 2OI9C 4PJIF 3LKRA 4GRMA 2NTFA 1DSFH 1V3KA 2ICWA 4LEOB 3TIDA 1PX3A 3NCJL 5B38A 4ZO7A 3V0WH 3GJFK 3OKEB 4ZPVB 3D25A 2IANA 2GW5A 5SWSE 4IOFC 4DGIL 5IROC 5IVOA 3MRBA 1A5FH 1YNLH 1YPZB 1KENL 1LO3H 4PJBF 4J4PD 1RK0A 2AI0L 5ISZD 3ULUE 4ZFOA 1NCWH 4O58L 3WFBH 4X6FA 4HUUB 3C6LA 3FMGH 1QSVA 3MTRA 3C60C 5IFAL 4OD3L 2WLYA 5J56B 2CIIB 2UWEF 3CCHA 2DICA 5B22A 5A2FA 3RIFK 1KIRA 4FQPA 3RWJB 2VUOA 2DKSA 1GGBL 3GRWA 3IF1A 3T3PF 1LEKB 3QHFL 2DN7A 4RMRA 3LPFA 3N0PB 3QO0A 4MX7A 4ZAKC 1Q9LB 2FGWH 4KZDH 4M5ZH 1D5BB 1WISA 4BQ9A 1JZ2A 4GW5B 1IQDB 1TJGH 3IT8D 3AU1A 5BOPA 3F7YB 3STLA 4KGLA 4J3OC 3IRZA 5F1NB 5ACZB 4XPAL 2BVQB 4MNQD 4KJQD 5E6ID 1MCOL 3VFRB 4UT7L 5C7XH 4DK6A 3OKEA 4NRZB 5EZLA 1I9IH 2YPLE 2CRYA 2VIRA 1UJ3C 2HAZA 1HZHH 3GFUA 1E4KA 2DMBA 4OGXL 4Q9RL 1JBJA 1F4WL 4QY8B 1S9VA 2FATL 4K3JH 3D3VD 3BKJH 1FFPB 4ZUSB 5EU4A 4IOFD 3S35L 3PGDA 1CD1A 3K3QA 4U4BA 2VXUH 3TNMA 4AIZB 3UYRH 3UYOD 4MD4A 4U3XA 4DGVL 5I75B 5C08D 1UZ8A 3U36B 1OTTC 1J87A 4QRSA 3S36L 1I8MB 1TQCB 4NZDA 5H2BB 2AQ2A 3KYOA 1KT2A 4MAYB 4LGRB 3D69B 1T03H 2WIIB 4M9OA 5ID1B 4YHZL 1W72L 4FQQB 1BAFL 3QQ9D 1C1EH 1FC1A 3ARBD 1FIEA 1WBZA 1UM4H 1SJXA 3MRHB 4I3SL 3GBNL 1BWWA 2BY1A 2B1AL 4P3CH 4F9PC 2ZKHH 4OT1L 2R56L 4B50A 5DEGB 4U1KA 1MIEH 3T3MF 2FIKA 1JV5A 5JO5A 5JHDD 3H7BA 1MI5D 3TH2T 1CGYA 5FKAB 1CVRA 5EC1A 5IB4B 1K6QH 5T1DL 1E27A 1DN0B 5KAQF 4IIQC 4Q7DA 1CE1H 1P1ZB 2AK4E 3AY4C 1W72H 3VFWB 3AAZA 3L7EB 5J9PB 1MCEA 1UFUA 5I8KH 3GBNH 3QDJE 2X4PA 1ODAA 3HG1A 4UDTB 4Q6IA 1P5UA 2QJDA 2CH8A 4YHZH 3Q6FB 3KPRB 4HJGB 1KOAA 2DQFB 3BUYB 1RMFH 3T0AA 4FABL 4Z7QF 4PBXA 1NMAL 5IBLC 1EEUA 3DYPA 3N85H 5T3XE 3UYRL 4J1UB 4L4VA 1PGRB 1QG3A 4PJDA 1HHGA 4WWID 5IHZA 5HGAA 2WWMC 2YRZA 2H6PA 2R23B 3LH2L 5D7JB 4L9LB 4CN1A 1X7QA 1UXSB 5C7XL 1EAJA 5KSBA 1GXEA 4K3JL 4TUKL 1MFCH 4ZFGH 4CADA 1BVKB 1SBBA 1ZS8B 1J1OL 4KK5C 4N8CH 4YPGA 2I26N 4K94C 4UT7H 1UC6A 5KANI 2ZNWA 4KZDL 5C09B 5EC2A 2X44D 4M6ML 1MI5E 4OCYL 1NLBL 3O2VH 3ULVL 1G6RB 2NNAB 3RUGB 4JO3L 3H9ZA 3QYCA 4WUUB 5A2KH 2LTQC 3WUWA 4PGZA 2GT9B 3VDCA 4JFOA 5IB1A 1FFNB 3REWB 3WHE1 5HYQA 1T5XA 5GRXG 2EC8A 3T3ME 1KBGL 4U1IA 4WCYH 5IF0A 1F90H 1HKLL 4QNPE 1YEDB 1D6EA 5K33A 2PCPB 1Y18B 1CG9B 1HSBA 1TTUA 3WSQH 5GHWH 2B5IB 5HI5C 4V1DB 1OW0A 1WIOA 3V0VB 4OV5A 3WFBL 2NR6C 2OZ4A 1FG9C 1A7PH 1N0LA 1BM3L 4WUKL 1A02N 5IFHL 3V0WL 5AG8A 5IEKB 2ZZUT 5SX5K 4DGIH 1JTPA 1Q9KA 4Y19B 4FMFA 2YXFA 5IB5B 1RUQH 4KAQL 1KIPB 3F7RA 4JFPB 4PGDA 2DL9A 3EUUA 3QXWA 4FXGB 4P4KA 2ZPKH 3BPOB 3Q6FA 4JFEA 4PUBL 4XPFL 3TYGL 5HYJE 5IWLA 3B3IA 1JTTA 4B53A 3MGOA 4JFDA 3WMSA 4JANA 4F7CB 4JPVH 5GGSY 4LVHB 2P5WB 3MRRA 1YECH 3SGKC 2FX7H 3JV4A 1K4DA 1IAII 2PW2A 2IADB 4U1LB 5D8JH 5DD1L 1FNSH 3HCVB 5D2NE 3FT3A 4JAMB 3JV6A 5ADPL 1ZLUK 3B83A 3TFKC 5BCAA 2XACC 1AHWA 3OMZA 4NKOA 1S7SA 4HWZB 3EHBD 4WWKC 4AH2B 4LHQB 3BH8B 1IGML 3IS0X 1T6VN 2QHRL 3RY6C 1U8PB 1MH5B 1FL6A 2NX5B 2F5AH 4G3YL 2VQ1A 1T2QL 2CUHA 4PJ7B 3HZYB 4HGMA 3KS0J 2ZG3A 4K2UL 4FP8L 1RZIA 3L5XL 2LE9A 2NTSP 1MCIA 2VWEE 3WL9B 4LLYB 2A6KA 4JFFD 1KC5L 1TQBB 4RMQA 2NW2A 2DJ4A 2OBGA 4PJBB 1KN2L 1D5ZB 4PV8B 1WZ1L 3U30B 3I6KB 5J3HD 4WFFE 1FAIL 2DQUH 1AQDA 1LK3H 4C4KT 4X7EC 3NOIA 5ENWA 2XICA 2NXYD 1G7LB 4YFDB 1QRKA 5CFHA 2WNGA 4TSBH 2AABL 3OX8B 2APWA 3V9FA 4JFQB 4TRPL 5D1XC 5I0DA 4B7IA 4HSQA 4OM0H 2WINB 3T0VA 5CZVL 4ZOBA 4JZJC 3WO3B 2J8UA 1FNGA 1I3GH 2WBJD 1KXTB 5KSAD 1F4YH 3MLXL 4XMLL 4HV8A 5IMMA 1QHOA 1QR4A 2W9EH 4MVBC 3DETD 4RMTA 1TPXC 5LCVL 1JNLL 5BW7A 2AS5M 1F6FB 1AGCA 5F44A 2A9ML 1AGBA 1DN2A 3QQNA 4G80B 3KPPB 5DD0H 1C5DB 3K7UA 3VWKB 2ZSWB 3VXMB 4NGHH 1ZT1A 4NO0B 