4FHBD

Enhancing dhfr catalysis by binding of an allosteric regulator nanobody (nb179)
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
127
structure length
125
Chain Sequence
QLQESGGGLVQAGGSLRLSCEASGRTFSSYAMGWFRQAPERDFVAVISWSGSNTYYADSAKGRFTISRDNAKNTVYLQMNSLKPEDTAIYYCAAPGRPHGSSWSLNKKGQGYDYWGQGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanistic analysis of allosteric and non-allosteric effects arising from nanobody binding to two epitopes of the dihyrofolate reductase of Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase/protein binding
molecule keywords Dihydrofolate reductase
total genus 30
structure length 125
sequence length 127
ec nomenclature
pdb deposition date 2012-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4fhbD00
4QRQB 4X7TB 5GRZA 4GRMB 4KK5C 3UZQA 1YZZA 1KV3A 3OV6A 3BIKA 1MJUL 5AG9A 3NZ8A 3QRFM 3MRRB 1DANU 2NY3B 4M9PA 5I1JH 1IAKB 1EFQA 5MHSE 4YX2H 3PGCB 3QDGE 3KR3L 2QR0A 3MRBB 4X7DC 1CBVH 1RZJL 4NKIH 5K9OB 3Q2CA 3CSBA 1Q1JH 2XZAH 2HJLA 4OD3L 4OF8A 4FHBD 4FQLL 3SE3C 4C55A 4Q9QL 4QHLA 4U1NA 4LHJB 3GBNH 3ILPA 5GGTH 1J8HE 2HVJA 1DUYA 1DQML 5KVGH 3VE0B 3G6AA 4L4VE 4I77L 3EKCA 4JY6B 1DZBA 2WUBH 1J1XL 1KJ2A 3U0TA 4U1KB 1CXIA 2A38A 4KK5D 2RCSH 1AY1H 4L8SB 1PQZB 1WZMA 1B9ZA 4WWID 5MENA 3S96B 4NIKB 1PJ9A 3MGOA 4K23H 4I48B 2XZAL 3OXRA 2V7HA 2GTZA 3RNQA 1KJ2L 4E41E 3P11H 3MXWH 1LDPH 2AEIT 1KULA 3U79A 3ROOB 4NJAL 3FT3B 1MCQA 5DURB 4PJ7B 2R39A 2FB4H 3LS4L 1IC7L 4CVUA 3QUYA 5LCVL 1A1MA 4ZPVB 1FN4A 1NMBH 4JDTH 4K3EL 5I66A 4JRYD 5D6CB 1KCLA 5FCUL 1JV5A 3FJTA 4ETQB 3TYGH 1I85C 3WFBH 2AAVA 4N8CL 4WHCA 5KVDH 2BFVH 4M6OL 2YA0A 4MZ3A 32C2A 3BPCB 4JFDA 5F96H 1BIIB 4LASH 4A6YB 5I0DA 5GGRB 3X12A 3FQTA 1VCAA 1CXKA 2J5LC 2VITB 1K4CB 2OSLA 1MJ8L 4HGKC 4LLAA 4U1IB 4FQHB 5TQ2H 3ARBD 2QQQA 1MCWM 2XXMB 2HH0L 4CNIB 3MLVL 3IJSB 2AV7A 5E2JA 1T22B 4XNXH 4H5SA 3CSGA 4YHML 5JOEA 4EVNA 4ZUSA 4BKLB 2Z4QB 1Q94A 3RA7H 1SJEB 4NC1E 1MJ8H 3JWDL 4MXVE 1IE5A 4OCMC 3QUML 4AG4L 1M71B 4Y4HB 5MP6H 1YNKL 2FD6L 5TGBA 5J12B 4F9LC 3KYOA 1KB9J 3LMJH 1BQLL 2VE6B 1AE6L 1OGTB 2HT3C 3P0YL 2YMXH 4RBPH 2IGFH 1MI5B 4K7PL 3VRJB 3DX6B 1OSPL 5A16A 1I1FB 5DJ0B 2NYYC 1B3JA 1JI2A 3T4AB 5GZOD 1QHPA 3TJEH 1CFNB 1Q38A 4N5UA 3LEXB 4R7DB 1ITBB 2NTFA 2D3VA 4HMEA 3G5VA 3GHBL 1CS6A 3VXQB 1C5DB 5K59E 2HJKA 3RIFF 2Q87A 5C92A 5KSAB 3HFMH 5JQ6L 4KDVA 4YH6A 2CRYA 1TTUA 4NM4L 1JGLL 4G8GE 4LU5H 4PV8A 3UTTA 3MUJA 3U7WL 4LMQI 4YC2B 3X14B 3G9VA 4QF1B 4TNVF 1UFUA 3FRUB 3N0PB 1II4E 1I3UA 3FB7A 4P23C 2HN7A 3TH3T 3T08A 2ADGB 4OD3H 3TGXA 3GJFA 1JPFB 3DIFA 1DL7H 1CT8A 2Q1EA 3GNML 1OWWA 1AD0A 4FXKB 3FRPG 3D85B 1I7TB 1T1ZB 4YXKH 3ZHLA 1SQ2N 1K2DA 4OLUL 4GLRI 5D9SA 1Q9OA 1DVFA 4ZS7H 3MZGB 5FGBC 1X44A 4NN7C 4Y16B 2VWEE 2DQIL 5HDOA 4CRPA 2BVOA 4UQ3B 5EU3B 2CDFB 1CDIA 1OAZL 1DN0A 3KYKL 3OGOE 5DRWB 3MRCA 1JN6B 2AQ3A 3GSXA 2B5IC 4CN1A 4A2LA 2YC1A 4C83B 1YNLH 4KVCL 1YMMD 4GKSB 4WCYH 3T0ED 3NH7H 2ITDB 2MFNA 5F7YC 3VFOB 4JKWA 1TVHB 3SQBA 4PRAB 3BYYA 2NXZD 3MNVB 2ARWA 3P4NA 2QSVA 4LCUA 4F37K 3K3QA 3BDBA 3I9GL 2VSCA 1RIUL 2JCCE 1MOEA 4MQTB 1F97A 4QRUB 5I1HL 2RR3A 2GSIA 3QXDB 4Q6IA 3HRZA 4N8CH 4DVRL 2FIRT 3DV6B 4RBPK 4YE4H 3ZSSA 4MA3B 3C2AL 3DVGA 1M71A 3KPSD 2LU3A 5C0JA 5MEQB 3HAEH 3SDYH 2VE6A 2WIIA 1ADQA 1FBIL 1QLRB 4MJIE 3T4YA 3LVEA 3NIGE 2GSGA 1UA6H 4FMKA 4JN2A 2OBGA 5HHNB 2BSSB 2EXYC 4X6EA 4ZG1A 1CLZH 3MLXL 4PJGE 1BJ1H 5EOQL 4KRPD 3BQUD 2G9HB 4NQXB 3N1QC 2PN5A 1BP3B 3RVTD 3SCMD 1INDL 4LIQH 4Q9QH 3SDXF 2UY7A 1J5OL 4J1UB 4ZTOH 1WFOA 4LFHG 2ICES 4Y2OA 1KACB 3FN0L 4EUPG 1I9JH 1NAML 4GG6E 2WUCL 3AS1A 3T0EB 3QUXB 1IEAB 4N90E 2IADB 1IC1A 1BVLA 2DL2A 3TVMD 1P7HL 1R0AL 4KDTA 4WFFE 2R0LH 3S34H 3WXWH 5ALCH 1GPOH 3NFNA 3GRWH 5CS7A 3EOAA 1A6UL 3PGCA 1VFUA 3QP3A 2ADGA 4F9PA 4JJ5B 3VFWA 1MIEL 3GHEL 4JFDB 2V2XB 3H6JA 4KXZH 1LD9B 3RWFB 2CIKA 1KF9B 5CIPA 1QOKA 4UQ2A 3HG1B 3MRDA 2NY7L 1EEZB 2SEBA 3D0LB 2EDLA 1RJZA 4Y5VC 2B1HL 2OZ4H 1GC1L 1QO3B 2OTWB 3H3PL 1YN6A 3N85H 3V6BR 3GKWH 4NFBA 1IAII 2YPVH 2J88L 1MWAH 3ZTNL 1YNKH 1WWCA 3PNWB 1UH3A 4HF5L 3IJSA 4X8JA 1J8KA 1FNEA 4U0RB 4RFNB 5E4IA 4IS6A 1ZANH 4GG6A 1N6QL 4PREB 1P69B 2Z0BA 3QIWA 4YHYB 1J18A 1I8KB 3OTTA 4ZYKB 4YAQA 4NO2B 2VN7A 4N1HB 4H1LA 4YHZL 5DJ6B 3STLA 3SOBH 3KPLA 4PJGA 2FX9L 5CILH 4Z95H 3FT2A 1GZPB 3FAXA 5FM8A 3WMSA 4G6ML 4GW1B 3NCEB 1QVOA 1CGWA 2ENSA 2R4RH 4IJ3C 3GSQA 1U8PA 2ADIA 4KTDH 3RTQC 1VFBB 4OZGB 3TBSB 3QNYB 3ETBF 1U8JA 1MRDL 1H5BC 2IMNA 1N59A 2QV2A 5IQ9A 4AY0A 5BRZB 2G75A 5DQJA 3UC0L 3HB3C 4BM7A 4HLZG 5SX4I 5J3HD 1LP9E 5MENB 3AXLB 5CJBA 3RVWC 4DGIH 3BHBB 3S36L 1UKSA 3D2UA 1IC7H 5C7XH 5JNYB 2H45A 1NGPH 3OF6A 5I1AB 1BIIA 2BK8A 1ZXQA 2V17L 2J88H 3TVMA 3BQUB 2MHAB 5HHOA 5C08E 4LDLB 3ARBB 1NC4D 3WO4C 4K7FB 3KPMB 2VZTA 3FONA 4KI5C 1DBBH 3MYJA 4N8PA 3VU2A 4KJWD 5CEZE 1YJDL 3KPRB 1NCDL 4LARH 4P9ML 5GS0H 2MWCA 4LVEA 4M8QB 1BAFH 2R1WA 5CGTA 4OFVA 2IQAB 3MRBA 1NPUA 5GRVL 5KS9E 