4FHBD

Enhancing dhfr catalysis by binding of an allosteric regulator nanobody (nb179)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
125
Chain Sequence
b'QLQESGGGLVQAGGSLRLSCEASGRTFSSYAMGWFRQAPERDFVAVISWSGSNTYYADSAKGRFTISRDNAKNTVYLQMNSLKPEDTAIYYCAAPGRPHGSSWSLNKKGQGYDYWGQGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dihydrofolate reductase
publication title Mechanistic analysis of allosteric and non-allosteric effects arising from nanobody binding to two epitopes of the dihyrofolate reductase of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/protein binding
total genus 30
structure length 125
sequence length 127
ec nomenclature
pdb deposition date 2012-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fhbD00
5HYEA 4M6OL 5HGGS 2VITB 3WLWD 2NYYD 1JPFB 4LCWD 4OD2B 3GK8H 5TFSH 2YEZB 3ZYIA 1IZKA 1JPST 1I1AA 35C8H 2RFXA 3RY4A 4OSUL 4O51A 3RGVB 4YBQC 3JTTA 1KTLA 5EA0H 3O8XA 2D31A 3B2VH 2HKHH 1H0DA 1WWWX 5GGSY 1QLEL 5D5MF 2YUVA 1OARL 2D9CA 4GS7C 4QTHA 4Q6IC 4ZS7H 3CFJA 3PWPB 3KYNB 2WWMC 4PTUB 3VW3L 1CDGA 4WHDA 5HHOA 1PKQB 3TBTB 2O93L 2DBLH 2JTDA 3F12B 3MRMB 2X4OB 3PABB 5FA3B 5E8NA 3RUGA 2DWEB 3FZUD 3VXRB 3BP7A 1FFRA 1P69B 4N9GB 2WUCH 1INDH 3PHQB 1Z9SA 2EYRB 5DD0L 1C08B 5DUMH 4ZXBD 4UNVA 3U0PB 1R3IH 3GBMH 5IMLB 4NQCA 3ZTJH 2PTTB 3S5LA 1MH5B 1EHAA 4RMVA 3MODL 4GQPH 4X6FB 5BZWB 4Z8FL 1GYAA 4YNYA 2A6KA 1RZJH 1JVKA 1S5HA 4H25A 1DFBL 4NM8L 5FYJU 1ZHLB 4K23H 3IDYC 2O5YH 4NJAH 3ALPA 1NAMB 1T04B 1MHEB 4U6VH 4TVPL 2VO5A 3TV3L 3QNYA 3RL2B 1YEHH 1U0QA 3H9HA 1RAMA 3V4PH 5GZND 3ECBA 4X83A 1LO0H 1KC5L 5GS0L 5D1ZA 2E9IA 4KUCD 2AJUH 1CYGA 4ZYKB 3BEWB 1CD0A 4UINH 5IFJB 5KN5A 3L5XL 3IAGC 3R0MA 3JWDL 4CUCA 1MFNA 2EDTA 2IANA 3PL6C 4PG9A 5EU4A 5D1XC 5DD1L 3U0WL 3C60A 2JJUA 4PJ7E 3MLSH 4LDOB 3QUYD 4JHAL 4TSBH 5EOQH 1T03L 1I3UA 4KRPC 4C55A 5EIIB 1R5VB 3QEQE 4J3WA 1JCKA 4JY6A 4NQVA 3K8LA 1G6RB 1WISA 3S88H 3LD8B 3DUSB 1EJ6A 3OKKA 3VXUD 4RMUA 3PWVA 3QUMA 4M62L 1IEBB 3QHFH 4YZFF 2DKMA 1UM5H 4UIKH 3W9EB 2W0LA 1CXLA 2H41A 4M4PA 4PRID 4AL8L 4PRDA 1TZHB 4NRYB 5FKAA 5IMKB 2ZOKA 4HKBB 3QUZD 2F5AL 1CBVL 1NGWA 1IC7L 4BQCA 4F7EA 4PJ9A 4Y16A 5I1LB 2ORBL 3AUVA 2E8ZA 1DLHB 3R06A 1RJLA 4NWTL 1FYHB 2DLFL 3TEUA 3H3PL 2DQIL 4KROB 4HXAL 1JZ2A 4PRAB 3MOBH 3WJLC 5F7YC 2MHAB 3CFBA 2F9BT 1OGAA 1KJ3H 2P5WB 3QIUD 3MXVH 2X4NA 3I6LE 5FHBL 2WIIB 4OD1H 1AHWC 3PWNA 4U33A 1G7PA 1NDMA 4MJIB 4JJ5A 1U6AL 3U48A 4G5ZH 3VFPA 3QIWA 7FABH 4UT6L 3ELAT 1MY7A 5AWNH 4J4PC 4B41A 4RBPH 4GW4A 1SVCP 1K4CB 5EU6E 2NX5E 2W9DH 4KTYA 5DI8B 1T1XA 1PZUB 4GQ9H 1MJUH 1PBYA 4CVWA 3TWCH 4PV9A 4FQ1L 1U58A 2H8PA 2H3NB 2O5ZH 1H3PL 3IDMA 1OCWL 1F97A 1FNGA 2VOTA 1CGXA 4YDIL 4U1MA 3GSUB 5IJVA 5DFVD 4RFEB 3MUGA 1I9EA 2XZCH 3IGAA 1AKJA 3EZJB 3U83A 2YOCA 3BH8B 5E2WH 3DHMA 2J7LA 1KB5H 4LGSB 1OW0C 3BH9B 2MFNA 1L7IL 1CK0H 1VEOA 43C9A 4EKXA 4GKZB 2EXWD 4J3UA 4F9PA 1D5MB 2P24A 4AMKL 4KI1A 1EMTL 2AK4E 2BY3A 3WFCL 5CZXC 1HKLL 4LKXA 1A6UH 1S78C 5DSCB 3B3IA 5C0JA 3QEUB 5GRWA 4KI5E 1A7PL 1Q94B 2W0FB 3GMOA 4GBXB 4UTAL 3PIQB 3DRTB 4LARL 1OAZH 5EH1A 1RIUL 1KACB 2W9LA 5I76B 3B9EA 5JIPA 4HT1H 5IB1B 1XMWA 3O6MH 1ZT1B 5BS0D 1JWMA 3LPFA 4P3DA 5TQ0L 5T1MA 2NY5L 5DQ9A 4JGJA 4G7VL 5DDHA 5AUMB 5I16B 1A1MA 5AZ2H 1F6LL 4P5TC 3WDHA 1AO7A 3EOYG 3V0VB 3HS0B 1FPTH 4XVSH 1EAPA 2BNQB 3QUXB 4HJGA 4K9EC 5HDBE 1U8IB 1J18A 2LQRA 4JRWA 4LCCA 5FM4A 1VADB 5EZJA 4CMHC 3QQNA 1FJ1A 2YBRB 4EOWL 1YJDH 1U8MB 4F3FA 1DVFC 2IADA 5HYFA 2W9EL 3MJ8A 1CTNA 3KYAA 3B83A 2UZIL 5DHVB 3FKUS 5I19H 2UWEA 1TZIA 4TOYL 3ZO0A 1XF3A 5D72H 1JWSA 3FO2B 3LY6A 4NO2B 3V6ZA 3VXTB 4HCRL 3CH1A 4YHMH 4HQQL 2YZ8A 5D1XA 4P3WA 3QRGL 1ODAA 4LHUG 5FUCC 5KW9H 2OZ4L 4N0RA 1YEKH 3IXTA 4YQXL 3IFNL 3J8F7 4J3OC 1IZJA 4ZMAT 3OQ3B 1TIUA 4E41B 4HC1A 4IRSC 2F58H 1I8KB 2P8PA 4OB5L 4JFOB 2DQJL 2DTML 4YPGB 1QYGL 3KR3L 2VDNH 2AQ2A 3MV9A 4KJQD 5IW1A 5KOMC 2R0LH 5EC1A 4OV5A 4BK5A 4AJ0A 3M07A 4OQTA 1FZJB 5D1QC 1X9QA 1FNLA 2DIAA 3ORJA 4X8JA 1T1ZB 3EO1A 2CKNA 5E6YA 5GRVL 1IC4L 4HS8H 3RHWF 4X6BA 3GIZL 4NSKA 4YLQT 3RVXD 2BFVL 5IG7B 1JHLH 4PGCA 2JJVA 3P77A 5C08B 5ICYA 3WFEL 3VXSD 1XEDA 1MIEL 4JE4B 1DUYA 2FWOA 3K4DA 4Z95H 1FL5A 4PJCF 2ERJB 3P0VL 1F8TH 1MLCA 3RPIA 3MRHB 3NGBC 3FMGH 1GGCH 3EOBA 4NO0D 1CN4A 4S1RL 1RZGA 1GZQA 1CWVA 3SKOB 2AXGA 3RKPA 2Z31B 1QOKA 1QHPA 1NUFA 3CZFA 4OZFB 4Y4HC 4OZGA 4N90D 3T0XA 3V52H 4D0BA 5JOFA 1NAKH 5JR1H 3CXDL 5J6GB 5JO5B 4DN3H 3SKMB 4RX4A 5IEKB 1XIWA 4JO1L 4X5WB 3T04D 1A9BB 4WENB 2Y25A 4HMCA 1IGTA 5HSFA 1HIMH 4G8GA 2NLJA 4M6OH 4XGZA 3V4VL 1RZ8A 4PR5A 5D7LE 5GRJH 2XOTA 3LN9A 4WWKC 5MEQB 4OSUH 4JM4L 1P1ZB 3QI9D 2PXYD 4X4MA 3F7RA 4GUPB 1D5XA 3WUZA 2H2SC 2R0WH 3MRIA 5HI5D 2XWJA 3NCYS 2UV3A 3C6LA 5EOTA 1T5WB 5MEPA 4Z7OF 1LDPL 2C1PB 3G6AB 3M45A 1YEGL 4MXWH 3OJDA 3WMSA 3GHEL 4I9WE 3C09C 1QLEH 4XBPB 3ZDXE 5E4EB 1OARH 1CFSA 5JIIA 3QJHB 4G6JH 2OCFD 1URLA 2HRPL 3D2UA 4JQIH 5CJ5A 3VW3H 2NY0D 3BPOC 2FR4B 3BAEL 3V6OC 4UOW1 4U1NB 3KNBA 4GAJL 4JFYA 2DLTA 3WV0A 1HQRB 2KKQA 1IILE 3L7FB 2MKLC 3OAUH 4GXUM 2X4PB 1KLFA 5CSZA 4HWBL 5D5MA 3CVHL 1LNUB 4PRPA 5E9DB 2LVEA 1MLBA 3STZB 4UTBL 3GRWL 1J1OL 2D9QB 3HRZB 4R2GB 3ARFA 