4MDIB 2JJVA 5EBMB 3TCLB 3MRKB 3SO5A 1WCBA 3RWIA 4ODBD 4DKFH 3BQUC 1CFNA 4EXPX 4YHML 4HS3A 1I4FB 3P9MB 3DBXB 3L3IB 4NZRH 3VGBA 3DECA 4Z77B 4YC2B 4JAMA 3H3PL 1JNNL 4LLAA 2Z9TA 2VO5A 3E8UH 4LHUB 3SDCC 1UACH 3ALPA 4EBQL 3BAEH 1MCPH 5CJ5A 4WWKD 2H3NA 3QIWA 3IDXH 4NKDB 4XPTL 4B7LA 3MODH 3HE6D 5HHVH 4GKNA 4S1SL 3BT2H 4Y4HD 1T21A 2FEEI 5DFTA 3L95B 3NGBC 1GVIA 2N1KA 3IDUA 1DLFH 1EEYA 4BUGA 4P46B 4ZXBD 4EUPA 4K7FA 1T1XB 4OQ1A 5HGGS 1S7VA 3QUKB 5GGQH 1DLHB 4HCRA 4KDWA 3NAAH 2DM7A 5DZLA 2CK2A 5D7IA 2QQKH 2IALB 4WO4D 1HE7A 2BVEA 2XWBB 2RR3A 4MGXA 4JLRA 3U46B 3GSQB 3CH8A 4ERSL 5BV7L 1DQML 1CL7L 1YY8B 3EO0A 3G5XB 2NTFB 1WK0A 1H0DA 3ZMRA 3CZFB 3RZCB 1OF2A 3IXAA 3HN3A 5IESL 3SE9H 3FAXA 3SOBL 3BD3A 3TO4A 4XP4L 1OTTD 4NNXA 4QHUB 5BRZB 4Q0XL 4MAYD 5LG1A 3F7VB 3HS0A 1DP0A 2JCCF 5DVMA 3QIWB 5D1ZC 3S5LB 1NBZA 2X41A 5D1QC 1NAML 4AQOA 3ZSSA 3EOYG 2OZ4H 1A3QA 4FXLA 5KSAB 4WRLA 4EUPB 3RDTC 4Y4HC 4DK3A 4L8DA 2RGSA 3WXVH 1Z3GH 2NLJB 3NN8A 3DJ9A 3I84A 2X4NA 2P5ED 5GRUL 3LKNB 4KMTH 1FDLH 1JI2A 3QWQB 3DGGB 4TVPL 4HIEA 4C56E 3QEQB 5EUKB 5IJVA 3B9KD 2FEDC 2OL3L 3P40A 4F80A 1JYNA 2IQAA 1CXEA 5DK2B 1KLGB 5F93C 5HGBB 4GOSA 3VFUA 2E6QA 4OGZA 1DN0A 3NIDF 3C8DA 4X5LA 3LV3B 4P5TC 5ID0A 5HHMD 4LFHG 4KKCC 1U3HD 3QPQC 4LVEA 3KJ6L 1A22B 1IM3B 4E0RB 1LEGA 3V4PH 2C3XA 4G8EA 1LP9E 3V5HB 1JMXA 3UZQA 5TDPB 4HQQL 4K94H 4YHPA 25C8L 3ULVF 1G9ML 3ZKMD 2OJZH 4PJFE 1OVZA 3RI5K 2VITB 2UZIL 2AV7B 4KROD 1EO5A 1MRDH 4RGNE 5IT2L 4U7MA 4ORZC 3QNZA 1FZKA 4RFEB 1R3KA 5FA3B 3C5JA 3LMJL 5L2KE 2G75B 3NA9H 5C0RL 3JWDH 3RDTD 4RFOL 4Y8AA 1DBJL 5DURB 1RI8A 2GJJA 5KVMC 2Z92B 5EO9B 4I18A 4YAQA 1AO7A 4NHUA 3ZT5A 4X9FA 3MV7D 4CADB 2X7LB 3HG1E 1A9BB 4UUJA 4Z8FH 2VKWA 5C86A 5EZLB 3HC4H 2FWOA 1WIPA 5HD8D 2L7JA 5TF1H 3W0WB 2IH1B 4IJ3B 2VZUA 5GISL 1AQKH 5C0ND 5EU4B 4P46D 2VZSA 3HE7D 1I1CA 1QBAA 3GM8A 2B20A 5JNYA 5A2IH 3QDMD 4NQCA 3VXPB 3CSGA 3O4LA 2VAJA 2O5YH 1UM5H 4U6YB 2Y25A 3MBED 3H7LA 4HXAH 4JZOA 4NRZA 1RURH 5CILH 5GXBB 3P0YH 4HJGA 4KI5C 1NCDH 1RU9L 5EZJB 1C12B 1RK1A 2FIRT 1EMTH 5HHMB 5DMJB 1GZPB 5C0BA 1MVUA 4HJJH 4F7TA 1DEEB 2YHGA 3C5JB 4K3GA 4GRLD 1HHGB 4NN7C 4MB5A 2EH8L 2DQTL 3MOAH 4RAHA 2VYRE 3V6OE 4NQDA 4X7SH 4KK8D 4K8RD 1YMHB 4DOHB 5C0FA 5F3HA 3RNKA 1JK8A 3OKOB 4KY1L 3RPKA 3S35X 1UXSA 3B9KA 4KFZC 4ZUUB 3FO1A 4CUCA 3QCVL 4FFYL 5I30H 4PRDB 3MZGB 1SYVB 3BN3B 5C8JA 1MVFA 1WEJH 4KHTH 3STZA 1HOCA 3O9WC 5F89B 4N0CC 5D6CB 4KTYA 4LLDA 4JHAL 3IAGC 1E28B 4RWYH 2MMXA 5D7LE 4FXGA 3OWEA 4ZQKA 1F3RB 4JFZL 3S3PA 2Z8RA 2VL5A 5EFIB 1D9KA 1FDLL 1TTGA 5CCKH 1BLNA 2O61B 3VXSA 5DDHB 4UDTA 3RWGA 4ZFOL 2H41A 4QOKE 3BRGC 4M6OH 2Q1EA 1YNKH 4CDGC 3WS3B 2BMKA 5DJ0B 4HIIB 5IKCA 3CFJB 1A14L 5I1GH 3GEWB 3UO1H 2R2HB 4PJGE 3WIFB 4KROB 1ZGLB 5IM7B 5EIVA 3CUPB 2YPVL 1FIGH 2NXZC 3CFKB 2Y06L 1ZLWK 4FFVD 3V6OA 3ARRA 5GGRA 1Q9OA 4QXTB 4U0QB 4PG9A 2A6IB 5JORB 4GBXB 5ILTH 5D96B 4WWKB 4XP4H 1I3UA 4YX2H 3MNZA 5ANMB 1DEDA 1YJDC 3IXTB 4UV4H 4DN4H 1WICA 2QQLH 3VRIA 1FO0A 5KSVA 3TPUA 4ZDHA 4GAFB 4LLYA 3OL2A 3O45B 2YKLH 1M7DB 3FQUB 5ESAB 3QISA 3TH4T 3HR6A 4MA8H 4S0SD 1NJ9A 5BV7H 3HE7A 5F7NC 5L8JB 1CTNA 5E8PA 3F7QA 5HI3D 3FT2B 1RZKC 1G7PB 2QQKL 2A9NL 3QUML 2VLJA 4I3RL 5AAMA 4L1HA 3TJEH 2ZOKB 5GGQL 3KPNB 4P2QA 2XQYG 5DHVB 5E8DL 1F8TL 4Z7UA 5DI8A 4M8QB 1KCSH 4P48A 1E4KC 3M45A 4PJHB 2WUCL 4U0RC 5AZ2L 4BZYA 3WCYA 4N9OB 5B3JE 4XPGL 4RA0C 3MJ9A 4XAKD 3ZYIA 3IDXL 3NPSB 4N9GA 3PHSA 1G9NH 1FVEB 3EJJX 5IHLB 1LD9A 5F1OB 1EH9A 2APVA 4LGPB 1RUAL 1VEPA 1IC5H 2Q76B 1E6OL 3QDGA 2L7UA 1T2JA 4HKZB 4XX1E 5DURD 1JNNH 1CCZA 4NZRL 4NNYA 3SGDH 5F8QC 4BH7B 3V52L 3WDJA 