2UWEE 4JM2B 3O4LE 1X5YA 1ED3A 3PP4L 3NABL 1YPZA 3BEWA 4PJBA 3C09C 2BZDA 3L5XL 2MCG1 3ZKQD 1CLCA 1G7HA 2FEEI 1XGTB 3IAGC 2BNRB 1PKQA 1KLFA 1Q1JL 4X99A 3D18B 4LLVA 4ZDHB 1X4ZA 4JQXA 2HVJB 3UTSE 4ZAKC 1BREA 4EJ1C 1IEBA 1MFDL 2Y06L 4M1DL 1HSAA 4G80B 4K3GA 1HE7A 1P53A 1GGYA 5TDNB 2A0LC 5KVGL 4M8VA 1W0YT 3FN9A 4XP1H 1A7QH 3O4OB 3P9MA 1WBYB 5KOMC 4IEFB 2EDXA 4LLMA 5FV2A 3CVIL 4JDVB 3RWHA 3NFSH 2YBRA 5CCKL 1B0RB 4LEXH 3U9PH 3HMXA 5EPMB 2V7HB 2X5PA 3LKQB 4CW1A 4X9FA 4UNUA 4I3SH 3REVA 3UPCA 4I4WB 5HD8D 2B4CC 1X7QA 3EGSB 4GKZA 3F5WA 4X0KA 5F71A 4OZGA 3KLAA 3TBSA 3FB8A 4TUJA 4X4MA 3C5JA 5HYEA 2PETA 1KJ2H 1YY8B 4LVHB 5C09A 2WIMA 4IDJH 3W11D 4KKBD 3F8UB 3QDMB 1A3RL 3OJVC 4YHPA 2ATKB 1U95A 3TZVC 5A2FA 4K8RH 3QUXD 5D1QD 5E5RB 2Q86B 3OJMB 3WNPA 2GT9B 1U42A 1KJMA 2F53A 2D03L 2EIZA 2EDQA 4Q74A 2GJ6E 3MV9A 1OTSC 1UB6A 2AGJH 3Q6GL 5CEYB 4P9HL 3WIHL 3QIBA 2R0ZH 2GJ6D 2NW2A 4OCSH 5K9JH 2AJ3A 1FGNL 1QRNA 3VFMB 5ESAB 2R8SH 3AAZA 3LQZA 1QO3A 1S7WB 3PF2A 2ZNWA 4LSSH 1FCCA 4BQCA 4WTZG 5FYJE 1SM3L 1KXVC 4ALAL 5D7IE 5IBUB 2VKXA 4XHJC 1JBJA 1CG9A 4ZQKB 1MREL 3AMLA 4GAFB 1JGLH 4LU5L 5HI5C 2P44B 2R9HD 1IARB 2J8UF 4Y4FA 1HKLL 3BP5A 3WKML 3I6GA 1PX4A 1A3LH 2XKSA 1E28B 5E00B 4OZIA 4QRSB 3HR5B 1UXSB 4JZOB 1S5HB 1XF4B 3MV7A 2FYYB 2CKBB 3QCTH 4YE4L 2YWZA 1EAPB 1VHPA 3O81A 5IT2H 4HH9A 4GW1A 2ZJSH 5F6HI 4OFPA 5H37H 3QI9A 1OP3K 5BQ7A 2FBJL 4HC1L 2VLJD 4R96A 3WNKA 4LVOC 2OQJA 3ZE0F 4PV9A 3QDAA 2GTWB 3PWNB 4GRLA 1JPTL 3RWHB 3T0EA 3H3BC 2E6QA 3QZWA 3QA3B 2WIIB 2G75B 2P7TA 3O9WC 4UAOC 1T83C 1H3XA 2CR6A 2VLLB 4NUGL 2DIBA 3TIDB 4BH7B 4ELKB 3O3EB 3HZVB 1E6OL 3VXNB 5JDJA 3O8XD 2OM5A 1OTUC 1EPFA 4LCWE 2WBJD 2OP4H 2G5RA 2EXYD 2NZ9D 1S5IL 3FB6B 3MRHA 5F9AC 5LGJB 4PJFF 3S4SA 5IJVA 2WINA 1QSFA 5CD5D 3QDGA 2EDFA 1ZSDA 1MUJA 4ZFFA 3QEQD 1ND0A 5IVXF 1YEFH 3IJHB 5D7KE 4AL8L 1HWGB 1OAXL 4OD2B 3VI3F 4KVNH 3L3JA 3MUGA 3HZYA 3U46B 4O58L 4F9PC 3BUYB 5HYJA 1IEHA 3CDGA 3CLFH 5D1XA 4KJQC 1I8KA 3X13B 3L3KB 1RZ7H 4NHCH 1BBJA 3PJSA 2IANB 3C5ZB 5C86A 1GAFL 4PJIF 1ES0A 3HI1B 3T09A 4F33A 1CWVA 5GSVB 4MXQD 4LCCC 4NZUH 5D7JA 3WL9B 1YUHB 3HFML 5BS0D 5C0EB 5JQ6H 4M1GL 3P11L 1RVFH 3ZL4L 2XTJB 2N56A 3LIZL 1K6QH 3GO1L 2A1WL 1HOCA 3M17B 5JR1H 1JUFB 1MIEH 2DM7A 4X5XA 2FJFA 4LQFL 5CWSB 2GKIA 2MCPL 1CYGA 5TH2B 4KI5E 3S98A 1KTLB 1CDYA 3JV6A 4HQQL 5C08A 3MRLA 3HPJA 1QNZH 3QIBD 5AYUH 4HPOH 5E8PA 1T04B 2EXWD 4G6AD 3SE9H 5L6YL 4TRPH 1CDGA 4ZUUA 4D0CB 4Y4KA 2Y36H 4OIBA 3JWDH 5GS0C 4IRSC 2AEPL 5HYQB 2R4SH 4NOFA 4RX4D 2QSCL 4HKZB 3SEPA 1U8JB 1A6ZA 3G6JB 4LPYA 5HHMD 5IJKA 2DQEL 3MV7D 4OCNC 7CGTA 4WHDA 4D9QD 5FF6B 4NO3B 3TA3B 4Z9KB 1EFXB 4JG0L 2AJZB 3NFNB 4JO4H 4YWGH 3MLYL 1ROWA 2D0FA 3AXLA 1AHWC 1GZQA 4WIQA 4DN3L 4HQQH 2XZCH 2E9JA 1PSKH 5FB8A 5IOPB 5I1KH 3W39A 5DEZA 1UM5L 4XPBH 4HGWA 1KXTB 4U6YB 3CVHB 2NY1C 3LRSA 3EYFB 3OL2A 4MDIB 5EU7C 1D9KB 1U58B 5IROC 2QLVB 2DB8A 3VWJD 5BRZD 4G8FA 5BOZG 4X98B 4ORZC 4EKXA 1FV1A 3RDTB 2CXKA 5KS9F 3ECBB 3O2WH 4PGDA 3HZYB 3U46A 1KT2A 4LSQH 4AQ1B 5F9WB 3TWCH 1MCOH 4YK4C 3BRDA 3T0BA 1I8LC 2XRAH 3L6FB 4I18A 4NYLA 1V3LA 4HJ0C 1DBKL 2P5WB 4Z7UB 4MAYA 2I5YL 1TJGL 1CGSL 4HUMB 5I6XC 1NGXA 5F3BA 1LE9B 1FYTE 5I17B 4MHHI 4NQEA 3R1GL 5FDWA 4HXBH 4L4TA 5T5NF 4MYWB 5AZ2L 3AREA 1VERA 1WLHA 2VLJE 4WHYH 3QDME 5GSRA 4LSRH 1DL7L 4LVOB 4PRPD 1LO2L 4J3WA 4CKVX 3GMQB 3ULUH 1CK0L 5C8JA 4MQSB 1OY3B 5CHNA 4QNPF 2HKHH 1Y0LA 5KSAA 2GTWA 1JFQH 1RZKC 5A2KH 4RMWA 4P57B 1MCWW 3WFCH 4LLWA 4DKFH 4PRID 4NQEE 1XEDA 1VENA 2VLKE 2ICEA 4WGWB 5HYQA 3S97C 5GRWA 3ULUC 5FM4A 4ENEC 1F8TH 5T3ZD 3O3EA 1KJMB 5I1EH 4P5TC 1OHQA 2NTSP 4PJ7A 4D9QE 2X1PA 1NAKH 3BGFB 3C6SA 1DBBL 4ZNCD 3STZB 2J8UA 4KUCF 2BOBA 3VXTA 3VXSA 1ZSDB 15C8L 4ZFFB 1FL5A 4Y7MA 1BMGA 2VZUA 4Y16A 3TN0D 1X5KA 4OD2A 1KB5A 4BSWB 3Q0HA 4RGOL 2GY5A 3BIKB 1P1ZA 4MXWL 5GGRA 4UNTA 1NSNL 4UU9B 4MA8L 1BQHG 2B0SL 1GAFH 2H32A 3EYFA 4KTEL 2Q8AH 3K1DA 2UYLA 3GIZL 3JZ7A 3QEHB 1FZOA 1G0DA 2Z93A 5T33H 2Y25A 1T22A 1DUYB 4F7CB 2EH7L 3SDAD 1Q0XL 3V0WH 3GJFH 1EA9C 3WFEL 2V5YA 5K9QG 4OF0A 2DQCL 2ADFL 1UB5B 4TSCL 3LH2L 2PO6B 2B8OT 1JGEB 3BEVB 4U1HB 3WYRA 2YZ1A 4JY6A 1A5FL 4M6NL 5TGBB 4I48A 1SVCP 4HFUH 4HIEA 4JG1H 4JJHA 5FA4A 4OLXH 5CJOL 3PIQB 2CPCA 4EDWL 2XG4A 1L7IL 2F54D 2BHUA 3RJQB 3PWPA 2Z35B 5E8PB 3EUUA 4EI5B 2B1AL 1I1FA 4ZUUB 1JMXA 2DJ4A 4G8GA 3RNQB 3JWNC 4R7DA 3IAQA 1HXMA 4MJID 3QUKB 4PB0L 1WK0A 3QEQB 4RCAA 2NY4B 4YXHL 4ERSH 3TNNB 4XNYL 4F7MA 1BFSA 4ONHB 1DBAH 3DVIA 4QRRB 3PWNA 2C3GA 2NCMA 32C2B 3QA3A 4HUVA 3I2CL 1IAIL 3IRPX 4OZFG 4NO3A 2H2SC 3HI6H 3HMXH 4JM4L 1AY1L 1XGQA 2VDQH 3MRRA 1IGJB 5D2LA 1O0VA 4F2MB 3CVIH 4QHUB 5I1LB 3QH3A 1P5VA 4UIMB 2ARJQ 4MLIA 1EJOH 2X4UA 4MXVF 3NACH 3ULVE 5DLML 5TF1H 3Q5YA 1H3TA 3TN0A 4L1DA 3QHTC 4DGYH 5BO1H 3U4EA 1WZ1L 5IKCB 1N7MH 2HJLB 5ADOL 1ZHBA 1E4XI 4XCFL 4OI7A 1WCQA 1XCTB 1J0IA 1U3HA 2HWZL 5D70L 2GJJA 4PRHB 4OD1L 3ULUL 5DQ9B 2A73A 3BPNC 4UDUB 4DWHA 4KY1H 5BS0B 3BZ4A 4JR9L 