3TFKD 3TZVC 3WIHL 2AGJL 5CLWA 5JHDB 4HFWA 2R8SL 3ULUL 1CL7L 4NN7B 5F7KC 1ZT7B 3N0PB 4G8EA 4MNGB 3OB8A 1NBYA 2QJDA 2GK0B 3PQYA 2YPLA 3BKML 1DFBH 4JN1L 4NM8H 3WUWA 4NNYA 4GW1A 4Z7VF 4QRRA 2KL6A 3CVHB 1RURL 5C09A 4NC2B 1T1YA 4TVPH 4ERSH 5J56B 2F74A 3TV3H 2QSVA 2XPGA 2HVJB 4GRWB 2PW2A 1N4XL 4JDZB 5GS0H 1R5IB 1N2RB 1NFDF 4KTEL 2IEPA 2EYSB 2NY2C 2F5BL 3L5XH 1FAIL 3JWDH 4NKMA 1U3YA 3S97C 2ZG2A 3KJ4B 1RVFL 1EGJL 4UQ2A 5DD1H 3U0WH 3CXHJ 4ZUWB 5D6DA 4FZ8L 4JHAH 3TVMC 3UJJH 3OKDB 3WE6A 1T03H 4S1QL 5IK3A 2B1HL 1M05B 1QFWM 1BAFL 3W81A 2PYEB 2I60L 4MQXD 3PHSA 5DZLA 2Y06L 2IAMB 1T1WA 5EBWA 5BVJB 3RWJB 4KDWA 5GGTH 1CGVA 1JUFA 2OL3L 4M62H 3QFJB 5FO9A 5J13B 4AL8H 1MJ8L 4XVTL 4Y4FA 5MI0C 1Y0LA 1I7RA 5FOBB 5C07D 2F5AH 4WW2F 1OP5K 5FO7B 4DKDC 4RRPA 3RA7L 5A2KH 3LOWA 1P4IL 4BK4A 1ND0B 1AGFA 3E8UL 4NWTH 5L7XL 5EFIB 2OL3B 2DLFH 2QR0B 4MA7L 3L95A 5FUCE 3H3PH 2R2EB 3T65B 1F4XH 4HXAH 1FG9C 4FQXA 4WFGE 4ZUVB 5DQJB 3MA7B 2XTJC 1BQHA 4P46B 3P2TA 1NMBL 2P5EE 4Z7WF 5FHBH 3B9DA 1EO5A 2IBZY 2YS4A 4M5ZH 4RQQB 2OSLB 5I30H 1JK8B 3HR5A 1U6AH 3PWLA 4NUJA 5CSBA 1KTDB 4FA8A 1BEYL 4NCDA 4ZAKD 4JRYB 1AH1A 3DPBA 3SJVA 4UT6H 4ACPA 3LKQB 4OFIA 4JPWH 3UROR 1M7IA 4ZDHA 4R4FH 1R0AL 5IB5A 1H5BC 5KVFL 2AXFA 1S7TA 1SJVA 1SJXA 3ARQA 3C8DA 3L3JB 3B4NA 4OCWL 4FQ1H 3KXFE 3QCUL 2YZ1A 1OCWH 2AKRA 1IM3B 1U91B 3P9MA 4N0FA 4MQ7B 4NBXB 4V1DA 3V95A 2YR3A 3O3BB 1WBXA 5ITFB 1JTTA 4YDIH 1QHOA 2WQRA 4Y8AA 1KPVA 2CRMA 3GBLA 3ROOB 3UTTD 3OKLB 3T1FB 2R23B 1T0MB 2FJFA 5T1KD 3BHBA 3MLVL 4GAGL 4KPHH 3B5HA 3WS6C 5I6XB 1FGNL 1U92A 2XICA 3NOIA 5ID0A 4LQFL 1G9ML 5CJBA 3D69B 4M03A 2WINB 1BLNB 4FFYL 4L4VA 2SEBB 2GAZB 4AT6B 3FOMB 4NJ9L 1KCUH 2QV2A 1YPZE 1EMTH 2HFFA 4GKSA 4J7RA 3WFCH 4R4BA 4NYLB 2PW1B 1CR9L 4X5XA 1HI6B 1BD2E 1A7PH 4GRLB 5J57B 3O9WC 3OKOB 5BVPH 1VA9A 5I8OH 1RIUH 4PJ7B 2GFBA 5C92A 2A83A 4LPVA 4PLKC 3HRPA 4D3CH 5MENA 3K7UA 3FQTB 2EDXA 1FORL 5TQ0H 2NY5H 4GKOA 5E1AA 3CH8A 4MCZB 3ZKNC 4XT1C 3RGVD 2G75B 2HN7A 4MXQD 3HNVL 4G7VH 1OAUL 4FQQB 4OT1L 4D0CA 2H2PD 1LO3L 2E9WA 3TN0A 3HHRB 4OGYL 2J5LB 1GPOL 1QG3A 4YDLC 4TTGA 2V17L 1CDYA 4R6UA 4ZOEA 3GUTA 2VLKA 3K8MA 4EOWH 1Q9OA 1RHHA 3PWPD 1JZ7A 1IE5A 2W9EH 2VKWA 3MJ6A 5F70A 2PR4H 5KANI 1QPXA 1BBDH 2UZIH 4XPGL 4GKNA 1DJSA 2KQMA 4OKDA 4TOYH 1U3HC 1S9WB 5BMFH 3ZKQD 3VXRD 1I7TA 4JQVA 4HCRH 1NEUA 2RR3A 1CFNB 3NFNA 4HQQH 4OZHE 4MD0A 5CBEB 4PJAA 3QRGH 3NCEB 2Q8AL 2QKIA 3FT3B 32C2A 1Q9WB 3KPOA 3MLTB 4G6AC 3ZYOA 12E8L 1E4JA 1MRCL 5GPRA 1T4KA 4ENEC 2WANA 2MOVA 4PYGA 3BJ91 1T83A 1W72A 3QH3A 4HGWA 4WV1B 3PDGA 3FB7B 4PJDE 4NNXB 1LP9E 5A40E 4UNUA 4OB5H 5EU6B 3ARBC 2EDQA 2NX5B 2DQJH 2DTMH 5C9JA 1QYGH 3KR3H 3O3UN 5C0IB 3T2NL 3CCHB 1I7UA 3BOVA 1G7QA 2FO1A 4LBEA 4DCQA 2ZUUA 1OTUC 2OQJB 5EZLB 3VFSA 4PY8J 4XNYL 3QBTB 1IC4H 3ES6A 2ZNWA 4MJ5B 5CEXB 2YSSB 3GIZH 5MEOA 4TVPD 3VFUB 4PREA 4E42A 1HILA 2FD6H 1B6UA 1G9EA 4KUZL 1TDQA 2CRIA 2IG2L 3QCTL 5HXMA 2BFVH 4OUUB 5GS0D 3RDTD 3D85A 1H8OA 2XT1B 3BEVB 1D9KD 4OCLC 3WFEH 2BSTA 1J5OL 4ZNEE 1MIEH 5DMIL 1A6WL 4P5KA 1XF1A 2DJSA 1Z5LB 3CK0L 2AK4B 3P0VH 1FFOA 4XB8A 5HI3D 3EYSL 2YC1B 5J8OA 1IEHA 2XKNB 3NMEA 4S1RH 2XXCB 4RIRA 3CX2A 3BPNC 1ZA3A 2X6MA 4GSDL 1BX2A 5L0QB 4GG6E 4P9HC 1OWRM 4GJTB 3MBEB 1KV3A 4YFEA 3FAXA 4MXVF 2WW8A 4PGBA 3ARSA 2R2CA 2AJZA 4MVBD 3P4OA 3CXDH 4IDLA 2MSPA 4KROD 4D94A 4UI2A 4JG1L 1Q1JL 3UTSA 2YHGA 2QSQA 4RCAA 2R29H 3L3IB 2C1OB 3V4VH 2ADFL 5GGSB 1MRDL 4QHMA 2P5WD 5L2JA 4ZUUB 1H3WM 5DK3A 4JM4H 2XTJE 4MJID 1XGQB 5KZCB 1NCCL 3T08A 4GS7B 4Q6IB 1A3LL 2Z8WC 3WNOA 2VQ1B 5J1AA 4Q9RL 4LCUB 3GHEH 3RY6A 3BP5A 3V7AG 4CVZB 3TJHC 5D7IF 3VXMA 3W39B 4QHNA 2ARJB 3DURB 2NCMA 4ZTOL 1RK0A 4GO6B 1YY8B 3BAEH 1G1YA 2Q86B 3WHE0 4AIZA 4HEPG 3E6HB 1EFXA 2G5RA 1CDUA 1RFDL 4WGVB 3SGJC 2APVA 5E70A 3RU8L 2E27L 3PP3H 3CVHH 2VXTL 5IMMB 2JJSA 1MI5E 5DJ2A 4UTBH 3GRWH 1J1OH 5EPMB 1KENL 2AXJA 3WIHH 2AGJH 4HHAB 3IDYB 3TJEL 2R8SH 4Z0XA 1GXEA 3ULUH 1CL7H 2NQCA 2DLHA 4L3CB 3CPLB 3BKMH 1TQBB 2WIMA 4R7DB 1UACL 2EZ0D 1RURH 1UZ6F 3JUYA 4JFFD 4GBXD 3H9SA 4IHOA 2BCKB 5I1DB 1EEYA 4G43B 3PDOB 1A1OB 1SJEA 4CGTA 4QXUL 1N4XH 2PETA 2EO1A 15C8L 3NCBB 4X99A 4LHUB 4KTEH 5FUZL 3GSVB 2F5BH 2EH7H 2OS7A 4I48B 1F4WL 4F7EB 4KRPB 4K7PY 4JKWA 1R3LA 3S36L 2X42A 4XNMB 5ID1B 1RVFH 1EGJH 1ZANL 4H1LG 4NHCL 5E5MA 5T1DL 3ARRA 3KLDA 4HBCL 2BNQD 1JZ6A 4FZ8H 3QUXD 1K8DB 2EC9U 4BUHA 1U9KA 1PVHA 3BZ4B 4S1QH 4XZUA 5JA8B 1NFDA 3D5OF 5JA9A 2V9TA 2B1HH 3RFZC 2MPAH 4RAVA 1NDGB 1EK3A 4X6EB 1BAFH 1ZWIB 5L88L 3F8UB 1BREA 2Y06H 1WSST 3IJYB 4CDHA 1H8SA 2R69H 4X7TA 5HD8D 1CICB 2OL3H 3HI5L 4HBQA 3U30C 4BZ1L 3C2AL 1NGYA 1S7VB 2APWA 5D7JA 1RULL 4O2CB 1AIFB 2BY2A 1T0NB 1MJ8H 3QIBA 1NEZG 4PJEF 3BW9A 4XVTH 4MHHI 5CFHA 3LKPB 2ZUYA 3U1SH 1S9YA 2BZDA 2FJGB 2H6PB 2V7NA 1P4IH 4XI5D 5D7LB 2HT3D 3MX0A 2ATKA 5IBLC 1X6NA 4MA7H 3DV6A 3H6JA 3GHBL 4DW2L 4EN3A 1WK0A 4WW2A 5HHQA 5GSRB 1NLDL 5JORB 1AHWB 1MIMH 4M02A 4U1SA 2I5YL 5HJ3B 1UVQA 1WICA 4P5MB 4FQPA 4XBEL 1ZSDA 1MCDA 2CLZB 2DKSA 3L3KB 1NMBH 4XNQB 5JXEA 4J6RH 5D4QA 4HWZB 1FSKB 2A74A 3QB7C 1BEYH 1DDHB 4DEPC 4U4BA 2FH6A 2OMBA 2O61B 4I0PC 4EI5D 1R0AH 2NW2A 4NKOB 3KWWB 4GAFB 3D18A 3VFVA 4UIMB 4FG6C 