1MWAB 5GPRA 3KPMA 1MJUL 1JHKL 2XOTA 4NO0A 1XR8A 1KIPA 3FB8A 4JFPA 4AENA 1RJYA 4M6AA 4M3KB 5DD5H 1P2CB 2GQHA 2HMIC 4P4KB 4JFHD 3VI4E 2XIDA 1U91A 1TNMA 2E27H 1MUJB 3EZJB 3OKMA 5DJ2B 2WAHA 3SCMC 3VWKC 5F9AC 3OBAA 4X6CE 4OZHB 2BFVH 3G6AA 4P2CG 4XNXL 4XTRD 1CGSH 1V7ML 5DJZA 1I4FA 3P9MA 4QHNB 5DRZA 3U0TA 1KCLA 3PP3K 5SX5H 1PVHA 4JFDE 5I1LB 1HSBB 2WWKT 3L3JB 3RX5A 4PJIA 4P59H 5IB5A 1UM6H 2UWEA 4ORGA 1S3KL 4L4TE 1CF8L 3DRTA 1FBIH 3QULB 1A9EB 4LBEA 1MRCH 2V6HA 2XPGA 4J3TA 1F4YL 1W2KT 5JW5A 1PG7H 2C3VA 5IHUH 4LCYB 5EU7E 5ERWA 3F5WA 4BYHA 5D1XD 4OLVH 5IMMB 3HB3C 1YEKH 5KVFL 1FO0B 1A4JB 1RULH 4GLRI 2EYTB 3CXDL 3FFCE 1WWWX 1M7DA 4OF8A 5K9JH 4LCWD 1XGPA 1HKFA 1FNEA 1IEBB 3NA4A 4WU7A 1GZQB 2R4SL 5JW3L 2MSPA 4XWGH 2KQMA 1TETL 1XIWD 4EEEA 2RFXA 3D85B 1B0GB 5K9QG 1XGTA 4A6YH 5H94B 1YYLL 2HLFD 4IBLT 4NIKB 1BZ9A 1D5ZA 3WEXB 3WLBA 3W9DB 1TJHL 4Z7OE 5HI3C 1N6UA 4JQVC 4MQSB 5EB9A 1MUJA 4MJIE 4GAYB 3ZTNL 4WW1A 4TSCL 4I9WD 1QFWH 3FQTB 4XP9L 2P48B 4YUEL 1A6WL 3B9AA 2XNAB 4MHHI 2I24N 5IW1B 3SGJA 1ZK9A 2A6KB 1ZANL 1J5OH 1IQWL 5J11B 5MENE 3ALWA 2R8SH 1JWSA 2OI9B 5D70H 4NRYA 5IV2B 3SKJH 3CC5B 3NMEA 4KKLD 4YXKL 3VXUB 5B8CA 4QTHB 1MI5A 2R2EB 5EO1B 1FGVL 4ONFL 3X3GL 1BQLL 1M71A 4LASH 4RA3A 4WENB 1C08A 1CLYH 4O5LH 4H88L 4MD0A 2V5RA 4UTAH 1MJ8H 4L5FH 5FDYA 4AM0A 3DVGB 5GSVA 4G80A 3PL6B 1CFQA 4GG6E 2GJ6D 3Q0HA 1RZGB 4MCYA 3MPCA 1NGYA 4EVNA 1ORQA 3UTSD 3U6RB 2DQIL 4Q9QH 4L9DA 4X99A 3MRKA 2X4OA 1IAIL 4RRPA 2VLME 2IBGA 4CRPA 4CVZA 4WHCA 4YK4C 5FM8A 3THML 5F9WB 3QRFM 4OLEA 3C5ZD 3BGFB 5SWZE 3W2DL 1PEZA 4NQDE 3T8XB 1IL1A 2NZIA 4Y89A 2P8PA 1BFOB 2PKDA 4POZC 4HWEH 3MUGB 1Q94B 1KCVH 2I5YL 5T3ZL 4HKXB 2DI9A 1VDGA 1OTSD 3QHTC 1TCMA 4U1SB 5EU5A 2IAMA 2HG5B 4NKIH 4ZO9A 2X10A 3RA7H 4NWUH 4OUOA 5C0AB 1TJIH 3I75A 4L3CB 4TQEL 1XF3B 4Z6AT 3E6FB 4BKLB 5AD0B 1KBGH 2D2OA 3QUKA 2JCCE 1H3VA 4WHYH 3RY4A 3VH8B 1G1CA 4GQ9L 4M1CD 1P4LB 2BSRA 3GI8L 5B4MD 1JHTB 5GRWA 3VI3E 4PGBB 4ZUVB 1EBAA 4JO3H 1T21B 5J11C 4QRPE 4H1LA 5F1NA 5ACZA 1QOKA 3BP7B 4HUKB 1A7OH 1J1XL 2BOBA 5D7SL 3MV11 4L8BB 3QUMB 3FTGB 2OXHA 3KWWA 3BP5A 3ESUF 1FZJA 3TH3T 1IAIM 3VFTB 5F7WC 2VXQH 2ZWLT 3A67H 4JN1H 5TDPA 5IMKA 6FABL 5HDQH 3LZFL 4PRIA 2D7TH 3WFZA 4APQB 1IMHC 3WHXB 1P4BH 2V5YA 1CVSC 4DZBB 1NDGB 1ONQB 4K8RC 3U1SL 1KYOJ 2ZUSA 4JFED 4ENED 4YDIL 1U95A 3MGTA 1CQYA 4NO2A 4ZD3L 2AW2A 5E1AA 4P5KB 4JZJA 3BDYL 1U93B 3I3BA 1K8IB 4OF5A 1OOAA 3KYNA 2Z31A 3QDMB 4WEBH 4OZ4A 3QG7L 4HIEB 4LLWA 4M1CC 5KS9E 5KTEH 3U9PH 2X1QA 4O4YH 5CJQL 5CSGA 4CGTA 4P2RD 2OSLB 4ALAL 3IJHA 3QUMA 3GMOA 1WQVT 3EDJA 4ONOA 3O11B 2WK2A 4OT1H 3G9AB 4F15C 4BQBA 2E5EA 3CFDB 3AXLA 2CMRH 2I27N 3LVEA 4FG6D 1WAAE 1F2QA 2VDPL 4IDLA 3T2NH 2E3VA 3GBML 3FQRA 3F58H 4I3GA 4W68A 1T7YA 3QUXD 3LDBB 1BZ7A 1MCSA 5AWNL 4QKXB 4QRSB 2CJUL 2F54A 5DMGD 1T3FA 4PFEA 3EYSL 5E8OA 5I8CB 4H25A 4G7YL 4LCWB 1U8HB 4UMGA 5L2KA 4NQEE 4JZNB 1LEGB 3LRSB 3SKOA 2VNCA 3RVWD 4G8FA 3CLFL 1HH6A 2BDNL 3NBNA 1SBSH 3D1MC 1XF2A 3BKJL 1OAUH 3I6LD 1L7TH 1V3JA 4HWBH 2HH0L 3DX7B 3LV3A 3KLDA 4GW1B 4YQXH 3J7HA 4NT6A 1I9IL 4PJGA 5K9OB 1SBSL 4OZFG 4NN5B 1MCOH 5CMAA 1JYVA 1WC7B 3PV6B 1ES0B 5IGXL 4ZPTB 3GMNA 3BSZH 3MO1A 4ZQKB 1T1WA 1NEZB 3DMMC 5HDOA 3F6IA 4J3WA 1S7WB 3ARUA 5MI0B 1H5BC 2W38A 3UTSB 3WN5C 4HFUL 3S96B 3WS6A 4FQHA 4JR9H 1LP9A 3OXSA 2QHLA 2ZOLB 5BXFA 2CKBL 5J4MA 1KB5B 2QADB 4LHUD 1CFVL 3T2NL 1YJDL 1JPTL 5C0BB 1UB6A 3C8KA 5DRNB 4QXGH 1T83C 4I0PC 2HFEA 3DXAD 2BNRD 5TQ0H 1ORSA 3TV3L 4IMKC 5FYLE 1QRNE 2IH3B 4D0CB 4NQCB 3RNKB 2P7TB 5E56A 3MYJB 2VQUA 2EKSA 1ZLVK 2AI0H 1KEGL 5D4QA 5I1HL 1HWHB 5FK9B 3M8OL 4IRZH 