3VWKA 4JFPB 1MHPH 4P4KD 1JZ2A 2NY6C 3UJTH 3IDXL 2CUHA 4WY7H 3ZDYE 4KROB 5IM7A 1R5WA 3SGJA 3IDMA 3RVUD 1GH7A 3MX0A 5JIIA 5D7JB 3CCHA 2FH8A 4KV5F 1G6RL 2OLDA 2OI9B 3X3FH 1PX3A 5IMOA 1JWUA 3PHSA 3R06B 4CN4A 3ZTJH 1JNHB 5A3IC 1MCPH 2MPAL 3D9AL 4Y8AA 1GYAA 1DP0A 3CFJA 2PO6A 3IYLW 1GOGA 4KI1A 1GC1C 2OZ4A 1BX2A 2B4CL 4PGBB 5LXGH 1DANT 5JPNB 1TFHA 3HZKB 1XMWA 1C08A 4W4OA 1YQVL 4XWGH 1BD2B 5TPWL 2R2EA 4GRWE 3RKDD 4JLRB 5DK2A 3U6RA 2DQEH 2Z35A 3BWAA 5IBLC 4B7IA 4BQ6A 1YEHH 3QBTB 2AXFA 4MJIB 2IH1B 3NCYS 1U8NB 3CFDA 1HHHA 1HHJB 1PZ5B 3BW9B 3EJYD 4XCCH 2CK0L 2Q76A 3IFOB 1F58H 2LAGB 3QQ4B 3HE6B 3KPMA 4RGOH 3WFEH 1MJJB 2F5AH 5LQBL 5IMMA 1N26A 5EZOH 4LRNH 4ISVA 3T0AA 5MHSD 3STZA 4GG6F 3RIAF 1H3PL 1P4IH 2ORBH 4KC3B 1T0MA 3V6OC 1IGFH 1A8JH 1QRNE 3WSQH 4F7EA 3T3PE 2PTUA 1P6FA 2CDGB 4ZO7A 4Y5XB 3HE7D 3C5ZD 5GHWH 2V5SA 4HWBH 1WSST 4HZLB 1TTGA 1C1EL 2IPUG 2ED7A 1KTKE 5ANME 3TH2T 3EZ8A 4J3SA 5DD6A 3AU1A 1XH3B 1JYVA 4W70A 3OKKA 4KHXH 4CU8A 1TVBB 4M5YH 3L9RB 4JPIA 3QFDA 3V5KA 3FRPA 5T5NG 4ZFOA 3I2CH 5ID1B 1NMAH 5SWQA 3QIWB 4OTXL 3O3BB 3T0WA 4NNYA 3JBG7 4G6JL 5EIVA 5I1DA 5FGCE 1L9NA 3CCHB 1F58L 2Z8WC 3G08A 4Z7NE 2LE9A 2W07A 2H6PA 3BI9X 3PIQA 2VLKB 1G7QA 3NA4A 1H3GA 2WBJC 3RDTD 4QRPE 3DROB 2YPKB 2EH8L 3H3KA 1EHLL 1T1XA 5DD1H 5IB1A 1A1NA 1BVLB 5I8OH 1Q72H 1GJIA 1UWXK 1KEML 1GOHA 1SEQL 4PJHF 1KEGL 2HJFB 2GITB 1AFVH 5CGYD 2IADA 1XF2A 2XPGA 1ZLWH 4RZCA 2O61A 1S8DB 2XQYK 4XPHL 4RFEA 1MFAL 3FZUC 3I6LD 5E4EC 5DJXB 2FLBT 3O6FD 2AXFB 4PBXA 1K4DB 5I1LA 5EOCH 4R26L 3BT2H 1EGJA 2P5WE 4Z7UE 4HKJA 3RVVC 4P2YA 4MD0B 1YYLL 3MRDB 2QL1A 1CDJA 4AMKH 3EBAA 2W60A 3ZKXC 2DQJL 4NRZB 4WUUD 5ALBL 2DQTL 4M7LH 3L3OA 5CZXC 3QEUB 4ZPTA 3D3VA 5ELIA 1QFWM 2NX5E 2UWEA 3LS4H 5EO9B 5IUSA 3MJ9A 1T5WA 5DJ2A 2ZUWA 4KVCH 4ZYKA 4W6YB 3LCYA 4UV7L 2NY4D 4N0UB 1J86A 1TCRB 3Q3GB 3VWJA 2ZJSL 5BV7H 5FUOL 2BSTA 4H8WC 3TO2B 1KCSL 3ARVA 5IK3A 1UZ6F 1W72L 2UYLB 2O5XH 4L9DA 2M1KA 4ODTL 5D2NE 5I17A 5I1EL 5LWYH 2BSSA 2IAMA 3LDBC 5A2JH 5DWUH 1MLBB 4HV8A 5IW6B 3S3SA 4DUWA 2R29L 4G3YH 1VKXA 3GMQA 4PS4H 1LEIB 4OD1H 4HIXL 1JYNA 4EQ3A 4OV5A 5DC4B 3GGWA 1NAMB 1IGIH 5DUPH 2XG5A 3PP3H 3TH4T 4OV6F 1GGCH 4C4KO 5BJTA 4KKCC 3PQYB 3SGDI 4ZOEA 1TZHA 4QRPB 4UV4L 3DGGB 2CH8A 4PB0H 4JFDD 1Y18A 3B8YA 1CIUA 2DLHA 2X70A 4UB0H 1T5XA 3HNTH 4OSUH 4I9WE 1RHHB 2R56H 1IGMH 1K3ZA 4P9MH 2P42B 1BWWA 3WN5A 5C3TA 4ACPA 3MBXL 4KGLA 3WNOA 3DOSA 1QFUL 3H9ZA 1I8IB 5IB1B 2XIDA 4POZD 5IVXA 4I3SL 1C5BH 2I9LA 2XN9E 1JPSH 5DGQA 4N0RA 3LIZH 1ZAGA 3VJ6B 1DEEB 3S6CA 5T5FH 2N1KA 1BBDH 4L8BB 1T1WB 3ULVD 1IGML 1ERNA 1YECL 1ND0B 2FJGA 2COQA 5M95B 5AYQA 3V4PH 1KEGH 1SJXA 3OKLA 1PEZA 1F00I 3KGRA 3PV6B 1ONQA 4HS6B 1W0WA 3O11B 5ANMB 1TVDA 1FZOB 5D7JD 3ISWA 5DUBA 1TVHA 1JWMA 4OZ4A 3RVWD 2YD1A 3WKNA 1MQ8A 1GZPA 3ULUF 3KLHC 2HG5B 3MRKA 4X5LA 4ZOCA 4KVNL 1R24A 1KB9K 3PWPD 4G6KH 4B53A 5MERA 3QHFL 1AXSB 1DEDA 2NQCA 4XPGH 2QSCH 5JDSB 3GSUB 5CJXC 2VWEC 2A9NH 2VUYA 4LLQB 4CMMA 1NANI 2FH6A 4XP1L 4R6UA 2DM4A 1UENA 5B38A 3MJ7A 1T7XA 3G6AB 1YC8A 2WV3A 4BK5A 1WBZB 2JK5A 1UWEL 4HS8H 2PW1A 3M8OL 5T1LA 2E5EA 1LILA 1GVIA 2F5BL 4JPWL 5T3XE 3DO7B 4JZOA 1LP9F 1EDQA 1VFMA 4P23D 2V6HA 5F88B 5C08B 4LCWB 2B0SH 2DQFB 4JQXC 4WW2B 1SJVA 2RBLA 1NDGB 1A9EA 3I75A 4KK6D 5DMYA 3KHOA 4PJAE 1URLA 1BD2E 1RZFH 1YEKH 2X4QB 3SO3C 1U91A 3WD5H 2X4OA 4K3HA 4PLJC 1QBBA 4JO1H 2MQCA 3QXUA 1I7ZB 1A6WH 2ZCHH 4LRIA 3ALXA 3B43A 1JHKL 1TNNA 4WEBH 3S35H 3DMMD 4M4RA 1OM3H 4OCSL 3BWUC 4U6HB 1S7TA 1A6AA 2EIZB 2FRGP 4DAGL 3P2TA 2DYPB 1S7UB 5TFSH 3SDCD 1OP5K 3GBMH 3D1MC 3NFPB 1MCHA 1R0AH 1EBAA 3ZMRA 4W6XB 4U6XA 5BW7C 3CVHA 4KRLB 4PFEA 2XKUA 3W2DH 4ZFGL 1SY6A 1Q0XH 4YHLH 1KNOB 4ZAKD 2Q7YB 3GB7A 4X6DB 3BO8B 3RDTC 4ISVB 3MLWH 2D7OA 1NJ9A 1FG9C 3L9RA 1J1PL 3RWJA 4WWKA 5J6HA 1MHHA 2J4WL 2DBLH 3NZ8B 4XAWL 3IGAA 1IZJA 4BSJA 4X6FB 3QDJA 4Z7OF 4YHIB 25C8H 3VRIB 1MCLA 1ONQB 3V4PL 1CGVA 4TVSa 1FFRA 4K94H 2IBZX 3B6SB 1ES0B 4FQ1L 4XP4H 2RQ8A 3WL9A 5C0EA 1S5IH 1MIMH 4EDXB 3F12A 3KYAA 5EORL 2P5WA 4Z7UA 4MAYD 2ZZUT 5I0ZA 3IF1B 2P46B 4YC2C 3RWDB 4DUXA 4YDKH 2DMCA 3MQIA 4KU1A 1RFDH 4PGEB 1CZ8H 2Y7QA 2IQ9L 1HK6A 1UZ8B 4U1GB 3QDMD 1X6NA 1D5BB 4ZOBA 4JO4L 3QQNA 5BQ7B 1OCWL 5C09B 4M00A 4JLRA 4E41D 4YBQD 2NPLX 1P7QB 2LV4A 4XH2B 4QHMB 3ZYJA 4RAVA 5D70H 1AQDB 4QRPA 4IRSD 2AJVL 4I0PD 3OAUL 4ONGH 3FT3A 5FO8B 1H8NA 2YPKA 1HH6A 3MLXH 1ZVHA 2RCSL 3UBXG 3BRGC 2L7JA 1DDHB 4P5KA 3DMMB 1S7WA 4FP8L 1YEIH 2EIBA 2MCPH 2RFXB 4RGNC 5HVGB 5IB3A 2MNUA 5I6XB 5IHUL 4HBQA 2JCCB 2D7MA 4ONGL 4ETYA 1BF8A 2Y1VA 3VXRA 2APFA 4S2SB 1AO7A 3UTZB 4HZLA 1DBAL 2BMKA 1FZKA 2CRZA 3JWOC 5GSVA 4RRPG 3PP4H 1YQ2A 4JCMA 4R90H 4XP9H 5DD0H 3X13A 1IGCH 3DETC 4JZNB 4FQCL 4U1NB 5ECJE 1AC0A 2V17H 4U3CA 3S37H 1E4WL 5ILTL 1OP3H 4MNGB 5FKAA 2A9MH 3ZE2E 2MPAH 1F45A 2PTVA 3LKOB 2UWEB 4HCRA 1L6XA 2EYRB 4WO4D 5I8EA 4XVSH 3WHE1 3DUSA 2PYEE 1FH5H 5B3JF 3UC0H 2VLRA 4UT7L 4YHNB 4BQ8A 4ODVH 3VGGA 4UINH 1LO3H 2GIYA 