3CXHK 4Z7WA 4XAKD 1ES0B 4XCCL 5DA0B 3QCUH 2Z8VC 5EUKA 3T4YB 4HIJB 5F6IC 3BZFB 5B8CC 1JE6A 4AQ1B 5EULV 4NHUA 2WM0A 1DLFL 2UVEA 4KY1L 2F53E 1NC2A 5INDB 3FFCD 3T2QA 4MDJA 3MLVH 1FZKB 1RJZB 1BWWA 1WVZA 2WP3T 4GAGH 5F89A 1VGEL 5DVLA 1FGNH 4NQDA 4LQFH 1G9MH 2Z31D 4FFYH 4JFZL 1TJHL 1U8HB 2QADC 1NJ9B 3MGOB 1OB1B 5F71A 5IKCB 5ICXA 4NJ9H 3DXAE 3EOTL 3BGAA 4K9EL 3ZDYE 4Y5VC 3QA3A 1CR9H 1D3CA 2C9AA 1Y18B 2RIKA 3LKSA 1MFBL 3DX8B 1C5DB 3IDNB 3DMMC 1WCQA 4H5SB 1MQKL 5K93A 5JPMB 3RZCC 2NNAB 4P5TB 5JLZB 1RJCA 4XHJD 3TPUB 2HJFB 1FORH 3OX8B 1FNHA 5C70A 4DUWA 3IS1X 3RVUD 1A6TA 3MPCA 1A7RL 4L4TE 5E2UL 2C26A 5IQ9A 3HNVH 2EYTA 2E9JA 4XWOC 4CMHB 1WC7A 5J12B 2IH1B 1N5AB 4OT1H 3ZZ1A 5I1KL 1XGPA 3JTSB 1DUZA 2V2TA 4LLWA 1VEPA 4OCXL 5JIHA 1JPTL 4OGYH 1GPOH 4XNZC 4HUWB 2J8UE 3TBVB 3QCVL 3U4BL 2AJ3A 4HIIA 3WLBA 2V17H 5IVXE 2ITCB 3V79C 4NKQB 4XPGH 1GGIL 3MNZB 5LAXB 1DEEA 3K3QA 4WO4A 5EBMA 5HHVL 3K4AA 1MCPL 2HT2D 5DEFB 1MCKA 3EOAB 4OFYA 3V5DA 4LAJH 4U6YA 4ALAL 4M6ML 3OG6B 1CU4L 4HH9B 4LOUC 4R2GD 2Q8AH 5EU3B 1SEQH 3VWKC 5HGBA 3T3PF 5JHDD 1UXSA 1G7JA 2LABA 3OR7B 2HTLD 3EDEA 2P5EB 12E8H 4HZLB 3UTQB 5BRZE 1DN0A 4G9FA 1MRCH 4TPRL 3AXLB 5F9OL 4ZFFA 3D0VA 3CDGB 1FAKT 1QSEE 3QDGE 2VWEE 5LG1A 5I18L 3L5HA 1I85A 4WW1A 5FCUL 1IAIM 2XKSA 5FAAA 1T22B 3QXTA 1CLYH 5GGQL 2HVKB 1JIBA 2GJ6A 2VJXA 3ARDA 1OT2A 4RGNC 1II4E 3T2NH 1ZMYA 1IJ9A 3KXFB 4YHPB 3ULUD 3L7EB 3VGHA 3LPWA 3H7BA 4YEEA 4Z77A 3P4LA 2D7TL 4XNYH 1QFWL 2A0LC 3BI9X 2CIKB 3IYLW 3QXAB 5FUOL 4N0UB 5DJXB 2J8OA 1JTPA 2DQHH 3CLFL 1TJGL 3Q5YA 3HUJE 4NQEE 4BH7A 2BNUB 4KUZH 3QCTH 4JFQA 4JFEB 5ICZA 3Q6FB 2I27N 3NGBB 1J5OH 2PYED 4M6NL 5FYKE 4LEOA 2IAMD 3L3OA 4KC3B 3RWGA 3EYQC 3S5LG 1YPZB 1OAQL 3SO5A 1M7DB 4XC3L 3EYSH 5F96L 1KIQA 4LSRL 5B3JE 1XR8B 4DVBB 4GSDH 3TT1L 5CD5C 3JBG7 3UPRB 1W0WA 4YXKL 3LS4L 1NCTA 1MWAL 5SWZB 4P0DA 3GMQB 3S6CA 4QXGL 1AR1D 3ALXA 1N0LA 2IH3B 4JG1H 1Q1JH 4WWKB 4WTZA 5GGUB 4QEGA 5HPMA 4GMTH 3MXWL 3MLWL 1BMGA 2ADFH 1MRDH 1K8IB 5CIPA 1DQJB 4P46D 1FCGA 1FVDA 5KSBF 1IAII 2CR3A 2YRZA 1EVUA 3WN5C 2HJLB 1AI1H 1R3KB 3C09B 4RMRA 4XVUC 3NN8A 1NCCH 2LVCA 4JRYD 2FEDC 1A3LH 2GITA 4JM2F 5DEGB 1QRND 2H26A 2IPKB 4LP4A 4EQ3A 4Q9RH 3O2DA 3OSKA 4LHQB 1FBIL 1AJ7L 3UX9B 1UQSA 1FO0A 1BVZA 1U8LA 4OZHB 4P48A 4DZ8A 2XWTA 5F1IA 3MV8B 1GH7A 3DNKA 4ZTOH 1S7UA 1AXSB 5I17B 1CTOA 2KH2B 4JKPL 4PRHE 5CINL 2MCPH 5D93C 5CBAA 5KVGL 3HC0B 3KDMA 3O41B 3TZVB 5KVEH 1RFDH 4LSUL 5ISZA 2WBJD 3RU8H 3WNNA 1MFCL 4FXKB 3MNVA 4MS8D 2VXTH 3RIAK 1FYTD 1PZ5A 5D7IA 4I3GA 3MCKB 4IBLT 4U3CA 2M26A 3CGTA 1KENH 1UC6A 2JB5L 3TJEH 1RSFA 1VFBA 2EXYD 1MY5A 5I71B 3BUTA 3LKNB 4OCNC 3T2PA 4APQC 3VG0L 4KHXH 2D4FA 4ODXB 3D0LB 3IJHB 3N1FC 3S37X 2ZSVA 1UACH 3SPVA 2PCPB 4YFDB 4GRLD 5TF0A 1P7HL 3FQNA 4PB9L 2X4RB 4L8BB 4QXUH 1CT8A 2OI9B 2Q6WB 3VGEA 2JJWA 4IMLA 15C8H 1OD7A 4KTDL 4ZS6D 5FUZH 1EFQA 4CVXA 5EU5B 3TVMB 3SBWC 4BKLA 1F4WH 4WGWB 3KPQA 3RX5A 3DVNA 3S36H 5I1AB 3WS3B 4JB9L 2EDYA 3HR6A 4NHCH 5T1DH 4HBCH 3X3FL 4ODVL 4Q0XL 1WIOA 4QOKB 1CDIA 4MSWB 2MNUA 4C56E 3VWJC 1ZVYA 4Y4KA 1JZ8A 4CN4A 4DUVA 3TNNB 1AGBB 5L88H 1QVOA 4PJXA 4P9MH 2DQFA 4GG6B 3KPRE 1SY6H 3EBAA 3HI5H 5SX5K 3NIDE 1FVCB 2P4AB 3AS2A 4BZ1H 3C2AH 5E2VL 1FFPA 3UEZA 1RULH 3BJLA 4M7ZC 1FVEB 3X13B 4D9RD 2QQLL 2D7QA 3RWCB 4J3XA 5SWQA 4HX1A 1JNNL 5KSAD 5HGDB 1JRHI 3AC0A 4FMKA 1DBAL 3RVTD 1PGRB 4HGMA 1JGVL 1S7WA 4OKVA 2XTJB 2P7TA 1WFOA 3RWHB 4O2FA 4MWFA 4YHNB 2HT4C 3GHBH 4S1DD 1PLGL 4PJEA 1B88A 1F3DJ 4EEEA 2DI9A 4OUOA 4FHBD 3O3EA 4GLRI 1NLDH 1KPRB 4M9OA 2I5YH 3Q6GL 4YWGL 4BSWB 2VERN 2UY7A 4XBEH 2Q87A 4XCEA 2NX5D 4DJMA 1UWGH 4HIXL 1IEAA 5GIRA 1XF4B 4OJFL 3RBGA 4PUBL 1PDKA 4Y19A 3GMPB 4Y5XA 5HYJA 4RGNE 5TE4L 1OGTB 5F7WC 3O4LA 3OMZA 4HS6A 3B9KD 1ORSB 2NY4C 1AD9B 1P7QD 4JCMA 3DSFL 1CD1A 4PJFF 1X3DA 4ZFZA 3QEHB 3OBAA 4ORZC 1ZLSL 2CDGA 3AS1A 4LFHG 1G7LB 1MI5B 2W60B 4XCCH 2VL4A 4TUKL 3KPSE 2HYMA 2XFXB 4FQLL 2NZ9D 4IRJD 3FAWA 5FKPB 2ENYA 1DLFH 4ZFOB 4KY1H 2WZPD 4I2XA 1A6AA 1U41A 3SDDC 2V2WA 1N3NA 3L5WB 4P2QA 3RVVD 4JHBA 4C83A 1VGEH 4I77H 1TVDA 4ZXBC 43CAA 5TE7L 2HTKD 4JFZH 1PAMA 5I1EL 1TJHH 5J3HD 3OF6A 3O9WB 3RWEA 1DEDA 3FRUA 3MBED 3QJFA 5BW7C 1D6EA 3RBSA 3BN3B 2EKSA 3QDMA 4ORGA 1HH6B 2CJUL 2ADGB 4ODBD 3CSGA 2G9HA 1FZMA 4FZEL 4F8QA 1MFBH 1YY9D 1XCQA 3G5VB 4YHLL 3BE1L 4PJIE 1MQKH 5FA4A 5GZNC 3C5SB 4L8DA 4K3DL 3VFOA 3PUCA 4U3HA 4DGIL 3QWOA 5T1LA 4YDKL 2HFEB 2WLYA 1VHPA 1YNTA 1A7RH 3EJZC 5KZCD 3FONA 1F45A 4URTB 5I73C 1V3JA 5I1KH 3P73B 3C2SA 3F7QA 2WWMD 1KTKE 5CKGA 4OCXH 1G9NL 5E1HB 3QUYC 3IDGB 2DN7A 4IS6A 3U4BH 1B0GB 4AY0A 1E28B 1U3HB 4OIAA 3WFBH 5GGRA 2X05A 4NWUL 3OKEB 4P23A 3MRNA 2WUBH 1AGDB 4JN2B 5DC9B 5DD3L 1Z9OA 1TCRB 3LSOB 5GRUH 3C8KB 5J11C 2R4RH 1LK3H 3VXQA 2ZCHL 3EJYC 2ATPB 5HHVH 4DTGH 1MCPH 3D87B 3O2VL 5ACZA 3QUZC 4EI6B 4H1LB 4ALAH 3BQUA 4M6MH 1CU4H 5T3XL 3SCMA 1FHGA 4M5YL 4WDIB 6FABL 3TIEB 1MCHA 3O6FB 1IAKA 2B4CH 3BKJL 3VFRA 5F9OH 1AGEA 3HC4L 4DAGH 5I18H 1EBPA 2YD5A 4WEBL 5FCUH 1IM9A 3C6SB 1HCVA 4LLUA 4HLZG 3UYRL 2DI8A 4K7FB 1P9MC 4KQ4L 3V8CA 3QIUC 3ZKSD 3KLHC 4FFZL 3KYOB 2JCCF 4M9PA 5BOPA 2Q1EA 3HI6L 1UADC 4LHUD 1LO5A 2VMFA 2OJEA 2D7TH 3RNKB 1QFWH 