5I73C 3DGCR 4PJCF 1F3JA 4IS6A 4OFPA 4Z7QE 3UXFA 3RL1B 2BVPA 4P4RA 3VXTA 2WUBL 5E2WH 1QA9B 3KHQA 1R3IH 5FKAA 3HI5L 4P2OA 2XG4A 3FOLB 4NQDB 4R7NB 4JDTL 4U6YA 1NGZB 4X4ME 1OY3B 3G9VA 5L9DH 3GSRB 3UBXB 3UTQA 1AD0B 4OCMC 3OAZH 3C60D 2P4AB 4EDXB 1NUGA 2AXGB 4PJ9B 1YC7A 3PABA 1RQ5A 3HC3L 2AVGA 2VLRB 2UWEB 2J2ZA 6FABH 4D9QE 2VXQL 3RNQB 3IDMA 3D39E 3Q48A 5JIIA 1S8DA 5IM7A 1KTLB 3TJHD 1IRAY 4JG1H 2H6PB 2R23A 1AR1D 3KLAB 1M7XA 4AH2A 2X2YA 1YPZF 5HYSB 4F33A 1MHPL 2EKJA 5D7SH 4RQQA 4JFXB 2ZJSL 5E6IC 4GG8A 1NCBH 3QNYA 1Z6JT 2X9XA 5I1KL 5EC2B 1RZKL 3L5JA 4R0LA 3L3OA 3NCEB 2R2HA 1C5BH 4NQTA 4BH7A 2W9LA 5EFIA 3KVQA 5CSZA 2DQDH 1ZHLA 4LAJH 3QEHA 2AXJA 3FB8B 3GI8H 4PJBA 4AENB 1DDHA 4LNVA 5F1SA 2X4QB 2FYYA 1U91B 3DSNA 2GEEA 3MCKB 3UJJL 4NO3B 2XA3A 4XBEH 4GKSA 4Z7WB 4TQEH 2G2RB 2YZ1A 4X6EA 3MNVA 3U0PA 1J10A 1R3HA 3JTSB 4OCSH 2WANA 3RA7L 3OJVC 3JV4B 3SDAA 4Z7UB 3TNNA 3QAZC 3AREB 5LWYL 3O9WB 1N3NA 3BGMA 2H26B 5KN5A 2FD6H 5IV2A 3T77B 2DLEA 4QWWD 1LO5A 2DLHA 2HJKB 2NYYC 4UT6H 4PP1C 3FT2A 1H3XA 3DXAE 4JN2B 4Y19A 2A2QT 1CGVA 4FQJH 1NCNA 3KPNA 1AR1C 4JFXA 4GG8B 5ESAA 4TPRL 2FZ3B 5HPMA 2Q3AA 4O9HL 3G6DL 4DGYH 1IAIH 3T3PE 4M5YH 3IAPA 4L4TB 3FO0L 3PDGA 4M48L 4NPYB 1G7PA 4C54A 1YC8A 4JPKH 4PJEA 5C0JB 2DQEH 1JGVH 4KXZH 1JN6A 3AB0B 4YGVB 4UTAL 2EDFA 5IK3B 4X6CB 1MFNA 4H88H 1H3WM 4NWTH 3L3DA 2CR6A 4TOYL 3FQWB 3GSNB 4I77L 1GYAA 3X3GH 4IHOA 3ZE0F 2WBJC 3JZ7A 4XXDA 3O81A 4ZFZB 4YXKH 2IQ9H 2VZTA 4G6JL 2I9LA 5D7LA 1RZ7H 1GAFH 3FB5A 4PJ7A 3QXAA 4RSVA 2VAAB 1J5OL 1A6UL 1ZANH 4GKNB 1R3LA 3PGCB 2ZUYA 1B4JH 4ODUA 4HPYH 3BH8A 3U79A 4KI1A 3OSKA 3OKNB 4G7VH 2IAND 4NQDD 4R8WH 3UDWA 3W0WD 3SJVE 5F3BB 4TSCH 2VXVH 4P23A 1QLFB 5CEXB 5HYFA 1JZ5A 2BVUA 4ZS7L 1NGWB 3QEGL 1AIFA 1IFHH 2A38A 2ADFL 5B39A 5HYSG 3L5WA 1X5AA 2YZ8A 1D5XA 3WDIA 1DUYB 4QT5B 1TETH 4Y4KD 4P2OD 4XWGL 2NY5L 4KTEL 3SE4A 2R4SH 3K1KC 4WTZA 3RY5A 5K9JL 1QQDB 1YQ2A 3CLEL 2YWZA 4P4KD 2KH2B 4ONHB 2VN4A 1CLOL 4X4XA 4JB9H 3SGKA 3QZWG 3KNBA 2GKIA 4YHYC 4X9HA 3ROLB 3SDCD 3T0WA 2IEPA 5DS8A 3REVA 1YN7A 3MZTA 2AQ3A 1DFBH 3QCUL 4P57B 4TUJB 1ADQH 3RGVC 4F7PB 2ILLA 1QPPA 1HQ4A 2EZ0D 1JPFB 3PQYE 2IMMA 1TCRB 4YE4H 1M71B 4P59L 1KLFA 3QIBA 4BZ1L 1F3DJ 3HNVL 4ZOCA 1MCCA 3BI9X 5JR1L 4GH7B 2P5EE 2CLRB 4F7EB 2YBRA 3RWHB 1UQSB 1AGBB 4HZLA 5EBMA 3IFOA 5F9JB 1CDBA 1QKZL 3HMXH 4XNZB 5FYKU 1HHKB 5KVDL 1K9TA 1LDPL 4MCZA 3G5ZB 2A77L 4C4KO 1MJUH 2MCPL 2FJGA 1QTYT 1RIVL 3CSYA 4OD1H 1JGUL 4D8PA 3CZFA 3RZCA 2YUXA 1OP5K 5DZOA 3GHEH 2HT4C 5D2NA 4PJ7F 3EFDH 5EOTA 5D7LB 3FFCD 4O2EA 4ZG1A 1NANH 5GRVL 4G6AD 5D1ZD 2ZP0T 1I3RB 2FX9H 1U9KA 4OLYL 5DGQA 3ULUH 2YD7A 5D1QD 5DUBB 4OSUH 3VA6A 3UP1A 1KCSL 4GBXD 1AFVH 3O0RH 1MIMH 2C4XA 2MPAL 5C0CE 3WE6A 4WVRA 2CDEB 3LPGA 2VITA 4RWHA 5D7IB 5FDWA 2X1XR 3DV6B 1RZGA 4AEIL 3T8XA 3EO1A 4FZ8L 5HGDB 4JPIA 1QBLL 3U6RA 1RZ8B 3QDHA 4D3CL 3QDGD 4Y5XC 4D2NA 4MA8L 3HRZB 5JOPE 2YD1A 1CDUA 3JUYA 4NM8H 1KJ3L 2YMXL 4J8RA 4PJDF 3OB8A 1GOGA 2X9WA 4LLWB 3MXVL 3CSPA 2I07A 2BNQE 2H1PL 3ROLA 5CJOH 1BD2D 5D9SA 4OZGF 4QTIH 3IU3A 4PYGA 3ARZA 2VLRE 1ITCA 5J13B 4UT9H 1EVUA 4N8VA 5E2UL 5CUSL 3KWWB 2EDJA 2O5ZL 4H8WH 3TVMD 3KJ4B 4QXWA 4X6DF 5FOBA 3PV6A 3TIEB 3AU1B 1JRHL 1NEZA 5J9PA 3CCHB 2DMKA 3VI3F 1NLDL 3H42H 4R90L 3U7YH 3MV9B 1VPOH 3BH9B 3HG1B 3CFCL 5IMKB 1CXFA 1F4XL 1I7ZB 4E41A 4JKMA 4JO1L 1MFDH 5E1HB 2I25N 1CFSA 1FNAA 3CGTA 3ES6B 3GMLA 5F9WC 5DC0A 1YEJL 4PTTB 4AG4H 1K3IA 2NY3C 4JFFB 2R39A 4LSTL 3MLTA 2EDEA 3LHPL 1QSFA 5CINH 4OI9A 4MCZB 1LO4H 1VACA 5F6IC 5L2KB 3HPJA 2X4NB 4G6ML 1RZJC 1QNZL 1FVDA 4XAWL 2HT3C 3JTTB 5T1MB 2HKFL 3TT3L 1HH6B 