5DJYA 1IBGH 4AYFA 4Y5YA 5IHLB 3L3DB 2DTML 5I76A 3VGBA 1RQ5A 2PYFB 5AWNL 3MZTA 5C70A 4ODUB 3C8KB 4NQDD 3ZKSD 3NCFB 3ARGD 3VXNA 3WFDH 4GS7C 4JFXA 2GAZA 3GIVA 3EFFB 1P9MA 2JE8A 5E2UL 2NXYB 4DJMA 2MQ3A 1HSBB 4H88H 3SO3B 3SPVB 2YD9A 5HHXH 4WUUA 1J1PH 1CICC 1SYSA 1I75A 2DJSA 4NGHL 3QUKA 3OAYK 2EDOA 1M1SA 4GG8A 3HZMB 5JHDB 3QHZH 4CADB 4MB4A 1U36A 3O0RH 1NL0H 3OB8A 4GH7B 3KXFD 2HFEB 4XVJL 5HJ3B 5ITBL 2IAMD 3VA6A 4K71C 5IT2L 1PLGL 3MNWA 5E94B 3QQ9C 3VXMA 4JFZL 3N50A 1M05B 1FH5L 3HLAB 3QCTL 4RA0C 1F4XL 2V2XA 1FDLH 4J3UA 3NCCB 2VZVA 1A2YA 4TSAH 4NO5B 5HI4C 1MVUB 3RX7A 3VGEA 2AKRA 2FCBA 5FV1L 2J8HA 2OTWA 3QUMB 2Q7YA 4RDQG 3MO1B 5C9JA 3KPOB 1UM4H 2XA8H 3P40A 2P8MB 5BRZE 1PYWB 3FO2B 2GQHA 3RVTC 3SCMC 3MCKB 1B4RA 4X6DE 1FZKB 1WICA 1CR9L 3FO1A 3TFKD 5D7SH 1PKQE 4GRLC 2CKBA 2EKSB 2VISA 3CFCL 3B9KB 5C9KA 2QKIB 4QLRA 4F3FB 4KKLC 1FJ1A 2X4TA 3FQNB 2D03H 1X5HA 4U2YA 1X5LA 2VB5A 3O0RL 3F12B 4D0BA 1HQ4A 3IF1A 1UJ3B 4NRYA 3S4SG 4Q6IB 3ARSA 4L4TB 3JXAA 4L5FH 2AEQH 3NCJH 3CZFA 3QNYA 2CRMA 1XGRA 1WZLA 3WNNA 4X6DF 1J05A 1PG7L 3IDYB 4XPTH 3G6DL 5E8EB 1OARH 2QBWA 3WIHH 4JKLA 2AJXH 2VTFA 5HVHB 3NN8B 2OL3A 4I5BB 3ARRA 2ICEB 4XMLH 5CHNB 5CINH 4AEIH 5IFJB 1QQDB 1A6AB 9CGTA 3NIDE 5AWNH 4OZFB 3H9HA 4P2QA 4L3AA 3CFEA 3C2AH 3JV5A 1J88A 2SEBB 3D0LA 3C6SB 3GJFK 1SMAA 3U1SH 4M6OH 3LDBB 5FO8A 5I1HH 5F9DC 3O6FC 3AREC 3QUXA 2YXMA 1WFTA 3UTPD 2FL5B 3MYJB 3MRFB 3S3JA 4JRXA 3MBXH 4MA7L 3F7YB 4UI2A 3HAEG 4G43B 3MLZL 3FO9A 5E2WH 2JJTA 4F2MA 5BV7C 1VGKB 4U6HA 3E6FB 2PUQT 4HWEL 2H41A 3K8KA 1EK3A 1RIVH 1G84A 2CIKB 2NXZB 2GW5A 1JHTA 2R0WL 5DJ6A 1OD9A 3STLB 4MJ5A 1FGVH 1TQCB 3TV3H 5MERB 3HB3D 1JK8A 2VO5A 4J8RB 5DUPL 3C08H 3RZCC 3WDIA 3OB0K 3GB7B 4XVUD 1DQJA 3S9DB 1I9RL 3BO8A 1FGNH 4PS4L 1A6UH 1N5YL 3P3YA 3X3GH 1RIVL 4F7CA 5IB2B 4IS6B 4W6WB 1DQLH 4Z7WF 4DKEL 2X4PB 4QOKD 1FYHB 5JW5B 1B88A 1T04A 3EDJA 4PRNB 3SE8H 5E2TH 4N9OB 5FUCE 3P4LA 1W72H 2D7NA 3IDJB 4QNPE 4LLWB 1B6DA 2HTLC 1AHWA 4RMSA 2VJXA 1QVOB 4LVNC 4XCEA 4K2UL 4P5TD 4PJFE 1YN7B 3DX8A 5TE7H 2J8OA 3EOTH 3OXSA 1NBZA 4NZUL 4WRLA 2DLIA 2DL9A 1HQRA 4J6RH 5B4MD 3GHBH 3MLTA 4LPXA 2F19H 4R2GC 4G8GB 3U7YH 1AGBA 2P4AB 5HXMA 2APXA 2XQBH 3NGBC 5D5MA 1O5DT 2X1QA 4K9EL 3O8XA 4O58H 1FSKB 4V1DB 3KYNA 1B4JL 4JCLA 3N1GC 3RGVC 2GITA 4U6YA 4O2EB 1D5XA 4GAGH 2V9RA 2ESVD 4GW5B 2FDBP 3S37X 5DRXB 1XF5B 5H37G 3N06B 1MWAB 4OLUH 5ICZA 2C3VA 3OF6D 3BPLC 3SE4A 2DD8L 4ORGA 3NA9L 5D8JL 2OYPA 1VACA 3CFIC 1JP5A 4ZXBB 4Y19B 5I71C 3GZKA 5I18H 1IGTA 1P84J 3WS6C 1ZANL 3HRZB 2AEPH 1MVFA 3VXUA 1VSCA 4O00A 4YK4B 2EKJA 1IGYA 1Q9KA 4PRBA 1NCAL 5DJAA 2QEJA 2VKWA 4KQ4L 1X6LA 3UBXI 4RNRA 1T7VA 1FNFA 2XWTA 3BGMB 5J56B 3VWJC 4K07A 5D1QC 4DVBA 1VA9A 5D2NA 4JFQB 4ZUTB 1QSEA 5F7HA 1S9VA 4LPCA 5AZEH 4DCQA 1VADB 4H25A 3WEXB 2FWOA 3WFBL 1FDLL 3OKMA 1OSPH 4JPIB 5GSRB 3SGKA 3VCLB 2J5LB 2HMID 1HEZA 4K3EH 1I1RA 4LBEA 4ODXB 1MNUL 4UOW0 4HC1A 4XMKL 2EZ0C 2GYSA 4FZEH 1A3LL 5J8OA 5GRVK 3MTRA 4HXAL 3K81A 5D7IF 4X9HA 1FIGL 1OQXA 2EC9T 4M93B 5GGTL 4MVBD 5IEHA 2I07A 1AO7D 3G08B 4P3CL 1RI8A 3LN4B 4KWUA 4XB7A 4RMRA 4ZUVB 2YUXA 2C1PA 3ARDC 4NKIL 1H5BB 3HLAA 5FYJU 3MLVH 1T1XB 4NQSA 3C5JB 3KR3H 3CFDB 2KKQA 5I66B 2FD6H 1AXTH 5GS2D 2VDPH 2A6DB 3FMGH 4PTUB 3HNSL 3OKDB 3SHSA 5E99H 4V1DD 1FAIL 1JE6A 3UTTD 1CVRA 5C0CA 3RAJH 4W4OC 3CSYB 2V5TA 2C3HA 4OF7A 3KJ4C 5ID0B 2FL5A 3TZVD 2QSQA 2X9WA 4XI5C 4J3TA 1IMHC 2BC4A 2F53B 2FX7L 3GM8A 4L3CB 5C0BB 4M6AA 5HGHA 4XAKE 3ZDYF 3RU8H 1HYSC 3AU1B 1FVEA 5E5MB 4IRJD 2NLJA 3Q48A 4PJFB 3QO0B 4WI2A 1TVBA 4NO0B 1NQBA 1TPXB 1FJ1B 2W9LA 2X4TB 5DUMH 1T6WA 3F6LA 3PL6D 3P9WB 5EC1B 4L4TD 2R1XB 3BN9D 4XP9L 5DD0L 5IMKB 5KS9B 1ZHLB 5D71L 1EERB 1YEGH 4HWBA 3T1FA 3ZYZA 4ESKA 4GOSA 3QISA 3FO2A 3UYPA 1XGRB 3LHPL 2P45B 4XPHH 3I6GB 1GPOL 1BFOB 5JW5A 4OFIA 4DW2L 1VDGA 3U0WL 2YD4A 3C8DA 3FO0H 3C6LA 3CDFA 3BKML 4BH7A 3T0EC 3W9EA 5C0FB 3ET9F 2IG2L 4QHNB 3MGOB 4R90L 1F90H 4M3JA 5F1OB 4C57C 2BXYA 4DQOH 1QBML 3DUHA 2IH1A 3VW3H 1D6EB 1JHLL 5FM5O 4R96B 1KCVL 1HINH 1FAIH 2X09A 5FA3A 4LSDA 1J1XH 5E8EA 4J2XA 1MCRA 1S8DA 1F2XK 5D2LB 2ILLA 3NN8A 1NGWB 4UIMA 1XGUB 3BKCH 5I1JL 2A2QT 2HJFA 1A7PL 1K8IB 4JY4B 5KSBE 4X4YB 4J7RA 1HHKB 5E9DA 3R8QA 3MFFA 1AD0B 4PJBB 1A2YB 4UILH 4L9LC 4XBPB 3HE6C 1INEL 3S35L 4YDVB 1HKFA 1S7XB 2VOTA 3X11A 5HGDB 3N1FC 4X7TA 1F02I 4NCC1 2W0FB 3IU3A 3MRIA 1FRGH 1IEBB 1XGYH 4XVTH 5E8DH 1YPZF 2VXQL 3IB4A 3O6LH 5GHWL 2YZ8A 3U4AA 1E6JL 4HUUA 4K3DL 1JNLL 3BP6B 1MRCL 4HK3N 2FIKB 4PY8J 4LGRB 2X1XR 2UZXB 1G6RB 3LKPB 4NJ9H 1S9YB 1MEXL 3VWJB 1T7WA 1BGXL 4DGVL 5EPMA 1NCCL 1NLDL 4HHAB 1CFQA 3WFDL 3QO0A 3ROLB 1QTYT 2CRIA 1CU4L 2GTZB 1YJDC 1HQ4B 4MA1C 1NBQA 2X89A 2HT2C 3FB5B 3MOBH 4G8GD 2FX9H 2G2RB 1R3LB 5CILL 5FGBA 1XCQA 3THML 2APWA 3QCUL 3GFUA 5A2LH 4LKCB 4P5TB 3DUUB 3F65A 3GSVB 2FGWH 4JFFB 3O6FA 4PJGF 3BH9B 4ELKA 3U6RB 4P3CH 5J11B 1YQVH 2ZSVA 3TM6A 4B0MM 3PXHA 3QJFA 5LCVH 3NABH 3C6LB 4PR5B 4QOKA 1J0KA 4ZXBD 5BVJB 