5HHNA 2ICEB 1BIIA 2JB6A 1I3RB 2NY7L 4QT5A 5FUOH 3I02B 3CLFH 1TJGH 2F53B 3FJTA 4L9LB 4ODWA 4HUVB 1K5NB 1KJ2B 1ZOXA 2X70B 4P9HL 4ZO6A 1MCBA 3ZE1F 4RWYL 4G9DA 4FNLL 3G08B 3FO9A 3PGDB 1BP3B 3V4UL 1DBJH 1H15B 1SYVA 4H26B 1T66C 3SO3B 3RTQC 4M6NH 5CZVL 2VB5A 1CICD 3F5WA 3DXAB 1OAQH 2PYFB 3QQ3B 3WEXA 4XC3H 1CFQA 5I2IA 5I0ZA 3WUWG 5F96H 3VI3F 3MACL 4WU5A 1QLRA 2CDFB 4BFIB 5JNYB 5DXWA 4LSRH 2AK1L 2XYCA 4NBZB 3TO2A 3TT1H 1A4JA 5TE6L 5F44A 2ESVA 2FHCA 5TDPB 3OPZH 2AV1B 5BO1L 3LS4H 5I9QB 4KDTA 1MWAH 1FNAA 2A6JB 3EO0B 5EUOF 4ZSOA 4QXGH 1HQ4B 2IQAB 4L4TB 4F33B 4NIKB 3DV4A 4KWUA 4I18B 1F6AB 4DOHE 4HKZB 4KV5F 4BQ9A 5DEZA 3MXWH 1DE4B 3MLWH 2RAMA 2BY1A 4I9WD 5BV7H 2X4UA 4PRPE 3BDYL 1L4IA 5IVXB 4WFFE 3G9VA 4LCWE 3R8QA 3S96B 4LLQA 2A2QT 1LEGB 3G5YB 3FN0L 4P57A 5F8RC 2E5EA 5GRXG 1FBIH 1AJ7H 3D3VA 3FQRA 1I8IB 4NRXA 1M6OA 3PWJB 4MNQE 2Y7QB 5E5UB 2IPUK 4JKPH 4I0CC 5BRZB 2X4SB 3IVKA 1IGYB 4LSUH 4F9LA 1OF2A 5DHXB 1NKOA 5C0AA 1MFCH 3MLZL 1QSEB 3QDGB 3U46A 4JHWL 1MREL 3NPSC 1UKTA 5B21A 1LD9B 1BM3L 4XWGL 4MA8L 1V3LA 3NIGE 5C8JB 4TRPL 1S78D 1S7XB 1BQHG 1ZHNA 3T77A 1S3KH 3G6JB 3RAJL 5EN2A 3VG0H 3GNML 4Z7UE 4QGTA 5FYKL 3M17B 2WAHA 1Q0XL 2N7BA 1EEZB 2WBKA 1IMHC 5MERB 5EORL 2Z35B 4PB9H 4PRIA 3HUJB 4NQEB 3MYZA 4MMXC 1GCFA 4P5TD 3HZMA 1TJIL 4KTDH 5IVZB 1NGZB 4AK1A 3SE3A 4YK4C 1RZJC 4JO3L 4ELKA 1I1FB 1BVLA 1UB5A 3V5KA 1J8HA 4YZFE 4JB9H 1RU9L 1I1AB 2I26N 4NPYA 4LKCB 3PXJA 4XMKL 4K3JL 4ODVH 4YO0A 1NBZA 2FZ3A 3SE4A 4Q0XH 4OZIF 3DYOA 4M61B 3RVXC 2ILLA 1RZIA 2EIZA 4ODUB 2A6IA 3Q1SL 5HYIA 4HXBL 4N0YL 1ADQA 1MCIA 2E6JA 1X7QA 2JK5B 4PJGE 3C08L 4GAYA 5E2VH 3WCYA 3CFJB 2D0GA 3SKNB 1ZVSA 4JZOA 3VXUE 3QNXB 2AJXL 2QQLH 4BJLA 5T3ZL 5F7DA 3RJDA 5ITBL 4XPFL 4XCNB 5L8JB 5TF1L 2GJZA 1A6VL 4NQSB 3RUGB 4PJ5D 1IAIL 2K3TA 4F7PA 4Z76B 1DBAH 1NC4A 1JGVH 2P5ED 4XRCA 4QF1B 3VXNB 2BMKA 4YC2C 1C16A 1PLGH 1A1NA 1W0VA 3QG7L 4UOW0 4XP9L 2JJTA 4ZPTA 3S3SA 5BJTB 1NPUA 4LDEB 5JXAL 2VN4A 5C0DA 3S5LB 3REWA 1JYNA 3HLAB 1A3QA 3Q6GH 4YWGH 5E7BA 5H8DA 4EVNA 4OLZL 4YNYB 1QEWA 4LLAA 3IDIB 1HHHB 4DEPB 3ISWA 4LF3A 1DBKL 3QDJE 4I0PB 4OJFH 4JY4A 4PUBH 2MCG1 1V05A 2IJ0C 3QEGH 5TE4H 1P4LA 3QI9C 3BPLB 3H9HB 1AFVL 1OTTD 2F19L 2PXYC 3JUZA 4PRHB 2ZSWB 3QQ4B 3QXDB 4R7NA 4FFVD 4LGRB 5HI5C 3DSFH 5F6IB 3FN3A 2N7AA 1CXHA 1ONQA 1YYLL 4POZC 5B8CB 1ZLSH 3J7HA 2DKUA 4RBPK 3QUML 4JRXD 4TUKH 3AVEA 1RZFH 3G6DL 4JFED 1GOHA 4XVJL 2GW5A 2V5MA 3EJJX 3C60B 2NY0C 1Z9LA 3SDXF 5GHWL 5EZOL 1JWUA 4X6DA 5BS0A 4PJFA 1S7QA 1B4JL 1TVBA 5FDWB 3T0EC 2CUHA 3ZKMD 2QADB 1CFTA 3OKKB 1P2CA 1KLUB 2ED9A 3U6RB 5DJDA 2L7JA 3VXPA 4QRPA 2UUDK 3U7WL 4Y5VB 3TFKC 1A14L 1INEL 5TE7H 4UV4L 5ALCL 3SQOL 5I1EH 4PRDB 1I1RA 1FIEA 2ZOKB 1GZPB 3E0GA 5DMJB 1E4KA 5SWZD 4QRQB 2CJUH 3RZCB 5BCAA 3BIKB 1P84K 5H2BB 3R06B 4NDMB 2VSDA 2X4TA 4PJHF 3BT2L 3QPQD 4XP5L 3BE1H 3IETA 1OPGL 4K3DH 4DGIH 2YD4A 4C56B 2B2XH 4HUKB 3QT2A 1IGJB 1RK1A 4YDKH 1HHJB 3GJFA 3ILPA 4ELMA 1SYSA 5FV1L 4XNZB 4QGYA 5F3BA 3I50L 5DK2B 4QYOB 4U49A 3KPRB 4JPIA 5D2LE 1UXWA 3GB7B 3CJJA 2X4NB 5IGXH 3BWAA 1G7PB 3RL1A 1G9NH 3VRJA 1JRHL 3GSNA 4H1LH 1R3HB 3ULVL 1XGTA 4G7YL 1CXKA 3MV8D 1L0QA 4NWUH 5KAQF 3DRQB 4MQXC 4EQ2A 3DROA 1T1XB 3D25B 2E3VA 3NPZB 3O2WL 4PV9B 3VWKB 3ZTJG 1U58B 3TZVD 4NP4L 3HMXA 2ZCHH 5E00A 2PKDA 3WIIL 1MFAH 2BRQA 4ZUSA 4MNHB 4WEMB 5IJVB 5T3XH 2X1OA 3MUGB 5KSUA 1WEJL 3PE9A 2Q20A 4M5YH 2RGSA 3IGAB 5JOPE 2GTWA 4PJBA 4LPCA 3OKYA 1S8DA 3BKJH 1XH3B 2R4SL 3MFFA 3WHXB 4RGNB 3VXSA 1OD9A 4HWNA 4WI7A 5A3IC 4FFWD 3HC4H 5ADOL 4WEBH 4K7PX 2C7UA 2IQ9L 4U31A 3F62A 3PG2A 3UYRH 1BOGB 5E6IC 5H94B 1XCTA 4KQ4H 1QLFA 4IEFB 4FFZH 4P2CG 1LK2A 4YIQA 3RWDA 3KPSB 4QXTB 4ZD3L 1VACB 1AD0A 1C7SA 4U6XA 3TVMD 3VFWA 3STLB 4FQJL 4YHOH 4ZAKC 1CLCA 2PO6A 5C0BD 2NY7H 2F54D 1CGSL 5D8JL 5C0FB 1ED3B 4PJCE 1I8MA 2DM2A 3P0GB 4P3DB 5T1MB 3AS3A 4KJWC 4RWYH 4P9HH 3TM6A 1EZVY 2CKBA 3CSYA 1KNOB 4FNLH 1HZHH 1ZKAA 4QOKD 1LGVA 3V4UH 1AO7B 1KBGL 1NCUA 3S35X 5LGJA 1EAPB 4XMLL 1CQKA 4HJGB 5CZVH 1JPSL 1ZA6A 5AAWA 3WFHA 4X4YA 4JDVB 1MHHA 2VLJE 4TQEL 2ED8A 3DX9B 3NZ8B 2DD8L 4JFPB 4R96B 2IADB 3ZE0F 4U7KA 3MACH 5GGVL 4FN0A 2NXYC 2FX9L 3RRQA 2AK1H 2B5IC 3UO1L 1TZIB 5TE6H 3KHOA 4PJIB 1XF3B 3RWFA 1I1CA 5F9WB 5EIQA 4HC1L 2BOBA 5GZOC 3NCCB 1J1XL 3OHXA 3KYMB 1U93A 3EYOA 2V9RA 3WN5B 2VDQL 2V9QA 3T2OA 3AREA 4XPHL 4PV8A 4PJ8D 2XG5A 1O7SA 2VL5B 4L3EE 3GKWL 3C5ZA 4Q9QL 4JHZA 3ZSTA 5EUOA 5DRZA 1CE6A 4OLYL 1RV6X 2P8PB 4MXQC 4AENB 3I6GA 8FABA 1WZLA 1BIHA 4JY5L 3R8BB 3FN0H 5IW1B 2H2PC 5EC1B 4BM7A 4A6YB 5D93B 2BP3A 5DGRA 2C3VA 4XXDB 1Q9KB 3NFSH 3EO1B 4JKLA 4FTVA 2DBJA 1WZ1L 1CS6A 3X14B 2AS5M 5T33L 4PGDA 4NSKB 2E6QA 3G04A 5EC2B 1UZ8B 4JLRA 1UKSA 3P9WB 1C12A 3L3HB 1VB9A 1DCLA 1MJJB 4F7CB 3MLZH 4Z7VE 1LO2H 2RJMA 4JHWH 5SV4A 1ETZB 1MREH 5CUSL 4QCIB 3ARXA 5IQ7L 1DUYB 4WTWA 4CJ1A 1LEKB 3T0EE 4TRPH 4I3RL 4WUKL 4PP2B 3GSWA 1CG9A 3HC3H 3O9WD 3RAJH 1N5YL 3PJSA 3GNMH 3QO1B 5ENWB 4G42B 3AAZA 5DJCA 2R1WB 4LP5A 4XP4H 4ZUTA 5FYKH 2E7LA 1BZ9A 3B2UD 1Q0XH 1U95B 3FOLA 1F3RB 4HUUB 1KG0B 3G5XA 3IDJB 4TNVF 4QHKI 3P11L 1OHQA 3ZKND 2BVOB 4P2OA 2XI9A 5IOPB 5KS9A 3GSXB 5FF6B 1NGPH 1A22B 1EUUA 2K1MA 5F9AC 5GS2D 3T0AA 