1G9MC 2GITA 3MACH 4ELKB 3X12A 5EWIH 2MTPA 5EBLB 4YHIB 3OAUH 3AMKA 5C0BE 3QCVH 1AXTH 1HSAB 3GSVB 5EOQL 1JZ3A 1BJ1J 1UENA 5C6WH 3HI1B 5I73B 4XCEA 4X9GA 4KY1H 5SWQA 3GMOB 2NMSA 4MD4B 1YEIL 3P77B 1ZHBB 1U8LA 1WGOA 3QEUA 4UV7H 1AI1L 3UTSE 4R7NA 3FRUA 4H1LG 2ICEA 4X7SL 3OKDB 2ITCB 3ZSTA 1A6PA 3X11A 3UPAA 3VGHA 3T65A 5CINL 5I16B 2HN7A 1SY6H 4HJJL 2Z93A 1TVBB 1BLNB 4LSTH 3V6ZB 1WAAA 2BVTA 4Z7NF 2X4SA 1MCFA 4QRPB 5F88A 2QLVB 4JO1H 3EFFA 1TITA 3MOBH 4ZO8A 3QXUA 1I7RA 1XIWB 2DL2A 2F58H 3GSOA 4RMVA 4KRPC 1C5CH 1VPOL 3ARDD 1FYTA 2V7HA 3JV5A 5IQ7H 1IE5A 1L9NA 2NQCA 1EIBA 3C5ZB 4MA7H 1R5VA 3NZHH 4OZ4B 1WBYB 5J6HA 4QF1A 2FJFB 1QSFE 1JRHH 4KK8C 3HZVB 4R4BA 4L29B 4Y16C 2E9WA 5GISH 2X1OA 4WO4C 1TXKA 5HY9B 1NSNL 1FZMB 5CUSH 2P7TA 3SE8H 1S9YB 2GJ6A 1E4XH 5GIRB 5ETUB 1IZKA 1Q1JL 3KDMB 5CJOL 4D0BB 5F9OL 3AAZB 1T0NA 2R0ZL 4U0RB 1RV6X 4F7TB 2FB4H 1UVQB 1B90A 2RJMA 4AZ8A 5B4MC 3P11H 3HAEB 1BX2A 3TZVC 1QPXA 5D7JA 3SJVD 5HVGB 5SWZB 5IJKC 4WI7A 1QBLH 1LK2B 4XVTH 1F5WA 3OJDA 2XTJE 5GS0H 2ZUTA 2FECL 2X4PB 4Y2DD 3VXRD 4QXUH 3TBYA 1T3FB 3GSXB 4QWWC 3U0WL 1JL8A 5IT2H 3B8YA 3RWDB 4G43B 3S34H 3FB7B 3HLAA 4K3EL 5ID1A 1FJ1A 3IDNA 3O0RL 1AFVL 2QL1A 4F8QA 2E9JA 3EBAA 2GUOA 5FO8A 3BMWA 32C2A 4C56A 5I19H 4FFVC 3KJ6H 4PB9L 1PYWA 1K4CB 2AK1H 5DWUL 4EUPG 3D9AL 3QIUA 4ONGL 4NZJA 2ZUQC 3L6FA 1F4HA 1UWXH 5CGYD 3QDJA 1IGCH 5C0CA 1FVCB 1A6VH 1EFXB 1F2XK 3HFMH 1NFDB 2J7LA 2ZSVB 4UBDD 2ESVE 4HPOL 3WL9A 3WLWC 4X5WB 5MEQA 2EICA 2C1OB 1G7QA 4R6UA 5FYJH 5MENB 3SGEH 2XV6B 4NPYA 4NOFA 5INCB 1JZ4A 4ZXBB 1U8OB 3UC0H 5IB1B 2X1PA 3WJLA 5T3ZE 4HUVA 2FL5B 4ZYKA 5EU7C 1WLHA 1I9EA 1F58L 2A0LD 4LQ1A 1Z3GL 1CDHA 1G7LA 3KPSD 3TT1H 1AKJB 1T22A 5JR1H 1ZT4B 4R96B 4G43A 3ARDC 3H9SD 3AB0C 5FECA 3ILPB 2E8ZA 4TNVK 1NAMH 4ZODA 1FCGA 4L3ED 4P9HC 1CLCA 4FZEH 1LO2H 2IPUK 3EOTL 2ZUQB 3GB7B 2D3VA 4N5ED 3QCUH 2V2TA 3L5HA 2K1MA 4GSDH 3O6KL 3QUYD 5I1EL 4UDUA 4WI4A 5HSFA 1INDL 3LQZB 3ZE1E 3RWEB 4KGJA 3TN0A 1BEYH 4PRPA 2E6JA 1X5IA 4LU5H 1VADA 1JI1A 4OFIA 4HKZA 3PWPB 5CGYC 2VDMH 2NY5H 4KTEH 5E2TL 1IAKB 3N9GL 4IRSB 4F3FA 4R3SB 1GOFA 4BFBD 4KVNH 2F53A 1WTGT 4ZNCD 1D5MA 1XR8B 4ZTOL 4RGOL 3QEGH 1KJ2B 3U4EB 3RPIA 4P46C 1UWGL 3MGOB 4JFDB 4X6DA 1FNLA 3PHOB 3GHBL 5DT1H 5K59F 4OCLC 2Y23A 3T08A 1YMMB 1SJVA 4R8WL 4J4PC 4ONHA 1T22B 4JM2F 2Z91B 4UU9B 1NBVH 3N1QC 1YEGL 4LRIC 4X8XA 4NUJA 3D3VA 4Y7MA 4H0GA 3PHQA 2B0SL 2HRLA 3VRLE 5FYKD 3V0VA 5IROA 1CICC 3WIHH 4Y5YA 2EDWA 2BSSA 1GGTA 1WZKA 3DV4A 1I3VA 2F54D 1BECA 3S88L 4I77H 3E8UL 3QXAB 3QFJA 5MHSE 2JB6B 1OTUC 4ODTL 2BERA 4NC1E 1MPAL 4LK4A 4GG6B 3C6LC 2NY1D 4YH6A 3SJVB 4FQXC 2NX5A 4V1DD 3FL7A 3NGBB 2YBRB 2X5PA 2EDBA 4YHMH 1JVKA 4ORGB 2DQEL 5A3ID 2HFGL 3VFOA 4JPKL 4HZLB 4EN3D 1IEAB 4WW2F 5DA0B 3X13B 5D71L 2QADD 3SDDA 1OGAA 3DUSA 4JY5H 4NGHL 2VZOA 4MCYB 4HDIA 2A0LC 4IMKA 2AAVA 3DIFB 4LVNC 3G5YA 1ZVSA 1YY8A 2X6MA 5CEYA 5JHLH 4G9FD 2K9UA 4CU8A 4F2MB 1PD6A 1MCLA 1H0DB 3BGMB 1A9EA 4QYOA 4KK6C 3HCVA 4WFEE 5EO0A 3FT4A 2XA8H 1E4WH 1B4RA 4LVOC 5F7EL 2P5EA 2VWEC 2B5IC 3WUZA 2FD6L 1QP1A 3TN0B 2PR4L 1YMMD 2GK0B 3S37H 4KZEL 4YHNA 4HT1L 1N8ZA 2J5LC 3FKUS 3JVGA 3L5IA 2Q6WA 1OP5H 3DBXA 4UTBL 3RWJA 1B6UA 3MRNB 3QA3B 4M02A 5IBTL 4U1GC 4U1MA 2CKNA 43C9A 3FFCB 5HGDA 3S37L 4KZEH 4UINL 3DVGA 1ZLWH 1Q9LA 2OX5A 3RPIB 2H3NB 5F96L 3MJ6A 4NKMA 3CU7A 3HRZA 2QQQA 1KN2H 3I50L 3VWKA 1MEXH 4RMWA 4DEPC 3OHXA 1MWAL 2VAAA 2GTZA 1S7UB 4PJAA 5E5UB 4BM7A 2YRLA 2R1WB 4QT5A 2KDGA 3QEQA 1IC1A 1T0PB 4OIBA 5IW1A 4I4WA 1I1AD 4YWGL 1VEMA 1X5LA 2QKIB 1F97A 3IU3B 3VG9C 4HS3B 4M7LL 5I66B 1DL7L 1JWSB 1KTDB 1KCKA 1XCQB 3NTCL 1MFBH 