4HK3J 5DQDH 2B4CH 1U8HB 1NDGA 2M8XA 4N0YL 2PCPA 5HHPA 4HIIB 1IBGL 3FQTB 3QQ4A 2YEZB 4WUKH 4GLRH 5FGSA 3TPUA 1EZVX 2ITCA 3QIBB 1S9WA 4GRMA 1F11A 5FDYA 3WE6A 1KELH 3L3HB 4F57H 4U6VL 3MV8B 4NRXB 2E8YA 5CSZB 4E9LA 2VQ1B 3P73B 1V8HA 2Y72A 1S7RB 4WY7L 4BZ1H 5EUOE 3VDCA 1NKOA 4PG9B 3TJHD 4YEFA 4PD4J 5DEFA 1ZLUH 2AJUL 5F6IC 5C09D 4OZHE 3VFRB 1M7DB 5C0BD 3LB6D 3LKNB 4X4XB 1FVEB 5F3BB 1QHOA 4MX7B 5C0AB 1HNGA 4YGAB 4YDIH 2EYSA 5BO1L 1AP2B 1CLOL 4X6CA 1OB1A 4HUWA 2R1XA 5KS9A 4Q7DA 3QWOA 4YHOH 2OL3L 2ZKHL 4HG4J 4IMLA 3F7VA 4L9LA 3QCVL 4YHNA 4QHKJ 1ZA6B 5I1CH 2NZ9C 4NC0B 3U9UB 3HMWH 1CDBA 3PWVB 4HHAA 2I26N 3UTSB 1TITA 4Z7OE 1T2XA 1RZJH 4JPVL 4OCWL 2NY2B 1I9EA 4AEEA 2AI0L 1FNGB 3RGVA 1T66C 2F53D 3EO9L 1BLNB 3SCMB 5CJXA 3EDDA 1QR4A 2GAZB 3GIVB 2FB4L 5SX5K 4F7TB 1CTNA 2QQNH 3GKWL 1UZ8A 4PBVC 1UADC 3SBWA 1Z9LA 3OHXA 5J1TC 4KXZI 4K2UH 2YPLA 4LKCA 4P5TA 1LO3L 4OUUB 1CF8L 5DA4A 2HLFC 3MRNB 1TENA 1A02N 3D85D 3HS0B 4XI5D 3CVHL 3KPRE 4TSBL 1I7ZA 3BZDA 3O2VL 4IRSB 3ZO0A 1FFNA 2R2BB 1YNTB 1MAML 3EOAB 3VA2C 4ENED 1K8IA 4OZGF 4JHZA 1HH6B 2OMBA 1KNOA 1HHKA 5E9DB 5EH1A 2X7LA 2HKFL 3E6HB 2X41A 2VZ3A 4X98A 4DK3A 4QRTB 3UTQB 3RZCD 3RBGA 5TDPA 5FYJD 4CN6A 3SDDD 4XNMA 1B2WH 5C0CB 1LP9B 1RURH 4RFNC 4QRUA 4YHIA 2LQRA 1W72B 4NZTH 2VLJA 2OI9C 1FSKC 4UV7H 1CDUA 1WTLA 3MJ7B 1I7UA 1QRND 3JWOL 4PRPA 4L4TE 3AFLA 4UU9A 2AEWA 4X6FA 2Q7NA 1AKJD 4R4FL 1YMME 1KTLA 2LVCA 4ZUTA 2WAHA 3C87A 3SDYL 4AEHH 3U30C 2FWOB 5C1MB 2CUMA 5E5MA 5IB4A 1CZ8L 3A67H 4NO0A 2DQFA 4LQFH 1CXEA 4YUEL 1H3UA 3BT2L 1A9EB 1KCSH 5DZNA 1Z3GH 3S5LG 3WO3B 4YHKL 4ZO8A 5BZWB 3U30B 5E4EB 1C5CL 4XNYH 2XV6B 5E24E 4MQ7B 3AUVA 3QHZL 5FHBH 4PRPE 4QCIA 2A6JA 2WK2A 3E0GA 2KL6A 1JFQL 5CAYB 3D5OF 1CL7L 5IGXL 2FZ3B 1XGQB 2XN9A 1KXQE 3SDCB 2JB6B 3MREA 5I18L 1EGJH 3IDGB 3BDYH 3IFPA 2VL5A 4E41B 5EOCL 1YMHB 1UQSB 5J12C 3MJ6A 5LG1A 1N4XH 3D69B 2IALB 1Q9OB 1ZA3A 1S3KL 5IQ7L 1G9MH 4X7SH 5EUKB 4MQXD 3HC3H 2ADFH 4JZJA 4OUUA 4APQB 3DPBA 4GRLD 4J3XA 4X7CC 4KMTH 1CXLA 1IM9A 5T1MB 3D25B 2ESVE 5C3LD 1S7SA 2ZOLB 5DF0A 3TVMC 4M5ZH 3T8XA 1RUQH 1T4KB 3HUJF 4MCYB 3IJYB 4PJEE 3BN3B 1EH9A 5FYJL 3M07A 2IMMA 4GKSA 3OQ3B 3SKUD 1XF3A 3TPKA 1OT2A 4MJ6A 3VFNB 4M93C 3U4BH 5JORA 2JF1A 3VFPA 3UBXB 3IKCA 5FYKU 4R0LB 3LS5L 3ULSA 1T21A 5FHBL 3HNVH 5KW9H 4X80H 2AXJA 4WV1C 5DHVA 1MLCA 5DS8A 1QACA 1IC5L 4XPFL 3DX7B 4QHLB 3JVGA 3QB7C 3NCYP 2IBBA 1HHGA 4G9FB 4HEPG 2ZUUA 5CD3A 3T3MF 4IIQB 1FVDA 2WBJB 3FFCE 4IOFC 1J11A 5FKPA 5GRYA 3NZHL 3KDMA 4Y16C 4PJ8B 5EFIA 4H1LG 2V5MA 3D48R 3CU1A 2ZSVB 3PL6C 3RVUC 5IB4B 4MJ4A 1FNSL 4Z0BL 4QOKE 1TIUA 1CE1H 5F9JA 5IBTL 1OTUD 2CLZA 1GGIH 2VLKD 1M7IA 1KN4L 4ZOAA 1AHWB 2IBGA 1MCSA 1TPXC 3D39E 4TPRL 2EO1A 1LQSR 5HTSA 4OM0H 5JHDA 2VDLH 5B39G 3UTOA 4XRCA 3P0VL 3OAZH 1JZ3A 3BIAX 1J7VR 4DGYL 5HI3C 3V6ZA 2DLFL 1JGVL 4GQ9L 5HYFA 4OZFA 1U8MB 4RIRA 2H2PD 1MJ7L 3BKJL 1D6VH 4NCDA 1BOGA 3UJIH 1X5FA 3MJ9H 1S9KC 5L2JB 2VXVH 1KJVA 3BJLA 2HP4A 3SGEI 1G7MB 4TQEL 4NNPH 2NZIA 4WI6A 5C0IB 1K4DA 5J57B 3BP7B 4TVPE 4JZJB 4H26A 2NY2D 1DVFD 4ZD3H 2WWKT 2OJEB 1CFVL 3EW3B 4YFLI 3ZKNC 4H20L 4PLKC 2AJ3B 5AAWA 3RJDA 1BEYH 3GSNL 3VWKB 3BAEL 5FUZH 1HHIA 1RIHL 3DUSB 1IGCL 3L3OB 4XNMB 3QUMA 4X5WA 5DD3H 4JFOA 3LEYL 5D1XB 1F6LL 1LEGA 4TQEH 6FABL 3MA9L 2QKIA 4R7NA 4F3FA 2VN4A 4GJTB 3WJJA 3FQNA 1ODAA 5DZOA 4PG2A 3MXVH 3C8KA 1HH9B 4XC3H 5HPOA 5IW1A 1LVEA 4JFXB 1ORSB 4HPYL 4HS3B 2FYYA 2Y5EA 1HOCB 3M17A 5DD5L 3GBNL 4X6CB 2OTPA 1MI5D 1QPXA 1ZKAA 5KAQF 1OL0A 4R3SB 3M1BB 1FPTH 4U6TA 4O51A 2RIKA 5GJSL 3U9UA 3JV6B 4JFFD 4JAMB 1DCLA 1U8HA 4MXWH 3OXRB 3CGTA 2P7TB 3MV9E 1F2QA 5L6YH 4Z77A 1HHHB 1PZ5A 3VMPA 3EYOA 3QJHB 1BQSA 1AR1D 1TJHH 5ADPL 3S5LB 5FOBA 4E42A 4WI8A 1RUKH 1GXEA 2ENYA 3F62A 3NZHH 4LPVA 3MGTB 4P2QB 3QIUC 2UUDK 3QULA 4JM4H 3S35X 4R4ND 1FN4B 1P4IL 2ORBL 3VXRE 3CX5K 1AKJB 3OB0H 1KBGL 4KKAD 4JHAH 3ZHKA 5T1KB 2Z8VC 3F7YA 2PNDA 2XZZA 5IJVB 2P5WD 1VEMA 5HHVH 5L0QC 1BQLH 3B5TA 4V1DE 5JOPD 5DQ9A 5ENWB 1TJHL 5ADPH 1T5WB 5DJ2B 2Q8BL 4GAJL 2K9UA 5FYLH 5D72L 2BOCB 1NEZA 4PRIA 3LS5H 4D3CH 1H8SA 1UEYA 2O5YH 4JPKL 5K9OA 1TXKA 2DQDL 2DQHL 3UZEA 5F1NA 2Q6WB 3ZDZE 2AXHA 1I8MB 1UACL 3MOAL 2VISB 4IM8A 1T1YA 2J1KA 3OKKB 3T0XA 5GS1B 3HC4H 1EHLH 1QRNB 4WI4A 2F58H 3MLSH 4HS8L 4FQ2L 5GXBB 5DURD 3O2DL 3QUYD 3QG7L 4ZUSB 4EVNB 4KTEH 2LAAA 1G7JA 2FO4B 3RY6C 1KB5L 1RHFA 3NVQA 2DWDB 4NKOA 2DQGL 1UJ3A 4NRYB 2X42A 4G9FD 1I85A 1C16B 5HVWA 5D72H 3RY6A 4G9FE 4QXGL 1KPRB 4CW1B 2XI9A 4GRLB 2XKNB 5F7MC 4PJ5B 5KVDL 4QRSA 3VDAA 4XNZC 3D39A 5F8QC 1MEXH 3P4MA 4MNQA 2IC2A 5IBLD 2IFFH 4O2FA 1RZKL 3QRGL 4S10A 1BFOA 1O7VA 4YLQT 5ESVA 12E8L 4TUJB 1JI1A 1SEBA 1ZWIB 3IDUA 1BZ7B 5E6ZA 4K8RC 5D6CA 1FFPA 2JJWA 4OUOA 3UJTL 5EOTB 3ZTNH 3FCTB 3B2VH 1AGEA 3ZYIA 4JQVC 2VXSL 3O3AA 5DJCB 4PJEB 1KGCD 2EDYA 4DUVA 1DLFL 4KK8C 1KJ3L 2ESVB 3VD4A 3IVKB 1BQHB 1R5IA 3TIDA 5F1IA 4GQ9H 5EBWA 1F3DH 4XVJH 4ZNEE 4H1LH 4FFYH 2ZUYA 2NY5L 5IR1A 3V0VA 2FX8H 4JY4A 