4MJ6A 1TJIH 4QRUB 4D8PA 5D7SL 1B4RA 2GSIB 4XGZB 3DUUA 3MZTA 4JO3H 4X9IA 1N64L 3VWJB 1RZ8B 4PR5B 5KOVC 4MAYD 1RU9H 5B4MC 5E5RB 4XMKH 2AJYH 5E95B 4G6KL 1TETL 1KIRA 5F7LB 3H9YA 5HVFB 2AEPL 5GS0C 3RDTC 3Q1SH 3N06B 4M7ZB 2BHUA 1D9KC 4JKKA 4HXBH 3OJDB 4N0YH 1NANI 4Z78A 3LD8C 3IF1A 3QSKB 5E56A 1XF2B 3CDFA 4J1UA 4HUXB 1IGFL 3JWDC 3OKNA 4GMSL 3F7VA 4CMMB 3GKZA 4OZIA 4H0GA 5HI3C 5I1HL 5T3ZH 3RIFF 5ITBH 4XPFH 4J3VA 1RUQL 3KNBB 3TH4T 5TF1H 2J6EL 4RSVA 1CGWA 3OL2A 3MGTA 3V6BR 1CFBA 1A6VH 3BD3A 1P5VA 2RBLA 1IAIH 5CSZB 5D5MB 4PRPB 4Z7WE 5DVOA 4RDQF 2BJML 3O6FD 1KJMA 1S7SB 1NSNL 3ARFB 3MLUL 5I8CB 4XP9H 5JXAH 4PYHA 3EO9H 1RJYA 4KROC 2W59A 4IRZL 3LQZA 1KEML 3MR9A 4WCYL 1TQCC 3GMNA 3SGKA 4G8EB 4OLZH 1NBYB 3O6LL 3W2DL 3WUWB 5JZ7C 2NY4B 5T3XD 4NNYB 5DRNA 2Q7YA 1DBKH 4DGYL 4ZQKA 1E6OL 4MNQB 1WBYB 1P4BH 2F74B 4TUJB 2X7LA 1AFVH 2F19H 4KZDL 3U79A 1I8LC 3S8WA 3T0DA 2VDMH 5CILL 4U1KB 5DD5L 1GC1L 1CXEA 2F53D 4MCYA 2GY7B 5C86A 5J6HB 1KN2L 5DMKB 1BBJB 4PY7A 1CDHA 5HHPA 4HW6A 3FO1B 3QUMH 3QWRD 5CJXA 1RIHL 3G6DH 3P40A 3SDDB 4UQ2B 4EDXB 1G84A 5CGTA 2D7PA 1JPFA 4OD2A 5GHWH 5EZOH 2YEZA 2BRRL 3W0WD 3WE6B 1T7VA 1DQQB 3C8HA 1B4JH 4V2CB 1Q9LA 3RGVA 2X9XA 4Z7UB 1YEFL 2Q3ZA 1NLBL 3MJ9L 3VD7A 4X8XA 5EBWB 4JGUA 3T0BA 3U7WH 3UTTE 5B3NA 1A14H 3SDXA 1INEH 1MHCB 4FQ2L 4UV4H 2CLVB 4U1GC 3SQOH 1QNZH 3ARGC 3BYYA 2W07A 1Y0LB 1I7RB 4LPWA 1NCBL 2OJZL 4HPYH 3KYNA 4PTUA 3UBXG 3TBTA 1PKQA 2J2ZA 2VDOH 4L4TD 4X7FC 2EZ0C 4PRBA 4DKAA 1ZGLM 3F12A 3MRMA 3DUHA 4Y8DC 3BT2H 3PABA 2BHYA 4XP5H 3L95B 2DWEA 5IROC 3VXRA 1OTSC 1OPGH 5F7UA 2RCSL 5E94B 5HBBA 2DMKA 3ILQC 4HK0B 4N9GA 3DIFB 3PHQA 3HE7D 2EYRA 1C08A 1NFIB 3I50H 1BQHB 1MFEL 1FNSL 4NKIH 4GRWF 1MH5A 3IKCA 4PJGB 4PJHA 4Z0BL 4X6FA 1ZHLA 5IB4A 3LRSB 4NUJB 4R0LA 3QUXC 1JRHH 1QSVA 2JKXA 2Y1VA 1BJ8A 4O2EA 3ULVH 1NAMA 5J11B 1T04A 1F3JB 1MHEA 4WHTA 4ZODA 1HXYA 1M71B 4JFDD 5IB5B 2GJ6E 3SY0B 1T89C 2NY5C 5IV2A 4QY8B 5BRZD 3O2WH 3SDCC 3BISA 5E08H 3PWPE 4ZYKA 3BEWA 3L3DB 3P9MB 3WIIH 2EDJA 1QSED 3QDGD 3EHBD 3PDDA 2GQHA 2Q3AA 4PBXA 4WTZG 1WEJH 4XI5C 1R3JA 3FHQA 3QDJB 2R1YB 5EIIA 1R5VA 4WTXA 3VE0B 4BFBD 1G6RA 4KKAD 3DUSA 5ADOH 1U8OB 1IQWL 2IQ9H 2X89A 1BJ1J 3RPKA 3W9EA 4JVPA 4YDVB 2R0KL 4N1HB 1A7QL 3HZYB 3GSQB 1TZHA 4NRYA 4NQED 5IMKA 3F6LA 4HKBA 3C9NA 3LB6D 4ZD3H 2BSRB 1FG2B 5I1LA 4R9HA 1JZ3A 2LAAA 4FQJH 1DLHA 4WVRA 5FYKD 1HYSC 3QP3A 1CGSH 4LMQE 5D8JH 5H35B 1I1AD 2P42B 4EI5C 3RTQB 4CRPA 2FDBP 3VJ6B 4AEEA 2COQA 2YXMA 4PRAA 2QHRL 4D0CB 1FRGL 2MHAA 1KBGH 4XMLH 3F7PC 4JR9L 5F9JB 3TO4A 1JPSH 1PKOA 4TQEH 2DM4A 2WIIA 4N68A 4MXVE 1FLRL 4YUEL 3AU1A 2DD8H 5IWLC 1L6ZA 2Z91B 1CXIA 1RIVL 1RHHB 5GGVH 1BFSA 5IBLD 2FX9H 3U36B 3UO1H 1K4CA 5DI8A 1R5WB 1W72L 4PG2A 5GS1A 4HC1H 2H3NA 1Q0YL 1VESA 3NFNB 5J0BA 4LPXA 4HGKC 4G8FB 1PG7X 1J1XH 5AG8A 2VDQH 5T3ZD 4KVCL 4W4OC 4OQTH 3UZVB 1FE8L 3U9UB 1JHKL 5CZKA 1T4KB 3CSPA 3GKWH 3BH8A 1M1SA 1W72B 4KQ3L 2CUMA 4HGWB 4XHJC 4OV6F 1AR2A 3BH9A 1KT2B 4I0PD 4F58L 3MRKA 4OLYH 3CFDB 3L9RA 3SQBA 2P5WE 4PJ7F 4GKZA 1KCLA 1ULVA 1WCBB 5ESVA 1RUPL 1D5MA 2FBJL 1I7UB 2GSGB 3PHOB 3O4OC 3MV11 5D1ZD 4LBEB 4DCQB 1UKQA 2ENSA 2BNRE 2ARWA 5DSCA 5L2KE 3QEUA 1Q94A 1JI2A 2W0FA 4GBXA 4Y5YA 1WZ1H 3ES6B 3NZHH 4IJ3C 1P7KB 5I76A 2VXQH 3C60D 3UYOD 1HILB 3NPSB 2KPNA 3FQUB 3GGWA 2DL2A 5IB1A 1ZT1A 5I15L 1A6PA 5K33A 3D85B 4FS0A 3V5HB 2OXGA 2VZOA 5HYSA 1UZ6E 5I16A 5CUSH 5E8EA 3B6SB 5IQ7H 2OMNA 3V0VA 3PP3K 4Q7DA 1EXUB 5F21B 5DJYB 1MSPA 4R2GC 3LRGA 3LHPH 3CSBA 1U8IA 2O5YL 4HFUL 4I3RH 4WUKH 2HTLC 1VADA 4NN7C 2AJVH 1N5YH 4RIRB 4XXCC 5C0GA 2YBRA 2GUOB 3ZT6A 4RMSA 1QBAA 1T21B 3RZCD 3MLYL 2HFTA 5DHVA 5K9JL 1FLTX 3DO7B 3P11H 4PJCB 5I8EB 1J8KA 2HJKB 4YK4B 1ZVHA 3P4OB 1L0XA 3FO2A 4NO2A 3T3MF 5HVHC 4XWOD 3HAEG 4DUXA 1QR4A 5C0CA 4JFFE 3ULUC 5D7SH 5TDOB 3NCMA 3UPAA 1F11B 4QHMB 1OGAD 3EYVB 2VABB 2VLJB 3U4EB 5L2JB 1Q8MA 3NA9L 4RFNC 1I9RH 2W65A 3KJ4C 2GI7A 1ZT4A 4G6KH 1TETH 1OQXA 4E41A 5IHUL 3UXFA 3OGCB 2AEPH 3CZJA 4M4RA 1UM5L 1I8KA 3ARZA 3QZWG 5L8KB 1EJOL 4JFOA 4YPGA 2IAMC 2OZ4A 5DVNA 3BP5B 1IGFH 1HINH 4GMSH 1CD9B 3VWKD 2MMXA 4LOUD 3CUPB 1AGCB 3SN6N 3GZKA 4OCMC 1IAOB 5J13C 1RK0B 5I1HH 1T1ZA 5CLTA 4L5FL 1RUQH 1HSBB 3ARWA 3ULVD 4LVNC 4L3EB 1HHKB 5F1NA 2HG5A 1DQLL 2BJMH 5IFAH 2FX8L 5DJ2B 5IG7A 4KI5F 1NSNH 4JM2C 1EO7A 5HGAA 5C08A 1NMAL 1AR1C 5A2FA 4IRZH 2HRLA 3MXVL 4WCYH 3W82A 3QI9B 3O6LH 1EEUA 3W2DH 2XWBA 2PXYB 2VDLL 4G5ZL 4DGYH 2AABL 3FT4B 4P2QE 4XMPL 4W6XB 2APTA 3NABL 1E6OH 3SKOA 2GY5A 2Z31A 1U36A 4OBSA 4KZDH 1TLKA 4OZFA 5DUBB 2W9DL 5HDBF 5CILH 5DD5H 2FEEI 3S34H 5JPNB 4X99B 5DJ6B 5ETUB 5CWSA 1GC1H 3GMLA 5J6GA 4Z7VB 5JO5A 1KN2H 3H2WA 4X7CC 4X5WA 5IEKA 3MREB 2ZP0T 3F6IA 1A9BA 1D5BB 1EX0A 5FHAH 1JHTA 3EYQD 1RIHH 3T0EB 1AO7D 3CD4A 1KELL 4JDTH 2BRRH 4ONHA 1F13A 5E2WL 2YWYA 1YEFH 2WBJC 4GRMA 1NLBH 4U1JB 1GAFH 3MJ9H 3D39E 1KUMA 1U8NB 4U05A 4X7TB 1T5WA 3U9PL 1U8KB 4LASL 3QDHA 2C1PA 1NGYB 3G6AA 2X44D 4FQ2H 3FFCE 3NCJL 1A6UL 2R2HB 3BW9B 2EXYC 1NCBH 3QJHA 5BXFB 1UEMA 3IFPB 2K7QA 2OJZH 3HG1E 3BKCL 1EO8L 1G7IA 1NBQA 2R9HC 4G6MH 2QSTA 4U1NA 2AJSL 5DHYB 1HQRA 3L7FA 1BZ7B 2X4PA 2GCYB 4XVUD 1LNUA 2RCSH 4EN3B 4AEFA 5E9DA 1G9MC 4WW2B 