2BNRE 3PJSB 5J57B 1MI5B 4HXBH 5BJTA 2Y07H 5HYJA 4ODUB 4OCNC 3F12B 3QDAA 1KEML 3IU4H 1UH2A 4HLZH 2ICWB 1A1NA 2OR7A 2ZG2A 2HFGH 5EBWB 2HFFB 3ECBB 2ADIB 4L1DA 2ICCA 3QXDA 3TF7C 1T1YA 5K9QI 3IXAB 2X40A 4IMLB 4M62L 3TP4A 1MSPA 5E5MA 5ADOL 1MAKA 5DQJA 1SVZA 4JKLA 4DCQB 4FFZL 2EECA 3L3KA 2CLRA 4F7EA 1B0RA 1FZKB 5AZEL 4MNGA 3DX8A 4U31A 1YDPB 4CU6A 3ILQD 1LHZA 1DBAH 3BP4B 1KPVB 1YN6A 1MCQA 4L9LC 1B88A 4PP1D 5E24E 1JHTA 1JIBA 3ZTJG 3V5DA 4NYLB 2BNQD 4YBQC 5BS0E 1R3IL 5T1MA 3K2UL 3QDMA 4NQCD 3QR2A 4PJHE 1KCUL 4LVOB 2WUBH 5E2WL 3KPRE 3DHJA 3KR3L 3RWCA 3FJTA 3VXMD 4V2CB 5T1LA 4TSAH 3RVTD 1FGNL 5CWSB 1CU4L 3GHBH 3W39A 4MXQC 4EUPH 4OGAC 4RGOH 2P5WD 3BISA 4OFKA 3L7EA 3TV3H 3PDOA 3EJYC 4YXLH 3GSUA 5DJCB 1RIUH 5IJVB 4RDQG 1BF8A 3V8CA 1CFVH 3CD4A 1F90L 1HKLH 1NMBH 3QUYB 1ZT7A 4Y16D 4JFDD 3GKWL 3DARA 4YK4B 4DZBA 1I7TA 3PWVA 1INDH 2DDQH 1ZWIB 1U8NA 5D93B 1YPZA 1ZSDA 1GZPA 3N1GC 5DJ8A 3EO1B 3OGOE 5EPMB 4JFHE 2FBJH 5F97E 1IM3A 1NUFA 1J18A 3BSZL 1YN6B 1AE6L 1H5BB 1KGCE 3EOTH 1J8KA 4HIHB 3MX0A 4RGNB 1V8HA 3MJ8A 4N8CL 1OARL 1QLRA 4W6WB 5I1CH 1J1OH 3ARGC 4W4OC 4L8BA 1MLCA 4HWBL 4Y4FD 1T7WA 2AJUL 1X44A 4XNUL 3UDWC 3SDCB 5SWSD 3HI1A 1T89C 3MRGA 2DI8A 5TGBB 1MHCA 4JQIH 4QOKB 3MRMB 4JGJA 1T5WA 3M1BA 4N0FA 4CW1B 5AEAA 4ZUSA 3F7PC 3WE6B 3O2WL 2IPUG 1CBVH 3GI9H 1ED3B 4IMLA 2CDEA 4XP6H 2YPLB 3QWRD 4G7YH 2ED7A 2J8OA 3EYSH 1KJMA 2ZCHH 3QUXC 4ELMA 2XZCH 4PJ8C 3SQBA 3VFNB 5MEPA 2J1KA 3STBA 3MRFB 4KRMB 5AWNH 3MV8D 1IGCL 1SM3L 5D93C 4QRPA 5F88B 4NFBA 4E41E 1B2WL 2HJFA 3DVNA 1I9RL 3GBMH 1XF5B 4HIIA 3O3DA 5INDA 5D72H 5DUMH 3QNZB 4OTXH 8FABB 3VG0L 2QR0A 2W9DH 4A2LA 5TE6H 3NIFE 4X6DE 4DEPB 4KUZH 3BOVA 1VEOA 4XCCL 3LRSA 3SKOB 4G6FB 3CUPA 4AMKL 3MRLA 4DOHE 1T04A 1BOYA 4ETYA 3L6FB 1CE1L 3WFEH 1OB1B 4KKBD 5DK0B 4WHTB 4DWHA 3UTZA 5DRXA 5EO9A 4NQEB 4X4YA 2H32B 4XX1G 4WWKA 4JCLA 3U83A 1FSKB 5HYIA 3C09B 3DX6A 1S7QB 3BZ4A 2V9RA 3CVHL 4QXUL 5KBNC 4WJ5B 3U9PL 1HI6A 4HK3J 1QSFB 1QFOA 3AUVA 3BZEA 1UVQA 4Y5VC 5BRZE 1YNTA 4PB0L 4ZAKB 3HPJB 1CXIA 1BZQK 4HD9A 3BDYH 1BAFH 1QFWI 5E9DE 1EAPB 35C8L 1EHLL 5F70A 5GGTH 4E41B 5DRWA 1MLBB 4PJFF 1DBKH 4BZ2L 2X4TB 4H5SB 4N5EC 4NRXA 4PRDA 4JVUA 3OXRB 4HGWA 3H3BC 1X3DA 3QUYC 4QOKD 4HZAA 2LV4A 1NSNH 1I1FA 3A67L 5T3XD 4YNYB 3UMTA 4XMKL 4QRUA 4G6AC 4O00A 5FO9B 1GHFH 2VXUL 2FJFA 3P9WB 2YD6A 3DI3B 4GO6B 5DHVH 1XF2B 4JZNA 4Y4KB 4GS7B 4PP2B 5C3TA 1S7WA 1F4WH 3IFLL 1C5CL 1OB1A 4Q6IB 1HXMB 4YGAB 5JO5B 4M4PA 1ZHKA 2DQFA 2W0FB 4Q9BA 2EDNA 2EDRA 4L3EE 1WT5C 3R06A 3W0WA 5FGBA 2PYEA 5GGSB 1A6TA 3AY4A 2JK5A 3X11B 2P8LA 1F6AA 4PJFB 2FLRT 3RZCD 1EHXA 1K5NB 2HVJA 2N7BA 1BVLA 1ZHNA 3QWRA 3KXFD 2AJVL 5FUZL 1XF5A 4JEGB 1EPFA 5IW6A 4RMUA 4WO4B 3MNZB 1R0AH 3MV9E 3DX9A 3IDIA 5E8NB 3OJMB 4AY0A 1JF1B 4BSWA 2VLRA 2HKFH 5FYJD 5IFAH 1OTUD 2NY7H 4XAWH 5E94A 4UZGA 1QUNA 1PW3A 4TTDD 5T3ZH 1S8DB 3T77A 2ITDA 2YPKA 5GRVK 3QPXL 3O2DL 4PTUB 3O3EA 1RPQA 2XFXA 4P2RB 1AD0A 3RJDA 2UYLA 1QR1B 3W2DH 1O7VA 1NCTA 3EYVA 5H35B 4OUUB 4D0CA 3VXTB 5KSVB 2X89D 1CZ8H 2PW1A 3HZMA 1HDMB 4Y1AA 3JBG7 3VFPA 3ZKND 3MRRB 3MV01 1NEUA 3HAEA 4JE4B 5I8OH 1QVOA 2VXSL 3NCJH 4MZ3A 4H0IA 5IEHA 1IAKA 4B41A 3VGAB 1XF4A 5ELIA 1T66C 32C2B 3VGEA 1D9KB 1AHWB 2F53B 1BD2A 3DMMA 4M1GL 1ZA3A 1NCAH 4RISH 2Q8AL 1JPSL 4GUPA 4HKJA 4WI6A 1P69B 3RWGB 3ZYZA 5D7IE 3A6BL 4XNMA 3VFSB 5ACLA 4CNIA 5E2UH 3RWIB 4X6DB 1P4IL 3MLVL 5C6TL 3NFSL 4LARH 3B9KC 3HZYA 4EOWL 1AKJA 1JF6A 4MWFB 1CLYL 3IJSA 2DWDA 1ZA6B 4YIQB 4BSJA 5FO7B 3DTXB 5DLML 4CMHB 1RJZB 2VJXA 5FF6A 3RL2B 4I0PA 3ZL4L 2VZ3A 5E08L 1I75A 1OAKL 2X05A 2D4FA 1N7MH 4Z76B 1HQRB 3IKCB 2NY0D 