2VR9A 2A6IA 4X4YA 2VMFA 2EE2A 3GSWA 1RUPH 4GXVL 1ZVSA 5DYOA 1EEQA 2W9DH 4BA8A 4FG6C 2CK0H 3LQZB 3NFPA 2JCCF 5J13B 2K7QA 5DK0A 2FNBA 3C9NB 5BZDB 3O4LD 3K0WA 2DDQL 1VFAA 4ORGB 1YN6B 4D8PA 3VXSB 1DLFH 3KVQA 5BS0E 5IVZA 4X7EC 4LSRL 4WFHE 3GMNB 1SJHA 1AI1H 4EI5D 2B39A 4NWUL 1OCWH 4YBHA 4DOHB 5CBEB 2VSDA 2CK2A 2ARJB 2VDML 4XWOC 4MHHG 3MRJB 5EFIB 2D4FA 1NGQH 4D9RE 4IMKA 5I74B 2RB8A 3MXVL 1KN2L 3B6SA 5LGKA 4MD4B 2JJSC 3BGMA 1A6VH 4G7VH 3INUL 2MMXA 3P4NB 4O2CB 5GIRB 4ODXA 3V95A 3WXVH 5I30H 3RVXD 5K93A 1MFAH 1ORSA 5JLZA 2V2TB 4OLZH 3FB5A 4K55A 5K9KA 5EDXA 5E6IB 3BAEH 1E4WH 3MV9D 3BEVA 1MY5A 4U1HA 5ILTH 5D7IB 4PLOB 5GS3A 3BUTA 1KCUL 3V0WL 4UBDC 2XZQH 3TIEB 3CD4A 1WAAE 4ODSH 4W81A 5D1QA 1KPVA 3QNXB 4BJLA 1RHHA 4O2EA 3UROR 5C0FA 1FE8H 2DYPA 2Z31B 3TT1H 4GUPB 3QCUH 3VWKD 2VZSA 2KH2B 1LO4L 5IVOA 4FABH 3C60A 1NCWH 5F6HJ 2MHAA 5HHOB 4RSVA 1DVFB 5EBLB 7FABH 5FOBB 4KPHH 3ME0A 4K7FA 2YHGA 4D3CL 3NMEA 3V8CA 2VDMH 3CLEH 2FJGB 3NAAH 2EDBA 4NZJA 1NJ9B 3RWJB 1XGPA 3ECBA 4BYHA 5B8CB 5KG9B 1F4AA 3IGAB 2UVEA 4OQ1A 3V6ZB 5EWIH 3WUWG 4Z78B 4URTB 3O9WB 1GGBL 4Z0XB 2ZG1A 3MFFB 1R3JB 4YR6A 1FLRL 3GO1H 5EU4B 4LF3B 2APBA 1CE1L 4NT6B 4Z5RA 1B90A 4MB5A 1WJ3A 4HX1A 1FIGH 1ZHBB 5DHVB 1P4LB 4UTBL 1Q0YL 5DJ8B 15C8H 4H26B 4P5MA 1KC5H 1Q9WA 4L3EA 4PRHD 5IW1B 1I3VA 4JRXE 3WSQL 5CZKA 2GSIB 4PRAA 1C8PA 1CCZA 2P5EB 2QADD 3JUZA 1DTUA 1A9BA 5EC1A 4UILL 4NHUB 1VPOL 4P48A 2OJZL 3LPGA 2H9GB 4NZRL 4YPJA 2YPLE 4RGND 3VD3A 5JPMB 1WGOA 1UB5A 4XMPL 4HMDA 1VB9A 4PJ9D 1IAOA 2XWJB 3SY0A 2E6PA 3P0GB 3WFCL 1R3HB 3QXAB 4LHUA 4MNGE 1WV7T 5T1KD 4EDXA 3RL2B 3OR6A 4YNYB 4ZNEA 2Q3ZA 3U4BL 4ELMA 4NQEB 4IRJA 3WHE0 4GMSH 2EICA 4J1UA 5LJYH 4N0FA 5KANI 1AGBB 3MLSL 3KS0H 2EDWA 4XRCB 3KLHD 3VGAB 1YA5A 5EZLB 3KPNA 4YPGB 3CX2A 2I9LB 1J0YA 1RIHH 4ZODA 4ZO9A 2BRQA 5JW3H 3SBWC 1IEAA 4NCC2 2ATPA 4EN3D 1MCFA 4HEME 2BVOB 4UQ3A 3EHBC 5EU3A 3VXPA 3RWFA 4MQXC 3I6LE 2UVFA 4BFEA 1N5AA 4KROD 4N9GB 5F9OL 4ODWB 5HY9A 3CC5B 3GJEB 4XZUA 5DMKB 5FYKD 4YZFF 3UJIL 2WWKO 3T77A 5EBLA 3L7FA 1B0GB 1KCUH 3H8NA 2Z93B 3GSOB 1XIWA 3BPLB 4NSKB 3T65B 3LSOA 5DR5H 5J89A 2ID5A 3B9KD 2VQTA 4KK6C 3EOBA 4H20H 2VAAB 4J6RL 4AT6A 2AK1L 3T3PF 3D9AH 4LSPH 2HFTA 1YEJL 1C5CH 1KB5B 2E7HA 5ERWA 1Q9LB 3TN0C 4BSWA 4Z78A 5EIQA 5B38B 3OKNB 1F3RB 1J8HD 1GC1H 2AXGA 3DURA 4JFYB 4Q0XL 1PDKA 2HTKD 4RAUB 4FZ8H 1WF5A 4JFQA 2VLJB 1OGTA 4YR6B 1SJHB 3SKNA 4M7JL 3N1PC 2WSKA 3WFHA 4XCFH 4ZTPL 1U8OA 3FQRA 3VXME 3AB0B 3DO7A 5E1HB 4NKQB 4DN4L 5F88A 3T4AA 1LK2B 1H3VA 1T6VN 5FO9A 2E7CA 2YD6A 5F7WC 1G7LA 3DRQA 4PJ5D 1MHPL 5FOJA 2PXYD 1OW0A 1DQMH 1PEWA 4ODBD 1QSZA 1N5YH 5CEZL 4S1QH 1KYOK 3I50H 1OW0C 5SWQB 1I9JL 1KIPB 1TQBC 3VFVB 5AAMA 4LKXB 5C07D 5GGRY 1JRHL 5JUEH 2R1YA 4MQ7A 4M7ZB 2D7QA 2A6JB 2R0ZL 3DUUA 3K2MC 2WLZA 2CIIB 4YBQC 2DIJA 4M61A 5E08L 2BVUA 4QXTB 1T2QH 1ZEAL 5HYIA 4X0KB 3KS0J 2C1OB 2BSRA 2KZ1B 4JN1L 1DUZB 3UDWC 3HUJA 3RWCB 3WE6B 3ARYA 4JFDE 5IMLA 5FYJH 1LEKA 1XT5A 2F9BT 2IALA 2H2PC 1QFPA 1MH5A 4JKPH 3RWEB 1MF2L 4GG8B 2BNQD 4FQJH 4LHQB 4WEUD 4KFZC 4OZHF 4IRZL 4L4VB 3KPPA 2ATKA 5DRWA 3MBEB 3T0EE 5L88H 1S78C 5T3ZL 1P84K 4XTRC 5B8CA 5KG9A 3EDFA 2YD7A 1QPPA 5D96C 3IXTB 4PLKD 1UWGL 5H35B 1U8IB 2AI0H 1AXIB 1RZKH 2MJWA 4HGMA 4PJAB 1INQA 1BBJB 3QWQB 5T33L 2DOCA 3JTTB 5CZVH 5C0AA 1RUQL 2WBWB 1HDMA 3R4DA 1A7OL 2EYSB 1FC2D 5CCKH 1FCGA 2OTUB 4PJHB 2NX5D 2DQDH 1LNUA 1PSKL 5H2BA 1FNSH 5FYKL 3VFTB 2VDPL 3FMGL 3QFDB 5K9KB 4DEPB 2P48B 3UTSD 4ZFOB 2ARJA 4PGBA 1JUFA 4UIKL 5JXAH 2R69H 4LLDB 1KJ2B 1RZ8B 1NAKL 3BH9A 1RZIA 1P2CB 4KI5D 3RI5K 1AQKL 2F8OA 4L8SA 4F57L 3SKOA 1DFBL 3RKPA 3L7EA 1XR8A 4S1SL 3K80A 3PGDB 3D6GA 4IJ3B 1ZWIA 4LAQL 1Z5LB 3FB8B 2Z31A 1CGTA 2VIRA 1EAPA 4F7TA 2C4XA 2YKLL 5FYLL 5JZ7D 1DQQB 3WS3A 2F53E 2Y4SA 1CD1A 1ORQB 1QR1B 3FFDB 3ARXA 4GXUM 4XPAH 2DQJH 3CAFA 5CJ5A 5HHVL 5JW4Q 1L9MA 4FZEL 3C5ZC 5HHME 4U4BA 4ONFH 3DMMA 1LO5A 3UX9B 3QZWB 3Q1SH 3S3PA 5EBWB 1XGPB 4NDMB 4QYOA 3MLUL 3MUZ1 5JOPE 5GRXG 4R4NC 3VXRB 1RAMA 1P4BL 4HXBL 3PE9A 5IKCA 3BPCA 5IHZA 2A83B 1UB6B 1B6UA 5CEYA 4WWKD 2DTSA 5GGQL 1IC4L 3FB6A 3MRHB 5DK0B 1FL6B 3UJJH 5DJXA 3QUMH 5GZND 4EUPA 2EDRA 1QSFB 2BDNL 3MV9B 4Y4HC 3V7AG 4PRDB 1AGDA 3QXWA 3TZVA 2FGWL 1J5OH 3QDGD 3PL6B 5CIPH 3PQYE 5ETUA 1D9KD 3GSRB 3GIZH 1G7IB 1NGZB 4G5ZH 4Y4FB 1G0XA 1E6JH 4HPYH 2IAND 4B7LA 2D7PA 3PHQB 4YX2L 4JFOB 4X7SL 2E9BA 5L9DH 5FO7B 1FRGL 4ZD3L 2C3WA 3L3DA 4PJEF 1MRFH 4HC1H 3IDIA 4EIGB 3OKYA 4TULL 3QPXH 4LCYB 5F7LB 2Y07H 4KRNA 2NY1D 1FLTX 2ICWI 5DD6B 1HDMB 1UXSA 1VFBA 3X3FL 2B1HH 5BCAA 5SWSA 4AJ0A 4UTAH 3LEYH 2PXYB 1HH9A 4KKAC 5I1CL 2DF3A 3ROOA 3DECA 5HYJD 2KZWA 5HPMB 3CZFB 3L1OH 5CEXB 1ETZA 1F3DJ 4QEGA 2ZWLT 3ARQA 2JJUA 2DYPD 3QSKB 4PLJD 4HWZA 4EUPH 3MLYH 4WENB 1LK3H 1PQZA 3X17A 4LLDA 3QDJE 2C7UB 4FQCH 5B22A 2IPUK 1MCIA 4XHJD 3SDDA 1NC4B 2YRZA 3DSFL 5J9PB 5DJZA 1NC2B 2FEDC 3CZJA 5C6TL 1Z5LA 5HJ3A 3EYQD 1ACYL 3BKJH 1UT9A 4K23L 1F4WH 4M3KB 1G7QB 4MWFA 4KK9C 2GT9A 