5HHQB 5I1IL 4RISL 3HRZA 5JHDA 1UVQB 3ABZA 2FX7L 2UWEF 1MFEH 5BZDB 1KCVL 3CIQA 5F1OB 2ZCLL 5IHLB 1PD6A 1T3FB 5A1AA 4XXCA 4Z0BH 4MB3A 2GK0A 2J3SA 4QNPF 4LQ1A 3AM8C 4HWBA 1J9CT 2YRLA 3UDWA 2WWKT 2DWDA 4LVOC 1J11A 2NW2B 2HVJA 3DSNA 3GIVB 4OLEA 4UUJA 1YEDB 3D18B 4JDZA 4LNRA 1R5IA 4Z7WB 5LKNA 1N2RA 1IGIL 2YD1A 2JIXB 2AERT 1I3GL 4XPAL 2VLRE 4Z7QE 3CFKB 3VDAA 1H3UA 2X2YA 2WK2A 5KSAC 1GVIA 2R2BB 5JDSB 4QHLA 2A1WL 4ZG1A 4ZUWA 4YFLI 1GL4B 3RVTC 4KH2A 3SOBL 1BQUA 5E6IB 2Y36H 4K8RL 2NTFB 4A2LA 2VC2H 3QQ9C 1IQWH 3RWJA 4WI3A 2WWKO 3MMEA 5HTSA 4MNGE 3QFJA 5E8PB 4OZ4B 7CGTA 2R0KH 4IMKA 1A7QH 1EGJA 3NAAL 3QA3B 4CL7A 4RX4D 1XIWD 4L8CB 5HHXL 3LKSB 5FO7A 4HS8L 4LSVL 4YH6A 4G8GD 1NFKA 2L0DA 1ND0A 4UBDD 3B9KC 1X4ZA 3ULUE 5DJAB 5EFIA 5FO8B 2X4QA 1JHLL 2NMSA 4L8SC 2R2EA 5J06A 3T65A 1CIUA 1OSZB 2YPVL 5C3TA 4OF3A 4ZUVA 4OZGF 2QHRH 1QQDB 4QHUB 1FRGH 1XGPB 5DQJA 3UTTB 2R39A 3OAYH 2WV3A 4CADB 1DUZB 2NZ9C 4IRJC 4P46A 5T1KB 3QRFM 4EXPX 3HFMH 2NXYB 4U0QB 1FLRH 3QYCA 2VDKL 4RQQA 4YUEH 2B5IB 2OSLA 1JK8A 4GW5B 3Q2CA 1RIVH 1KTDA 2PYEE 1RZ7L 1WWAX 3PV6B 3RVVC 2EDOA 5DR5H 1UENA 1WTLA 3OZ9L 1C1EL 3VXOA 2YUZA 1OP3H 3L3JA 1W72H 4A2MA 4PGEA 4HG4K 5J3HC 5L0QC 2WMPA 4PRPD 2VIRB 5D6CA 5KSBE 1Q0YH 2DQDL 3V5DB 4M3KB 4U6YB 1TCMA 4LCYB 4WFFD 1HIML 1U91A 1SM3L 3ARFD 4MQ7A 1AXIB 1UXSB 2C4FU 1G7JB 1Z3GL 3O3BA 4LVEA 5ITFA 5GRJL 4KVCH 3I3BA 1YY9C 5GISL 1FE8H 1YZZA 1JHKH 5C0AE 2R23A 1T0MA 3PQYD 4ZFFB 3WKML 1J0JA 3DJ9A 1OQOA 2NY4D 2R0WL 4X7EC 2WLZA 3FT2A 4KQ3H 2DQCL 1RUAL 4F58H 5C09D 1OT1A 4MNQD 4MXWL 3D69A 5DWUH 1E0OB 2GJ6B 2WINA 1BLNA 2SEBA 4Z18A 2AVGA 2GAZA 1X5ZA 4AT6A 3H42L 3S4SG 1RUPH 4G6JL 2FBJH 3FOMA 1T5XA 1O0VA 5CAYB 4JQIL 3UBXB 3I3DA 4NYLA 3QFDB 2PW1A 4JRYE 1HI6A 4GRLA 1QRNE 3MV7E 3OKOA 4I1NB 4KU1A 3OAUL 3SDDD 4PJ7A 2VKXA 5INCB 3MA9L 4OCYL 5DVMA 1YEEL 4LSDA 1MCSA 5EIVA 3MRJB 3FQTA 4JFQB 3QEQA 3N50A 5I15H 2D4DA 5CS7A 4MCZA 2G75A 1DQDH 4CN1A 4FQQA 1WAAE 3OGOE 1TVHB 4E0RB 1J8HE 3EYUL 5DLML 3FB8A 1FYTE 2E9BA 4LLDB 3TBWB 4CVUA 4HFUH 2DI7A 1IT9H 1KIQB 3U7YL 2ICWI 4F7TA 4ERSL 4OF6A 1EPFA 3I3EA 4PFEA 1H3GA 1TQBC 3MLYH 1JZ5A 3IDUA 3IKKA 5CKAA 5K9JH 1FCCA 5IJKA 5F88A 3EJZD 2Y5EA 1ZGLB 3KAAA 3I75B 4MX7A 1W8OA 2QSCL 5MP6L 3VI4E 1U2CA 1S5IL 1QZ1A 4JCLA 5CBEA 5HPMB 1AY1L 3O45B 3O2DL 3FT3A 2XV6B 1UJ3C 2GK2A 1MELA 3WNKA 3UJJL 1FO0L 4KHTL 3V2AR 4CN6A 3NA9H 3RDTB 2IALA 1D9KB 4P4KA 1ZV5A 4EBQH 2P48B 4J8RB 1G7HB 5A16B 5GGTL 1FDLL 4WV1A 5IHUH 4JEGB 3FB7A 4F15B 3SJVD 2GITB 4NNXA 3MRFB 3UTOA 3EJYD 4UU9B 5EU6A 2APXA 2P8LB 5DT1L 5FGCB 1EJOH 1DBML 5DF0A 4U1IB 5C0IA 2GJJA 1UQSB 4EIGB 3CCHA 1CICC 1QR1B 1QUNA 2XWTB 4NRZB 1Z0NA 2OQJA 5EZLA 1IC5H 4V1DD 2X1WL 4L5FH 3KDMB 4LSPL 5KTEL 2VISB 3GBNL 5CEXA 2YSSA 2I07B 3U82B 3VFUA 4D9RE 3MNVB 1UG9A 1F4XL 3E6FB 4NO3A 2XN9E 2VRAA 1TQCB 2FECI 1DQLH 1PZ5B 1A64A 2FX8H 1FH5L 3QDJD 4OUUA 3INUL 3BEVA 3BO8B 2NW3B 1B0RB 1NMAH 3T0WA 3LKOB 2VR5A 2Q76A 1VFBB 4WU7B 5KSVB 1MCEA 3KLHD 4L4VD 1MCFA 4M5ZL 2AK4A 2G2RB 3LH2L 4ZTPL 5CJOH 2PF6A 5I30L 1IKNA 1EZVX 4OAWA 2VDLH 1N26A 2BNRB 2AABH 2XKNA 5L2KB 4XMPH 5DC4B 3NABH 3TYFB 4MYWB 3VGGA 4YX2H 3DI2B 1JPGA 4JPWL 4R4FL 3FQNB 5KG9B 1FSKC 5B39G 3DBXB 3MBEA 4ONOA 2YA1A 4TUOB 3QUKB 1T66D 4UDTB 3RTQD 1HE7A 4N8CH 3THML 4JQXC 4O02H 4MJ4A 3DVNB 5GJSL 1HHGA 1KXVC 4JREC 4AYFA 5DJ0B 4KK9D 5E8OA 3L3IA 3JVGC 2C1OA 2HLAB 4M7LT 1KELH 2P8MB 2UUDH 3BUYB 3SHSA 1N6VA 3HZVB 5GGSA 4GT7A 4ZUUA 4KPHL 4OZHF 4OM0L 3D9AL 4U1GB 2OYPA 1XGQA 2VLKD 3ARGB 1QVOB 2DQFB 4HV8B 5CMAB 4Q6IA 1Y6KR 3U9PH 1F3DH 2VQ1A 4LASH 1KCUL 4WUUE 4OGXL 3NCJH 3U0TB 4GG8A 5I75C 4JFFB 3W39A 5ESQB 2ARJA 3DURA 4PJDF 1OAKL 1LP9F 5BVPL 2CRZA 3BKCH 1EO8H 5I8OL 1F4YH 2OR9L 1PFCA 5SWSE 3E6HA 2AJSH 1S7WB 4D3CL 1B6DA 3L3GB 1HSAB 4M8QB 3HCVA 4PJEB 1VFOA 3IB4A 5IMMA 4ONFL 1J05A 4EJ1C 5I1IH 3IU4L 4RISH 1IKFL 5IUSA 1AC0A 1NANH 4Z5RB 3HI1A 2FX7H 5GSVB 1KCVH 1OP9A 2ZCLH 3AB0C 1G0XA 2QL1A 1PW3A 4L3CA 5LCVL 3CPLA 1MJ7L 5J12C 4LPYA 4PJAF 4R26H 2IFGA 4R7DA 4HS6B 2PR4L 3SDCB 1BBDL 3A67L 3JV4B 2UZYB 1CD1B 5EO0A 4JZJC 3SGEH 5I1DA 3A6CL 3ZHKA 4G43A 3PDOA 3HAEB 5BMFL 3LQAL 3PL6A 5JOPD 2I9LA 1IGIH 2B8OT 3LRHA 1I3GH 1X5XA 4XPAH 3D85D 4I48A 4N8VA 1HYRC 1JYWA 3LS5L 4U1HA 5ID1A 5IFHL 2A1WH 1MUJB 5K9OB 4I2XB 3BYTA 3CX5K 1K8DA 1CDJA 3BZ4A 2YPKB 3G5ZB 4P2QB 3SOBH 4C83B 2XNAB 1A6ZB 2JCCE 4P59H 1NDGA 3QZWB 4X6EA 5I1CL 4K8RH 1ZWIA 4HSQA 3OXRB 3IJYA 4MLIA 4YDJB 2CDEB 4HKJA 1IFHL 1QRKA 2DOCA 3RWEB 3FRUB 1S7VA 1F2XK 4O2CA 1D6EB 2YK1L 3ZE1E 3NAAH 4CJ0A 2EKSB 5FYKU 3LKPA 5CGYD 5DJZB 5JIKA 2G9HB 5HHXH 1FZMB 3MYJB 2XY2A 4LSVH 3UTSD 4EI5B 3PGCB 2FJGA 2H6PA 4WFHD 1XCQB 2B4CC 5I1GL 1OTTC 1CGTA 5FA4B 2FD6L 4IOFD 5D7LA 3QNZB 3WJLA 4FFVC 2ITDA 2W38A 1PY4A 2VLJD 3SDAC 2HAZA 5M7QA 1A2YB 2YPVH 3D39B 4HLJA 5GSRA 3VI3E 3FONB 5HDOA 1AHWA 4X0KB 4UMGA 1HK6A 5AZEL 1ZHKB 4Y2DC 5HJ3A 4P5MA 3O0RL 6CGTA 4HIEB 1FNEB 3FFCB 5D2NC 3BP4A 2CLZA 2EE3A 3L3KA 4XNQA 1XGUA 4J4PA 3ETBF 2VDKH 1OLZA 3HG1B 5JQ6L 1RZ7H 3ZKMC 2NPLX 2VLLB 4B53A 5LQBL 2O61A 5I66B 3OZ9H 3RGHA 1C1EH 3KWWA 5ESAA 4L3ED 4PBWD 1ES0A 1OSPL 2IF7A 5ACZB 2DQDH 1MCLA 1JL8A 5EO1B 3VU2A 2R29L 1SM3H 3OG4B 3SCMB 3ET9F 1Z3GH 