4FZ8H 1S7RA 1IGYB 2R2EA 2UYLB 4Z7WF 5F7MC 4QHLB 3R1GL 5GS3A 3QI9A 3IKKA 5C0IB 3KPQA 5KSAC 1EUTA 3HPLA 3RDTB 2OLDA 3FO2B 3L9RB 3IETA 4OD2B 2J4WH 3ZTNH 4OSUL 4DUWA 3IFNH 3VD7A 3MLYL 3ULVC 1HHIA 3T1FA 5JZ7D 3PGFL 1VFUA 1OSPH 3C6LD 2CDGB 3S5LG 4A6YL 7FABH 3U7AA 5EU3A 3Q6GL 5E4IA 3S8WA 1EZVX 1TENA 5F7DA 2WV3A 1QFHA 2F5BL 3MV7A 2AJYL 1QBMH 3JUZA 1IKNC 3GHEL 2DQCL 4KKAC 4UAOB 4UILH 2OP4H 2WWKO 4MA1B 1OF2B 3LS5H 4YHLL 2H2SC 2IF7A 1YEHL 3MQIA 5IMLB 5CJXC 4KRNA 1SVCP 2VLRD 3MFFB 5EOCJ 4JPWL 2Y4SA 3F5WB 5A2JH 1R5WA 1ZE3C 3HMXL 3NPZB 1Q94A 4LL9A 1M4KA 4OB5H 5EH1A 5ESVA 5DJAA 4LBEB 4LDOB 4BSVA 2CLZA 2AEPL 2ATPA 4QRQA 3IKCA 3QFDB 4MNQA 4GT7A 5CEZH 4PRHA 5JXAH 2OTWA 4E41D 1EHAA 5T5FL 1KIQA 4G5ZH 2XRAL 1OPGL 3ARDB 1K8DB 2BFVL 1CL7I 1T66D 3S37X 4EIZC 4G42A 4IDJL 2XWJB 2EO1A 3CH1A 3VXUA 4NKDA 4OF7A 2BC4B 3NZ8A 4K7PY 4NQSA 3ZDYE 2Z35B 1J1PL 1DANT 4WI5A 3G6AB 3MRCA 4UAOC 1XZ0B 3LN4B 1S7UA 3QIUC 2PO6A 3QJHB 2XY1A 3HC0B 3I3EA 4MD0B 2G5RA 4YDJA 4CAGA 2OP4L 4PLKD 3CLEH 2YS4A 4D9QD 3P4MA 4NQXA 1IC5L 3BD4A 3FQTA 5BMFH 5HVHC 4HFWB 3FTGA 1G9NL 7FABL 4JJ5A 3MRQA 4U1NB 3FFDB 2WQ8A 4MNQE 2V7NA 2APXA 2HTKC 1IFHL 1T6WA 1IVLA 3ORJA 3QUXB 2X1WL 4A6YA 5I1AA 4MAYC 2EEBA 3G6JF 3GMQB 4MNQB 4X6BA 5IVXF 1NAMB 4GG6F 2IG2H 3W82A 5KJRH 2BNRB 4G7VL 5GZNC 4QHMA 2P43B 5BZWB 1J9CT 2GSGA 2JB5H 3TO4B 5DJXB 3ARDA 3VWJA 4HDIB 4KDTA 2NX5E 3GO1L 3QH3A 3UCRA 3DIFA 3MJ7A 4GLRH 1OAKH 5C0CD 1A0QH 3V79C 4NZTL 3ZL4H 5E08H 3PWPE 4MYWB 3VFVB 3HG1D 4IRJD 3BPNC 3G5ZA 5DLMH 4RZCA 2R4RH 4Y2OA 4ZUTA 4XPBH 1UZ6F 5HVHB 4N0CD 1NGPL 3E6FA 4BKLA 5AD0A 4YX2L 3ZDXE 1CGXA 1LEIB 5LGHH 3LRGA 4L4VD 4N8VG 3RGHA 3SDCA 1DUZA 5CSBA 2FO4B 2J12B 1WITA 5EOTB 2CLZB 1AGEA 2AK4B 3P9LB 4PY8I 5E00A 5FOJA 4K9EL 1QFUL 3FO0H 2YPVH 2Y5TA 5BVJA 2XWBA 1U58B 4B0MM 1X9QA 4F7PA 4FMKA 5ICYA 1RJCA 3UO1L 2DMCA 1A14H 5I1GL 4MNHA 1KUMA 1BQSA 1M1SA 3GMQA 4WUUD 3RVXC 4K71B 2WMPA 3MRIA 4KMQA 4DVBB 4P3WA 5E2VL 5CD5C 4GAGL 4PJCA 4P23C 3ARED 1LEKA 4I18C 3OHXB 4G9DB 4PYHA 4WFFD 2VXTH 2ICWI 3G5VB 4EDWH 1OP9A 1Y6MR 3GSQA 1F00I 3PNWB 3KPLB 3LEXB 4JFZH 2Q7YB 1MCWM 1NFDE 5F7YC 5HHQA 3U48A 5ISZE 3F65A 1XMWA 1QLEL 2HLAB 5ITFA 3ULUF 5LWYH 1QO3A 2VN7A 2W60B 1JYWA 4HIHA 1OD7A 3WFCH 2AV7A 4P2YA 2F53D 1R0AL 4LLMA 3TBSA 1P7QB 1N26A 1UWXK 1YY9C 2IQAB 2EYRB 1HI6B 1Z9SA 4I48A 4XB8A 4L8DB 4JPIB 4NO2B 3ME0A 3WKNA 3U4AA 5FFLA 3G6JA 4JHWH 5F1IA 2CPCA 3D39B 3K80A 4PRPD 1QYGL 3NABL 4K23H 4RBPH 5ID0B 2J8UF 1ES0A 4APQA 1OWWA 2HMID 4OLZH 4R97C 2G60L 3KPSA 4Z95H 2DQGH 4LP4A 3MRBB 4Z7VF 3HE7C 4FQ1L 4NRXB 5D5MA 3FQNB 1YQVH 2NXZB 4XGZB 3RVXD 3IFLH 1YMME 5C0DB 3LEYH 4PGBA 5DQ9B 4R4FH 3GKZA 1WBYA 3PNWA 1CDCA 1GHFL 3HUJA 3G04B 3CPLB 4OBSA 3VFGH 1INEH 2EE2A 4NC1C 4TNWF 2ICWJ 1G84A 3DO3A 1S78D 4J3SA 1VHPA 3VXUD 4Z8FL 1C12A 3ES6A 3GMLB 3ELAT 5M94B 1RZFH 4NQVB 4NQCE 1I7UB 2X7LA 5MEND 5HI5D 3IJYA 5H37G 5F7UA 3E6HA 1A6TB 5DQDH 5EU6E 5K59E 5GGTL 5SWQB 1ZEAL 1U6AL 3PGDB 2X9YA 4YXHL 4G9FA 3QT2A 3ZHKA 4OCWL 1LO0H 4JDTH 9CGTA 1DQLH 5KOVC 1VENA 3VFRA 3HI5H 4ZMAT 5DSCA 1GC1H 1LK2A 1ZLSL 2D9CA 4XP5L 3W0WE 3SDDD 1MRDL 3DX9B 1V3LA 1FFPA 1KJ2H 1RIHH 3BUYA 4JREB 4K7PL 1BGXL 4XGZA 3WFEL 1FJ1B 4J1UA 3K74B 4PLOB 4JFFA 2DD8L 5HHXL 3GMNB 2XY2A 4XCCH 4AMKH 3V4PL 5I1DB 4LSPH 3BPNB 1ZAGA 4XCFL 3SDYH 1R6VA 1W0VA 1JPTH 1P84J 4N9GB 4GW1A 4X83A 2VISA 3VJ6B 1WVZA 3AVEA 1SM3H 2CKBH 2ESVB 2FHFA 4OFYD 3P3YA 4D0BA 1KNOA 4X7TB 4OIAA 4L3EB 2OL3H 1FYTB 4EN3A 2HT4D 4WJ5A 1JCKA 1DEEA 4XVSH 5DA4A 5JXED 4J12A 2LVEA 4XBPB 4LCWE 3U9UB 2EDDA 5IGXH 4JFFE 2C4FU 1LP9B 4YR6A 4NM4L 4WHTA 4LRNH 3Q3GB 4PPTA 4XNUH 