2ITCB 43C9A 2F54B 2VDKL 4Q6IC 4OZIF 3GMRB 4PJ8D 5C0GA 2OL3H 2C1OA 3LV3A 4MDJB 1WISA 4KKLD 1T83A 3FO0L 1LMKA 4Q9RH 4NQSB 2VABB 2WM0A 4ODTH 3QG6B 3GI9H 2E8ZA 4RWYL 2X1OA 3DX9B 5GS0L 4NO0D 1E27A 4AT6B 4NDMA 2I5YH 5T1KA 4KTYA 3VXTB 1LGVA 4LSSL 1ACYH 3OX8B 2VXSH 4WW2F 4PJ7E 1V7MH 2B20A 2E9IA 4OGYL 4L3EE 1MSPA 4JGMA 3MRQA 1G7MA 5IIEA 1YMMA 5F6IB 3CX5J 3FT4B 4PJAA 5DRNA 2X05A 3IKCB 4AIZB 4D9RD 3KAAA 4FQPA 5FGCB 4AH2A 4EN3A 4FA8A 5GISL 4PGDB 1WBYA 3EJJX 2GK0A 1QLEH 4JDVA 5F9OH 2FSEB 1PLGH 2P43B 1KIPA 1KIQB 5H2BB 1MY7A 5D5ME 2ZG3A 3LKQA 4FMFA 1ZLSH 3O6MH 4JFHE 4IIQA 1BFVH 4LPTA 4WO4A 1PD6A 3HC3L 4C56D 5L2KD 5MP6L 2BERA 4V2BA 1UXWB 3V8OA 4MMXC 5GGUA 5ITFA 4XXCC 1RZIB 5BMFH 1QYGL 4QXTA 4ZAKB 3BE1L 3L7EB 2BVEA 3K74B 3BZEA 1TZGH 3V52L 3G6DH 3HHRB 4YXLH 3BMWA 3KWWB 3T2QA 2A6KB 3U0PB 3GMOA 4L5FL 1L7TH 2NMSA 4NN5C 1HXMB 4NKMB 5D5MF 5BMFL 4OGAC 1LWRA 5E8OB 4BK4A 5E8DL 3KPRD 2QHRH 3D39D 3MLRL 5IEHB 3KPPB 3UJJL 1X5XA 4C59B 1WVZA 3TF7C 2CDFA 2VDOH 3AM8C 4GAGL 1MFDH 1WCBA 2Y06H 1AQDA 1P4BH 2UZYB 2ZOKA 2DS4A 4S11A 1KJVB 1MNUH 2DAVA 4XMKH 1I3RA 5JIHA 4HS6A 3GSNA 4S0SD 3JWDC 1U8MA 3CNKA 2EIDA 1INQB 5GJTL 3BYTA 4K3DH 4AEFA 1JHKH 1P6AB 2OJEA 4UQ2B 2NLJB 2IGFL 1OD7A 3VFSB 5L2JA 3D3VB 1RJZB 5ALCL 5C6PB 2H8PA 3BKCL 3ZT6A 5C0IA 1Z9OA 3OKOA 4EI6B 3LMJL 4GRWB 3ZE1F 3O6KL 2G5BA 4FFZH 4L1HA 4X5WB 4L8BA 5HYSB 3RHWK 1FL5B 1KTRL 1P7QD 3UPAA 4PRPB 2QJDA 2E6JA 1WWAX 4N1EA 1EXUB 5F70A 5GQBA 1UYWH 4R7NB 1ADQH 1H9VA 4WFGD 3SKMB 3TJEL 3TBTB 4NFDA 3VDBA 3GHEH 4L3CA 5C0BA 5DUBB 2BY3A 1RK1A 4PP1C 1LK2A 1JPGB 2CLVB 1EO8L 4WU5B 5JXEC 1V3MA 1OAXH 4MAUH 1R3IH 4A6YH 4AL8H 3BKMH 1AJ7L 1PVHA 1DQLL 4HS3A 4MAYB 4HDIB 1T80A 1G1YA 5IQ7H 5C7XL 1NBZB 2IPTL 4E0RB 1MHEB 2XNAB 3RGVD 5CP3H 4N5EC 1CGUA 4QXWA 4XP6L 2GUOB 3WLBA 1F4WL 1K9TA 1U8KA 3LRGA 4RGMC 4NQTA 5C0JB 3E2HC 3ESUF 5DD3L 3AS0A 4Z7NF 1K8DA 1MFBH 3ILQC 1N0XL 2NX5A 5EIIB 4JN2B 4H8WH 4ZAKA 3D85A 5HHQB 3VH8A 4OKDA 1LD9A 2GJ6B 1YNLL 4GSDH 3MNZA 3OBAA 1EEZA 4JM2C 2B7DT 3OKEA 4UTAL 4MNQE 3D2UD 5KSAC 1C12A 3W0WD 4X6DA 4TUOB 5GRJL 3L95B 1CGYA 1EAJA 4P4RB 3RHWF 1WEJH 3A67L 4G9DB 4KK8D 3CH8A 4P46D 2JB5L 2EE6A 1KT2B 4KQ3L 1UH4A 5AD0B 4QHKI 4U33A 1SJEA 5LAXA 1OAKH 2ZOKB 4QY8B 3EOTL 3K8LA 5C0DB 4EIZC 3L5JA 5LGHH 1JRHI 3BJ91 4FTVB 2DBLL 1HINL 8FABB 5E6IC 2YXFA 5I8CA 5MEOA 4LEOB 4FTVE 1NFIA 2NW3A 3NFSL 1QA9B 5IP4A 1MI5A 4LLQA 1N7ML 3EYUH 3PWLB 1PGRB 4NM8L 3VD5A 2G5BB 1FZMA 5CEZH 4AENA 1QFWH 4ZO6A 5AZ2H 5LGHL 4JRXD 2XACC 4HPOL 3SJVB 2NY5H 2A77L 3GMNA 5CFHA 5CBEA 1A9BB 5DSCA 1AP2A 3JSSA 3A6CH 3QYCA 1FO0A 4NHUA 4E5XB 2IBZY 4OIAA 1RZJC 4PV8B 3CMOH 3H42L 5KANG 3WNLA 1IAIH 3B83A 3F58L 3L3GA 1DE4A 2ZUQC 2O5XL 5C0AE 3WLWC 4CL7A 1FNHA 2BVTA 4J4PC 1W8OA 4YBLC 1NDMB 4I2XA 3KLDA 5D1ZD 2EDTA 1OGAD 3RL2A 2NXYC 4X9IA 2YR3A 3MA7B 4D0BB 5IEKB 1RZFL 1JF6A 1MHEA 3MROA 1OAUL 1CFVH 2GUOA 2HVKB 3DROA 4UDTB 1RMFH 2HLAA 5HVHC 3QG6A 1U8KB 1TJIH 4EDWH 5D7IA 1BVZA 3DGCR 4O9HH 3GMOB 2IH3B 4YPGA 3O3AB 5DJCA 4WVRA 5F72S 1OSZA 3P73A 1UCBH 1OAZH 2BVYA 1WQVT 3G5ZA 5EIIA 1ZLWK 4TSCH 5TQ0H 4RZCB 1ZVSB 2ICWA 1GHFH 4YO0B 4OGXL 4OCRL 5DEFB 5IG7B 5JW3L 5DO2D 4FNLL 5CINL 1MJJA 1CFTB 3TA3C 1XR9B 4YHZH 5ETUB 1ZHKB 3KPSA 5F7NC 3DX9A 3VFSA 3PV7A 3QEGH 4N8VG 5MENE 4JFEE 4NRZA 2ZUSA 5FM5M 2VQ1A 5C09E 2DKUA 2FIKA 3QEUA 2R4SL 4ZPTB 5E6ID 3FO9B 1GGIL 2JLLA 2L7UA 3S8WA 1T20B 5HYSA 1D5ZA 1OGAB 3DO3A 4MS8C 4S2SA 1PZUB 2JKXA 1W72A 4DTGL 3F7VB 1KUMA 4L9LB 4RGNE 5I1IH 2VZOA 4OZGE 1HIML 3Q3GA 1I7UB 1J8HA 2OX5A 4JO2H 4YIQB 5TJWK 3TO2A 5HI4D 3LAFA 4WDIB 5I9QB 4HX1B 4ODVL 4U6VH 3ZKMC 5EG6C 1MI5E 4I4WA 3VFRA 3HTLX 5DT1L 3RUGE 3FQXB 4OAWB 3F5WB 2G2RA 3MLUH 4OCYL 4AH2B 4APQD 4NOBA 4EN3B 3LKOA 1ETZB 4U0RC 2DI7A 3SCMA 3IFNH 4MJ2A 1UJ3C 4HWZB 2GK0B 4ONFL 5ID1A 4M5YL 3PWJA 1L0QA 3P9MB 4JO2L 1MCKA 1P9MC 4U1KA 1R3KB 4LLMB 2LU7A 4HXAH 1LDPL 4KUZH 4PV9B 1LHZA 1E0OB 2R9HC 2NXYD 2F15A 5L7XH 2C4FU 5ITFB 2HFEA 1U41A 1WCBB 3TO4A 2PR4L 5E95B 4S1SH 3W5MA 2DIAA 3QEGL 1QBMH 4JFZH 4OLEA 1BLNA 4P9HH 4OLWL 3A6CL 2DD8H 3GSWB 4PJBE 1DDHA 1OQOA 2WUBL 5F7DA 3E6HA 4DZBA 3MV8D 5GZNC 2X44D 3MOBL 2VDNL 1JF5A 2DLGA 3O4LA 3CLEL 1YY8A 1TJGH 2IF7A 5FCSH 4ETQA 1F4YL 4NQUA 5D2LE 1KIUA 3C5SA 2A73B 1MUJB 1IT9H 5IVZB 2XTJD 3C08L 1A7OH 5TF0A 2EC8A 2J7LA 2IPKB 3MR9A 4PY7B 1EEUA 5CUSL 1A7BA 5FHAH 5IM7B 5C0CD 4NNXA 1AGFB 4U3HA 4PJXF 3HR5A 3KPLB 4PJGB 3LKNA 4NO5A 4UOJA 4F8TA 3DETD 4AEIL 4NJAH 5T3ZH 2AKRB 1UVQA 3PWPE 3B9KC 3T2NL 1JNHA 1MCPL 5A1AA 4LSUL 2WANA 4R26H 2Z91B 4NQVB 5E9DD 3TYGL 3VE0A 3QCVH 3VFTA 5DQJB 2ICCA 4HIEB 2UZIH 2XFXA 1AGCB 5CMAB 4G6FB 5DVKA 4JFFA 1AFVL 1J8HB 2OL3B 4I5BA 2F54E 4UB0L 1T0PB 2Z31D 3RL1B 1ZEAH 2BNQB 4MNHB 1SEBB 1QBLL 3BXNA 1F6AA 1BZ7A 4Y88A 2C26A 4YGVA 5KJRH 1DBML 3RNKA 4NKDB 1SYSB 1ZGLA 1B2WL 5I2IA 2FEDD 5D96B 1FGVL 4F37F 1RJCA 2K7PA 3NGBB 3QDMA 1CD1B 1ORQA 1QR1A 4OF5A 4OM1H 1N64H 4QRQA 3BGFC 1KLGB 4LCWD 3GEWB 1WZ1H 4EBQH 4IHOB 1WIPA 1EJ6A 