5F7MC 4OLUL 1OW0A 3DARA 5GISH 3QPQC 4X6CE 3WKMH 1AGEB 4YGVB 1FZKA 1RJZA 2DQCH 1FN4B 1RUAH 4AH2A 3O4OB 3GJEB 4POZD 5CP3A 1KJVA 4HZAA 1C5BL 3H9SD 4LRIC 4OCSL 4KJPD 3HA0A 3LKRB 1U8HA 1MF2H 1NJ9A 3H42H 3MGOA 1OB1A 2FYYB 4B5EA 5IKCA 4IJ3B 3CDCA 1MCRA 2VLRB 2PTVA 4N8PA 2OR8A 1Y18A 1K4DB 5ANME 5HHNB 2Z92A 4TSAL 5BV7C 4C54A 2P46B 1C5DA 3IDNA 4H5SA 2VE6A 1ZK9A 3T0ED 3MA9H 4OCYH 5JPMA 3BD5A 3MUJA 1YEEH 3NH7L 4LLMB 3KS0J 4P5TA 5JLZA 4YBLC 3DOSA 2PUQT 1INQB 2E7CA 2HJFA 1FP5A 3IXAA 4OGAD 3RY5A 1E4XL 3FQWB 3EGSB 4L1DA 2FLRT 4Q6YA 4YHIB 1WIPA 4KMTL 3BX7C 2IH1A 1N5AA 3JTSA 5CGMA 1DVFA 3ZDZE 3EYUH 5DLMH 3QIBD 2R56L 4HUWA 2JF1A 4L3AA 3U7YH 5IMOB 3WKNA 5I71C 5HGHA 4N0CC 3PXHA 2ZUVA 3TO2B 1BHGA 2VUOA 5HVHB 4FFWC 1EDQA 2C5DC 2VQUA 3C5JB 2X1XR 4S2SA 3KPLB 5EG6C 4FABH 3AY4C 4D2NA 5C6PB 4MA3B 5AYQA 2OLDA 2EH7L 5DEFA 2FSEB 3DV4B 4YHKH 2QSCH 4EN3D 2E7HA 5MP6H 2OI9C 4RFNB 1S5IH 4HH9A 1HHIB 5EU3A 1QKZL 1AY1H 3O2DH 3V7MA 2FIKB 4HDIB 1FO0H 3OR7A 2FLBT 4K2UL 3UTQA 2P5EA 4FXLA 4HZLA 1QTYT 4IRSA 3OWEA 4KHTH 2X4UB 3MRLB 2MPAL 3N1MC 5A2IH 3AXLA 4H0IA 3CDGA 1ITBB 4NKDB 3RNQB 5EO9A 2R69L 4LLQB 4LHJB 1FDLH 1T22A 5D1QA 5HHME 4H20L 2HVKA 4P57B 5IB2B 2NY6D 5DT1H 1DBMH 2FCBA 3KXFA 4YHPA 4M6AA 5KSBB 3U1SL 1O7VA 4MA1C 4LVNB 2JIXD 3MJGX 4KK8C 2CIKA 2QQNL 2V7HB 4JM2B 5IIEA 4LSPH 5KTEH 1M4KA 1RQ5A 5CP7A 1NUGA 3GBNH 5C0AB 5CEYB 1P6AB 3IT8D 5A3ID 1G6VK 4Q74A 2R0ZL 3MV01 2BNUA 1MIML 1FH5H 3K46A 3INUH 5E6ID 4I13B 3WO3B 4PJ5E 3K1DA 5FGRA 1U2HA 2BX5A 5ERWB 1YPZA 3T0VA 1FFNA 4J6RL 3LH2H 4XBGB 4ZTPH 1M7DA 4PJ8C 4Y4HA 5AYUL 4O9HL 3WJJC 4P2RE 1BD2A 1QRNB 3MV7B 4KJWD 1XR8A 4DVBA 3BN9D 4K8RD 5FGBC 4TVSa 4HAFA 2J8UF 1NKRA 1MCOH 4AG4L 2NY1C 3HZMB 5IVXF 3GMQA 4UT7L 3I6KB 5FGSA 3VFNB 4TNVK 1ADQL 2IH3A 3THMH 5IEHB 4ELKB 3UTZB 4WWKA 1BVLB 5GGUA 2JE8A 5GJSH 2OK0H 1UCTA 4N0UE 1J8HB 2WBJB 4NPYB 3ULSB 1NGXB 1K8IA 1FYTB 1DQJA 3MRBA 4G6FD 5KAQG 4JRXE 4KZEL 1QSFE 2NXYD 1YNLH 4JFEE 3UPCA 4OM0H 3GSRB 4BYHA 3D9AH 1R3KA 5D2NE 3UJIL 4N1EA 3HMWL 3HE6C 3ZYJA 3S4SB 3HKFA 4NC0B 5DEGA 2D3VA 4LSTH 2IPKA 5GZOD 1JGDB 4OGXH 4LMQI 3V6OA 4HIHB 5LWYL 5F7DB 2EEDA 4OZHA 5JW5B 4OFYD 5F72S 1OAKH 1PY9A 4IIQC 1AXSA 2E7BA 2ZG3A 2OR9H 3X17A 5I17A 4NCC1 3WFDL 3SKUD 3B2UC 4F7PB 5KANG 3HC0A 1NC4B 2CIIB 3O41A 3TZVA 5SWZE 4G9FD 1C16B 4DK3A 1A1NB 1W0VB 4FXKA 4FXGB 4ONFH 2VXVL 3OB0H 1BGXL 3AROA 3IU4H 3MCKA 1A9EB 4Y1AE 3ZYZA 4PJDA 1IKFH 1LP9A 4U6HB 3I9GL 5DS8B 3HAEH 3X3GL 4W70A 3HUJF 5IHBA 2GJ6D 3ARDD 1UA6H 5AD0B 4LCIL 5LCVH 1D7FA 4LVOB 4MAYC 3U2SB 1MJ7H 3LKNA 4ODXA 3IJHA 1P4LB 1I1YB 2HLFD 3K1KC 3V6FA 4KFZC 2Z93B 3A67H 4NUGL 1ONQB 3A6CH 4N1CA 1V7NL 5LGKA 2X4RA 4L8BA 3TA3C 2XN9B 3LQAH 1L7TL 1I9JL 4J12A 4UQ3B 5KSAB 1K2DB 1ZEAL 2H32A 1DBBL 2R15A 3MV8E 5EU5A 1SEQL 3TVMA 5B3JF 3QG6A 4ZNEA 3BDXA 5DFTA 3QO0A 1G9NC 1NCNA 1QP1A 5I1AA 5IHZB 3LS5H 3WS3A 4HF5L 1S7QB 3DVIA 3VMNA 5IFHH 1HNFA 3GI9L 2O26U 1B0WA 1YN7A 5HPOA 3FQXA 1CFTB 3IRZA 1HWGB 1P2CB 3O6FC 5I1CH 4QRPB 1JF1B 1CLYL 1EHLH 3TNNA 1AGBA 2N1KA 5IB3B 4GG6A 3EFFB 3MRCB 1KCRH 4WI8A 4QRSB 1IFHH 1FVCA 4MD4B 2XXMB 3HTLX 2YK1H 2BVQB 3B9KB 3X13A 1P7QB 3RWCA 5K9QI 1BFOA 1VKXB 5HGDA 5B4MD 4L8SB 2DQHL 4HH8A 5I1GH 5T5FL 2H9GB 3GSNL 4LSSL 2CO7B 3PWUB 1RK1B 3RWHA 3ILPB 4YHNA 4IRJB 4HWEL 4L9LC 4YHYC 3V0AC 3ZKXB 3ZE0E 3BP6B 4ZPVB 2EIBA 4JPIB 5C0BE 2EC8A 2F54E 1WFNA 3OJMB 4HKXB 5AZEH 3DGGB 5HYSG 3HMXL 4BSWA 3O0RH 3VGAC 4WUUB 3SO3C 3VRJB 4QOKE 3GSNB 3O11B 1XF4A 4M1GL 1LEIB 4K94L 1K3IA 2CO6B 4RMTA 1H5BA 4HD9A 5B39B 1OGTA 5JQ6H 1ORSA 5SWSB 1AD9A 2BC4B 2UYLA 4RGMB 3O3AB 5LQBH 1CQYA 1F90L 1WBZA 3QEHA 1BQSA 4LVHB 4XH2A 4O5LL 5ISZD 3RX8A 3W11C 5E00B 5FECB 1G7LA 1MI5A 1OSPH 4NOBA 2VLMD 5I9QC 4GMTL 2XFXA 1WZKA 5JZ7D 2BXZA 5FKPA 4K55A 3RX7A 5FB8B 3ZE2E 3ALWA 4OLUH 4L29B 5JOEA 1JI1A 4I18C 3WS6A 4ZFOA 3V8OA 3P4NB 1AI1L 3MFFB 2VYRE 1BF2A 2BNRD 3S7GA 3OR6B 3JV6B 5L2KD 4PBVC 2QLVB 2YA0A 3HE7C 1VDGA 1C5BH 2CKBL 4NM4H 4OCSH 2FATL 3MGAA 3N85L 3TT3L 2A6DB 3O9WA 1A47A 4KMLB 4R4ND 4XC1L 3RKDC 1LK2B 4YIQB 3RWDB 3UTPE 4G3YL 2Y6SC 2GTZB 1HH6A 2ADGA 3VMOA 3VFWB 1JF5A 5L9DL 1J1PL 2MCPL 1WT5C 3MUY1 4TSAH 5KVEL 3NIDF 1T80A 5FK9B 2BXYA 4BZYA 1QD0A 3G5VA 1HOCB 3TIDA 3C5SA 2ZPKL 3NH7H 5DRWA 5EWIH 3TBYA 2JCCB 1Z2KA 2EDRA 5LVEA 5C71A 1E4XH 2HFEA 4Y4KD 5F8QC 3LQMA 4WY7H 3ARGD 1ZLUH 5CHNA 4KMTH 2VWEC 3EHBC 3QWQB 4X4YB 3P73A 2M2DA 4KHXL 1QBMH 3IDGA 3V9FA 2R56H 5FM5M 1B0GA 4RAHA 1YUHA 3KPPA 1E28A 4RDQG 2AV7B 1U3HA 3HNTL 4LU5L 1OTSD 4Q2ZB 4R8WL 3OKEA 3V7AE 4KKAC 4JN2A 1AGDA 3ILQD 3LSOA 4EDWL 4KK5C 4OI7A 3C8KA 1JFQL 2BOBB 1MPAH 1UJ3B 2ATPA 3NCYP 3FHAA 3KPNA 2VN7A 1LWRA 1PYWB 4PJXF 4EI6A 1GGBL 2FRGP 2LU4A 3EYOB 4H1LA 4I0KA 4RGOH 3LB6C 1QKZH 4M1DL 4BH8A 4PV8B 2VZUA 4K2UH 5FYLL 3TIEA 3MLPA 2FGZA 1YMME 5JW4R 3U7AA 3ARBA 1F02I 1I1AC 3IU3B 4CW1A 4LSQL 4P9ML 1SY6L 3C6SA 3O8XC 3SDCD 2QQQA 4WNQB 4H20H 3CFIC 4MJ2A 1ACYL 4YJZL 3IAPA 2EH8H 3KYOA 4Z7NF 1S9XB 3WFZA 4FTVB 1VGKB 1ZGLP 1ZHBA 3TNMB 3RNKA 5DJ8A 2ICEA 2CPCA 2DQEL 2QQNH 3G04B 1I3RA 3RWIB 1PX3A 3TLRA 3I02A 2F53A 4FQIL 4K3GA 1K5NA 1KJ2A 2X70A 4PTTA 4X6CB 4Z9KB 3MLXL 2R0ZH 3G08A 4P2QD 3RZWA 4I4WB 1H15A 3Q5TA 4H26A 1BZQK 