5DRXB 5HDLA 3OKOA 1I7RB 5EC1B 2W07A 4HG4J 5CZKA 5TH2B 3DX6B 2V5TA 1T4KA 1CLZH 4R96A 3C5ZA 2B8OT 1MRFH 1OM3L 4XH2A 4JKWA 1OARH 1FG2A 1PLGL 1O5DT 2GTWA 3EJYD 3MV8B 4BELD 1AE6H 1ZV5A 4JY4A 2XTJB 3QEQE 1JPST 4C56B 4X4YB 3C5SA 5E9DB 2Y36H 2CKBA 4C58B 1I1AB 2NY4D 5FA4B 2D7QA 2BNQB 4HWUA 2BSTB 2DB8A 4WTWA 1XGRA 5JPNA 3H9YA 5KS9B 3GKWH 2FJHA 2Z4QB 4HH8A 1MCDA 2Z31D 1G1YA 1F02I 3NCCB 4LGSB 3RNQA 1II4E 3IXTA 1CDGA 4FQ2L 3TBWB 3RX7A 3EO9L 2GY5A 3TBYB 5KSBB 2VDRL 4PJ9A 4NCDA 5C09A 1CU4H 1W0WA 4M43H 5L2JA 1BVZA 4Y2DA 3LS4L 5C0CB 4U1IB 4EI5A 2P49B 4QRUB 1DVFB 4KQ3H 1L0XA 4Y8DC 4XC3H 3DSFH 2ERJC 1KCUH 4M4RA 5E70A 4XH2B 3K2UH 2IGFH 3PF2A 1P2CA 3IVKB 1UJ3B 4HUXA 1Q9WA 1G7IB 3V6OC 3FT3B 1HXMA 1JGEB 3E0GA 4DVRL 4W81A 5IQ9B 5BVPH 5I1JL 1UACL 1A7NH 3BJLA 3KG5A 1QRND 1CK0H 3R0MA 1MAMH 4HMDA 4YHYB 4GKSB 4PJEE 4QCIB 2OL3B 2G5BA 3U1SH 1S7XB 1VGKA 5K9KB 1MH5A 1C08B 4NC2B 2YEZA 3FRPA 2V2WA 4YBLC 1UKSA 4OLWH 4LCIL 3TO4D 4DKFL 5F3BA 4M8QA 2ZCLH 1CFQB 1TQCC 4LIQE 5D7JC 4ODSH 2MNUA 4LKXB 2JCCB 3QFJE 5M95B 5CSZB 1BD2B 3SDDB 5L6YH 4J7RA 3PP4H 1N2RB 4PRHE 3OB0H 1LGVA 3AS3A 4KKCD 3OKKA 1MFBL 1FVEA 2DTMH 1Q9KB 2H9GB 5L8LB 3ILPA 4M7LH 1NAKH 3EGSB 4F57L 3BVNA 5C2UB 1U8QA 3OAYK 5I74C 4TN9A 3Q1SH 4OQTL 1D6VL 1R5IB 5T3XH 3IDMB 5TFSH 2RFXB 5BRZD 4G8GB 4XMLH 1J0HA 1FV1B 1KTLA 1I9JH 4KROC 1XH3A 3MRPA 1NC2D 5GRJH 4JRYA 1FQ9C 3WEXA 3WLBB 2D31B 3AGVA 2DWEB 2WSKA 4OUUA 4N1HB 4PD4K 1FL3A 5HYSA 2J88H 4UINH 4ZO6A 5CZVH 5ENWB 1OCWH 2MOVA 4JM2B 5GS1A 3JSSA 3JWOC 3I6GA 3H3KA 4C56D 4K3DL 3HPLB 4UTBH 1TJIL 3BHBA 5FGCE 1N59A 1S9XB 4EQ3A 5FHAL 4LSQL 2I9TA 2NW2B 1KJVA 4JRXA 4OCRL 1MCRA 3DHMA 1LDSA 2UVEA 3QCTH 2JJSA 3X17A 1H3GA 4LKXA 3ZKXC 2WP3T 1R3JA 2ESVD 2XPGB 3MYZA 4NFCA 1BIIB 1E4XI 5BS0B 2CRZA 3CFBA 4U6XA 2HWZH 4LCYA 4TYUA 4MAUH 5J12B 4QHLA 2GTZB 2WW8A 4PJAB 4OFVA 1PSKL 3FAWA 1KN4H 5ICXB 4M7JH 5I1LA 5B21A 3FB6B 5J13C 3QHZH 1N5YH 1J88A 5JA9A 3JWOL 4KPHH 4PGEB 3QO1A 3BKMH 4LAQH 4LDLB 4Z76A 3FZUC 3C60A 2R1YA 3DURB 3VE0A 3VGAC 4U7KA 4JY5L 2AXFB 5IVZA 1ZT1B 3TA3D 5GSRB 4QCIA 3CDCA 2X4OB 4OKDA 5D8JL 5DD1H 3T2PA 1J05B 5EO1A 1R24B 3BKYL 4PREA 3QG6A 2BY0A 4OM1L 4BH8A 4ETQA 4HK0A 4F58H 3GMRA 3DO7B 2A74A 2AGJH 2WZPD 3D2UD 1MPAH 4R9HA 1MREH 1OLLA 3P4OB 4CJ1A 1S5HA 3O6ML 1NDMA 3O3BB 3D0LA 3MJ9H 4YHOL 1BQLH 3FT4B 4ONFH 4AM0B 3W9DA 1DUYA 3WLWD 1BFVH 2Q7YA 3KPLA 3LEXA 4S0TD 3KYKH 3WIHL 3SKJL 4JZJB 4KPHL 3O6LH 2R8SL 2VLJE 2OTUB 5DJ6A 4U6VH 4RIRA 3BEWB 3VGDA 3KPPA 5ITBL 4KK9C 3O41A 5EOCH 4MQTB 1G6RH 2K7PA 5EORL 4M7JL 3QQ9C 2XNAA 1NC4A 1KELH 4EJ1C 3DXAB 1KIQB 3MRNA 1PEWA 1I8KB 3QA3A 2HJLB 4LRIA 2P5WE 4P5MA 1S9WA 3BFOA 3S4SA 4F7MA 4WUKH 4G42B 4F37K 1A7PL 3QNXB 1RFDH 1TJHH 2BC4A 4NQSB 4Y5YC 4POUB 4ZTOH 4JKKA 4LSDA 4OCRH 5HYJB 5I2IB 2Z0BA 3N9GH 1GOHA 5E2TH 5JW3H 4ZSOA 2I9TB 3C6SA 4IOIA 3CXDH 4LU5L 4R2GB 4BQ6A 5EUOA 2RQ8A 1EJOL 2F74A 4HIJB 3NH7L 4GRLB 4Z5RA 3EOBA 3KS0H 5CHNA 4C59B 4HLZG 5BJTB 4PGJA 5FKPA 4K7FB 3OJ2C 4K55A 1I9JL 2IBBA 2DJSA 3C87A 1A1OB 5F9DC 4QHKJ 1I1YB 3O2VL 3ULVH 1MRCL 4OCYH 3GIVA 5TFSL 5F9JA 3ULVE 5TQ2H 1D6VH 4X9BA 4OQTH 3ECBA 4LPTA 1T83A 3DOSA 4V1DE 3TJHC 4UNVA 3GMMB 3MJ8B 1NAKL 1S7VB 4OZGA 1MJ7H 4Q2ZA 2DTML 1NC4B 3QQ4A 2FJGB 4N90E 4XMPH 4U49A 2O5XH 2NY6D 5DS8B 4X0KA 2YA2A 3GRWH 5CIPH 5KVGL 1C7TA 2YWYA 1RZJL 3LIZL 3V4VH 4DN3H 1L4IA 5DD5L 3LH2H 1TZHB 2PXYA 3FOMB 4CW1A 2CIKA 4ZPTA 4PS4H 4OLWL 1JGLH 2GK2A 3RUGE 3IGAB 2C9AA 1N4XH 1HILA 4P9ML 4KKNA 1I85C 4NDMA 1NMAH 1A7NL 1VCAA 1LE9B 2ZUXA 3SGEI 5MI0C 3W39B 3BPCA 4HF5L 2VR9A 3TYFB 3S5LA 4HUUA 1TVDA 4MJIA 5I8KL 1AKJD 2EXYC 3UTTD 2QADC 1I8LC