5LXGL 1UWGL 1A4KB 3FN9A 5DTFA 3DXAA 1VSCA 3OF6D 4LNVA 3QQ3A 1Z6JT 5AYUH 5DJCB 3S9DB 4P4RB 4O9HH 1HYSD 2APBA 5ANMB 4BFIA 1OM3L 5JNYA 5DD6A 4CDGC 3L6FB 1IGML 2WBWB 4M43L 1EAJA 4IOIA 5T3XE 1K9TA 4P2OB 3RP1A 3BPLC 2AV1A 1U8PA 3DX7B 4JREB 4RNRB 4AG4H 4MJ6B 3KPMA 2A6JA 3DECA 4UT7H 1HQ4A 2IQAA 5D1ZC 2I25N 3AGVA 4L4TA 4D0DA 1ADQH 1SMOA 1F6AA 3D39D 1EHNA 2GT9B 4HKZA 5IBUG 5H37H 4WEUD 1MQ8A 4UAOB 1A02N 4MZ3A 2JELL 3C60C 2J8UA 1JN6B 4KZEH 5A43C 1KIRB 3HZKB 1NCWL 5IVXA 4I77L 5D7KE 3FRPG 3UJIH 3S96A 3HMWH 3HG1D 4RZCB 5I75B 3W0WE 5DO2C 4JAMB 3IF1B 5HDQL 1LEGA 1E27A 1A3RL 1FIGL 1CL7I 4OZIB 3O3DB 3TGXA 1SEBA 3SKJL 5LWYH 2O5XH 1I8IA 3DVGA 3PWJA 3SGJA 3GMRB 4M93C 4PJ9C 5IM7B 2D7OA 1QFHA 3SCMD 3WFDH 1KXQE 4Y16C 5BRZA 2X4SA 3TYGL 3CLEH 1IGYA 3KLAB 3P9LB 1XZ0A 4NT6B 3ZHDA 1QSEA 3AB0B 2D0FA 5BOZG 1JNHB 2AEQL 1LILA 2VXVH 1RJYB 1N59A 1BGXH 1MCNA 5HHMB 1IM9D 3GMNB 1LD9A 3I9GH 3X3GH 5C8JA 2CSPA 3VCLB 3KHQA 1S7XA 4LCIH 3JZ7A 4JZJB 3KGRA 3X12A 1JYXA 3WFBL 3UJTH 2ZNXA 5BQ7B 2VLRD 2WUBL 4PRNB 4CU8A 2JLLA 3GSOB 4NUGH 3RI5F 3QIWC 5GRUL 2Z35A 3TCLA 2R4RL 1FGVL 1LK3L 3HUJA 1V7NH 5TJWK 2ZCKL 4DTGL 4MMZC 2IMMA 1L7TH 1I9JH 1WWCA 1ZEAH 1DBBH 5IVZA 3KJ6H 1MCWW 4JFDE 1NGZA 4PJ5B 3CC5A 4U6TA 1I1FA 5DURD 3MCG1 2LFGA 4HF5H 4LKCA 2B4CL 3GI9H 4NQXB 3ULVC 1Q9LB 1YDPB 1UM4L 3MO1B 4HEME 2FJHB 4LLVA 4DAGL 3BKYL 4M61A 4P2RB 2X5PA 4ODUA 1D5ZB 3BPCB 3SDXB 2LU7A 2ESVD 2JK5A 2CLRA 1EBAA 3CFEA 3GJFH 3RVWD 3G6JE 2ADIA 4PB0L 5JUEH 4F9PC 1ORQA 3SKNA 3QNXA 5M95B 4PRBB 4XCNA 3SDAB 2WSKA 1F00I 2XY1A 4YFLF 2GIYA 1WGOA 2CXGA 3T8XA 4F80A 4NQSA 4MZ2A 4Z76A 5T5FH 3GSNH 5D71L 3BDBA 4JRXB 4LSSH 2B20A 3MFGB 1NAML 1QSFB 4NN6C 4Y2DB 2VXSL 1IGCH 4QF1A 3VXNA 3LN4A 1ZS8B 3EZ8A 5DUPL 1DBJL 5D2NB 4HWEH 3V0WL 1YMHB 1FV1B 5BJTA 5C9KA 1JNJA 4KMQA 3MRRB 1H9VA 3GMMA 3DHJA 3ROLA 3HLAA 3IKCB 4PJHB 3HMXH 3S36X 2HKFL 5EBLA 4CNIB 3IDIA 1HHHA 4DQOL 5IB4B 4QRTA 4R0LB 1AXTL 3Q3GB 3D3VD 4O2EB 4I0PA 4M1GH 1IAMA 4K94H 3BVNB 3P0YL 4LCCC 4WHTB 3MC0A 1HXYB 4PRHA 2ZSWA 3QQ4A 3QXDA 3NIGF 3OPZL 9CGTA 5I1JL 4WHYG 1F90H 5IV2B 4JM2D 1A5FL 5B8CA 4O5LH 1G6RL 1BJ1H 2DMCA 4Z7UF 5C0AD 4HJJL 1MCJA 5HHOE 4O58L 4Y1AB 5F9WC 5LGHH 3VD5A 4KJYB 3DGCR 1KFAL 2AP2A 3RUGE 1JGEB 5BV7L 1R3JB 5ACLA 1J87A 1QO3B 1MWAB 4MD5A 5FDWA 4NQCE 1KLUA 3U6RA 5T3ZE 4WFED 2IPTL 5GGVY 4Y5VA 2MQ0A 2KUTA 3MV7D 4KUCF 1TNNA 2CKBH 2B7DT 2FATH 5I8KL 1EV2E 3N85H 4JZNB 3TT3H 5BV7B 3C9NB 1GZPA 5DMGD 4XC1H 3DMMA 4G3YH 4QRQA 2N4IA 3STBA 3RZCA 3BIKA 5L9DH 1WJ3A 1X5HA 1J1PH 4YBLB 5H2BA 4NDMA 4PJGF 3RJQB 1J8HD 2DDQL 3H0TB 4WI4A 2ZPKH 2G5BB 2VR4A 2YA2A 3DX6B 3FTGA 4C56A 3VD9A 1IGJA 4RAUB 5IR1B 4X9HA 2IANE 1HHJA 5IBTL 4JG0L 3QULB 4ISVB 5DK2A 4QYOA 2MQCA 3KPRA 1BECA 3TO4B 2Z4QB 4MDIB 5HYQB 3GB7A 2LE9A 1NCAH 1S3KL 5DGQA 1RUKL 3AU1B 3CVIL 2R9HD 3T3ME 1R3HA 2D03L 2OTUB 4QLRA 3HNTH 4DVRL 4LU5H 4R8WH 3DRQA 4XPBL 3D25A 4TNWF 4EDWH 3VWKA 1S7RA 5GS1B 1NC4D 2YMXL 1JFQH 1CVSC 4PIRF 4KRMB 1MNUL 4F7MB 4ODSL 1MCWM 3W9DA 5C0BB 2F54B 1XIWC 1GGBH 4MNHA 2BY0A 4OLWL 5FEBA 4M1DH 4LIQL 2BVUA 5FYLH 4UBDC 3ZMRA 5DK0A 2E6PA 4DKFL 1XH3A 3GI8H 3MRKB 4HPOL 4YAQB 3WHXA 3L9RB 4LSQH 2NR6D 1OGAE 3BGMB 3HPLA 3BRDA 4MA1B 1SJHA 5ESVB 2CMRL 1TENA 1BOGA 3C6LC 1JMZA 5H94A 4F37F 5MHSE 1ACYH 2R1XB 5J7CC 1CDBA 3BGFB 2X41A 2XN9D 2IFFH 1JJUA 3KPSA 4QXTA 1NGQL 4Y5YB 3GM8A 1VACA 4W68A 4LLYA 3STLA 4X4XB 1HN1A 4D9QE 2FGWL 2DQEH 3F58L 3GGWB 4HS3A 1D5IL 2BK8A 5C0FA 1ED3A 4QHKJ 4S11A 4FQIH 3SGDI 3MLXH 3QQ9D 1KNOA 4KRLB 1U8QB 5HYSB 1T7ZA 3HB3C 3MRGA 5E8EB 5KJRL 3ULVE 1ZLWH 4DWHA 4PJ8B 4QRPD 5LXGH 3ARFC 4YXHL 4XP6L 1NUNB 1HXMA 3QR2A 3PV7A 4JDVA 1GHFL 1VFUA 3B43A 3DX9A 3NZ8A 5IW6B 3QEGL 5C0GB 4WRLA 4JFPA 3VFGH 4R96A 3DYMA 2FO4B 3HPJB 3VFTB 5D2LF 2NY1B 1OM3H 1IGMH 4X6DF 4M43H 1NCDL 4ZOCA 5FV2A 4PJIA 5JW3L 4I3SL 2EC9T 5C0CB 1RZFL 2NY3B 2VDRL 3KYMA 3WN5A 1HDMA 4N8VG 3CU1A 3HE6B 2MWCA 2W65B 2VL5A 4WUUD 2JELH 1ZT4B 1GRWA 2AEWA 3VRIA 5D6DC 1RZKL 1NCWH 4TTDD 1WTGT 3MRDB 1AO7E 1JGUH 3O81A 1QBBA 4AM0B 1G7MB 1GC1C 4AENA 5HY9B 5SWSD 4OQ1A 5HDQH 3DWTA 1A3RH 1FIGH 1I4FB 2EDBA 1VFAB 4IIQB 4YBHA 4A6YA 2Y07L 1BF8A 4ELMF 2YWZA 3SKJH 2B1AL 4XXDA 1Q9KA 4Y4FC 2VUYA 2QQKL 3VH8A 2X1QA 5DRXB 3X14A 5CEZL 4M48L 4JANB 2UWEE 4NZTL 3BXNA 4NNPL 1YMMB 5EC2A 5F1NB 3TYGH 2B2XL 2HG5B 1UZ8A 2BSSB 3L3HA 3FB6B 1PQZA 1R24B 1MJJA 4F7CA 4QNPE 5HGAB 5TH2B 1KGCD 2CXKA 2AEQH 1ETZA 1WFTA 4MAYB 3Q0HA 4QCIA 4APQA 4D9LL 4FQXC 4F2MB 1LEKA 5IGXL 2ZUTA 2XWBB 1F2QA 3IFOB 4BSVB 4PP2A 2F15A 1IVLA 4RFOL 3QO1A 5ENWA 1FL6B 4G42A 5IF0A 2R1WA 1MOEA 3UAJD 3TA3B 1U95A 3FB5B 4HUUA 3F7YB 2PO6D 1KG0A 1ZTXL 3MV9E 3IDJA 4PJBF 1FGVH 5CD3B 3SBWA 4ZOAA 2BVOA 5CWSB 5IOPA 3GMLB 3GSXA 2ZCKH 5FF6A 1J7VR 1MFAL 4BFGA 3JSSA 3DTXB 4UZGA 3B5GA 4QRUA 3CMGA 1JHTB 1QA9A 1MAMH 1MAKA 2GSIA 2FIRT 2A9NL 3VWJA 3TPKA 1FL3B 5FFLA 4ONHB 2FL5B 2OTWB 3LEXB 4Q58C 4PLJC 3T4AB 1MAJA 3QXWA 4GOSA 1UM4H 4GRMB 4UOJA 4WI2A 3FFDB 3BKYH 3R0NA 1XGRB 2Y5TA 1NEZB 4FQHA 1TITA 4KKLD 2F8XC 3TH3T 5TDNB 4R3SB 2OM5A 1XF2A 4HUXA 4PB0H 2BVPA 4JFHE 4C57C 1FNFA 2C3HA 4E5XB 4DZBB 3PNWB 1UB6B 4CMMA 4ZO7A 3WL9A 4N5ED 1G7IB 4YHOL 5DZNA 5M94B 4OZGE 4AIXA 1IQDB 4ETQB