4U49A 2X4NA 4JDZA 2W9EL 4PJ9A 1K3IA 3TO4B 5BVPH 1EHXA 4QYOB 1JF1A 5ISZB 3U48A 4PUBL 1U8QA 4UT6L 2V2WA 1A6TB 1ZTXL 3V4VL 3HR6A 2AQ1A 1J10A 4IDJL 4XCYA 2XA8L 2FATL 3O45A 3I02B 1K85A 3MRMA 4PJXB 3QXVA 3TZVB 1FFOB 1IAMA 1N0XH 4KDWA 1CDCA 5DA0B 2GHWB 5H94A 1CICD 3UCRA 1REIA 3QQ3A 2PO6D 4LL9A 1FO0B 4U1LA 2EDJA 4WV1A 4BZYA 3ARBC 4LEXL 2BJMH 3QO1A 5GGSA 5EZJB 5I74C 4K71B 4I18B 4KMTL 2FBOJ 1SMOA 3VFOA 5EZOL 1WWBX 3WS6A 3ZE2F 4OGXH 1NL0L 5D2NB 1Y6NR 4OI9A 4KMLB 4WWKC 5F9JB 3DHMA 3PWLA 4P2OD 4N1CA 4F7PA 2F5AL 4E0RA 3VXOB 1U2CA 4KPHL 3WN5C 4AENB 4DCQB 4YDIL 4EI5C 2H2SD 3PXJA 4M02A 3MROB 5J7CC 1BD2D 3ARZA 4LMQE 3DV6A 1Q72L 5CD3B 1RV6X 1PG7H 5D1ZB 4WGVB 5C07E 2XTLA 3MBED 4M7KL 2NX5B 4R3SA 5TQ2L 3L5XH 3T04D 3DBXA 3W2DL 4ZFGH 5BJTB 3PGDA 4HF5H 4MA8H 1Y0LB 2BSRB 4Y2DA 4XH2A 4NPYA 1ZA3B 4GRWH 4M61B 3SDXE 2BNQE 3SGEH 3OXSB 4ZUWA 2Q8BH 4Z77B 1MQKL 4NQDB 4Y4FC 4R97B 5IESL 3QUZC 4HWNA 2X4OB 4U7SA 5E2TL 3HUJB 4FXGA 1EO5A 3KXFA 1T4KA 5AZEL 3KPSB 1NMBL 3EOBB 3GI8H 4JDTL 3SE3A 3IJYA 3R0MA 2VR4A 2CGRL 1AE6H 1P7KA 3GMPA 1HHIB 2R0LL 3S34L 1SHMA 4QY8A 3IDYC 3QFJE 4IDLA 4Z7WB 3W39B 5H35A 1ACZA 1S7UA 5C2BH 5AG8A 4NT6A 2HA1A 4KKCD 3E3QE 3VFPB 1JWSA 3ZKND 1NLBL 2JIXD 3V5DA 4HAGA 3GSXB 1MHCA 2EE9A 3P4OA 1U3YA 3MODH 5JDSA 1XIWC 3CJJA 4C56B 1BQUA 5L2KB 5DO2C 2P5EA 3F7RA 5L8KB 1ZHKA 3CK0H 4J4PA 5JXAL 5MEND 5F7UA 3RRQA 1KCRL 3NIFF 3U0WH 3AREB 4PJHA 2X4PA 4Z8FH 4P2QD 5FKPB 1LNUB 2HFFA 1C5DA 5F7EH 3VRIA 1WEJL 1QSFD 3PHOB 3T2OA 4OFYA 1J1OH 1R3HA 2P8LB 3ZDXF 2X10A 3SDAA 4Y4KB 4NJ9L 4YNYA 3VD9A 3FT2B 4PJDB 5C6TH 3PP3K 3V6OE 1FE8L 2CLZB 3GM0A 2CKBL 3DMMC 4P57A 4WO4C 4U05A 3IDGA 2QADC 2YOCA 4XP4L 1RUAH 4OCXL 1H8OA 3G9AB 2GSGB 4K94L 4WW2A 4MXQC 2B2XH 1RULL 5DR5L 3LZFH 1BFTA 4JKMA 3QIWC 2YPVL 1FVCA 3ARDB 3DV4A 4XMLL 4KAQH 3BFOA 3BH8A 3MJ8A 3QDGB 3TP4A 4IOSD 3RWEA 1A4KB 1EVUA 1P5UA 4JFEA 3H9YA 3T8XB 3HA0A 1V7NL 5EU6A 4TNVK 3LN4A 3MV7E 3MYZA 1C7TA 2ZUXA 3OKLB 3BUYA 5DMGD 4XCNB 3LRSB 2A9ML 4G3YL 5JO5A 2E7MA 1NC2D 4H8WL 5GGQH 5JMRA 3S37L 3OAZK 4WHTB 4JRYB 2ITDA 3E2HB 1R3IL 4A6YL 1BWMA 1VACB 2H1PH 4G5ZL 4JG0H 4NWUH 5ICYB 4PJAF 4LLUB 2N7AA 4QXUH 4FQ2H 3C8HA 3KXFB 4BKLA 1JHLH 1AXSA 2VLME 1UC6A 3VI4F 4QT5A 1OLLA 3I6KB 3VXUB 4Z76B 2R0WH 3QWRD 4NQCA 3QXDA 5GRUH 3V5HA 4KUZL 3ABZA 4WJ5A 3RKDC 3C6LD 3HN3A 5AUMB 1OF2A 3I3DA 2XWTB 1NFDB 4P2RB 2W9DL 3UO1H 5KSVB 1N8ZB 2NY1B 5FFLA 1O7SA 4Q2ZA 2PW1B 4KI5F 5TF1L 2IQ9H 2BY2A 1VEOA 3L1OL 4I2XE 2AJSH 3TO4D 1M7DA 2ZCKL 3IXAB 1AIFA 4HV8B 5IW6A 5DT1H 1JNJA 2F5BH 2VXTH 3I9GH 3DSFH 5E8NA 1QFHA 3LQAH 4OZIE 5L8JB 4RAHA 5DDHB 2FR4A 3RWGA 5KZCB 4UTBH 2V2TA 3MPCA 2DWEA 4IMLB 3O9WD 5KVEL 3W81A 1ZA6A 1ZT1B 4HWBL 3AY4C 3U2SB 4DFIA 4G7YH 2NY6D 1J05B 2W92A 4NQCE 2FX7H 4PJDA 5I16A 5CUSH 4BUHA 2Y6SD 3OPZL 5HGBB 1UJTA 5D1QB 3EYSL 4NP4H 3CFBA 4PB9L 5B8CC 2DQIH 3LV3B 3HG1E 3VG9C 4GMSL 1X4XA 5I2IB 4WUUB 4TVPL 1NCNA 2IPTH 4XCYB 4KKNA 4N8VA 4GO6B 2XN9D 43C9B 3SN6N 3R0NA 4G8FB 3C9NA 3FTGB 4P2OC 5BXFB 3GBML 3HE6A 2CDEA 2HT4C 1F11B 3SOBL 4ZMAT 2VABA 4P49A 5IF0A 4Y1AB 3ARGA 5JHDE 4HUNB 2OK0H 3GNMH 2P1YA 4H88L 1ZHNB 4K7PX 4QRRE 1DLHA 4JRXB 2FLRT 1RK0A 1P7KB 3GMPB 3QQ3B 3QEQE 2QSTA 3RI5F 3LKSB 1RMFL 3PHQA 1WUNT 1QYGH 5IR1B 3WFZA 4BFBD 2VXQH 4NUGH 4FS0A 4P59L 4Z0XA 1TQBB 5DHYA 3OJDA 3V6FA 5JHLH 4GRWF 4OLYH 1T2QL 2NY0D 1T03H 1YEKL 4LP4A 4P23A 5KVEH 5CSGA 1MHCB 5EBGA 1OTTD 3GDBA 4EI6A 4RFOL 3JV4B 2PXYA 4HFWA 3ARED 5KSAD 5JIPA 4MA1B 5JTWA 2YA1A 1OM3L 3VH8G 2OR9H 2C4FT 4JANA 3Q1SL 4P2CG 2NNAA 4ZSOE 5D93C 1A7PH 3M8OH 2PYFA 5C0RH 2AK4A 1KIQA 2PYED 1C08B 5HHOE 1VEPA 3WIFB 3G5YB 1A64A 3KHQA 4YBLB 1JTOA 5DK2B 3FL7A 4JR9H 5BVJA 4K9EC 3MCLH 1ZK9A 4EQ2A 3QAZC 1ZGLB 4GUPA 1A7NH 2MTPA 1CXFA 2AJVH 3KWWA 3RA7L 1UZ6E 4HBCL 3BW9A 2N7BA 3BZEB 3SKJL 3TC9A 3CFJB 4MMZC 2BNUB 3D0VB 3TEUA 4IOIB 4LDOB 5ICXB 2EECA 5HDBE 3DHJA 2AGJL 2X4NB 4FQXB 3OHXB 1BD2A 4NRXA 2R2EB 5H8DA 5GGTA 4P99A 3HZMA 5KSBF 1I3RB 4X83A 4YZFE 4Z7WA 4XX1E 2R2CA 4YDKL 1CGSH 1QLFB 4DVRH 3CDCA 4L4JA 2YRPA 4M7JH 2C9AA 1AD9B 2QTEA 3O45B 5SV3A 1QSEE 3PDDA 4A2MA 2OS7A 4NN7B 1BOYA 3PNWA 4AIXA 3ZYOA 3DVNA 4KRPB 3ULUD 2XT1B 4WCYL 3AAZB 5CSZA 2WNGA 2DWDA 3QFJD 4NKOB 3MCKA 3VXUE 2KQMA 1OB1B 1S7RA 3ZE0E 3NIGF 1DLHB 3MO1A 4F15B 3AM8A 4OFDA 1DQDL 3B2UD 1CFSA 5C71A 3O3BA 3IDIB 3KJ6H 2V5RA 4Y5XA 5DVLA 4MD4A 3ULVF 2QQLH 2ZP0T 3CUPA 2QHLA 3O2DA 1FYTB 4M1CC 3REVB 1LO0H 1OT1A 5EUOF 5TDOB 4P2OA 4P23B 1JZ8A 1IKFH 1ULVA 1EO7A 1Z0MA 4QWWD 4EN3C 3EFFA 1BJ1J 3DI2B 2AV1B 4DAGH 3NACL 4LOUC 5D7LD 5LBSL 5T1DH 2J12B 2F8XC 1I4FB 5I8OL 5EU5A 5IV2B 4JANB 4P4KC 2GCYA 4JZJC 2R23A 3QUZA 3OPZH 5B21A 4U1JA 2NY4C 3RWGB 1JGUL 4LCCA 5D7JC 3WV0A 3EOYG 3JUYA 3CXDH 3D3VD 4JPKH 2X6MA 5DK3A 3WD5L 2PCPB 4XBGB 5I19L 4HWEH 1BHGA 1IQWH 2VXUL 4XNQA 4PIRF 2KQNA 5HDQL 2ZPKH 2Q76B 5K59F 2XICA 1F4XH 4AMKL 2C1PB 3EJZC 1IGFL 1NH6A 3GSOA 4HUKB 1KFAL 3MJGX 3RY5A 2OR9L 3VFMA 5CKAA 4JG1L 1U92A 4D0DB 4M48L 3S36X 1NGYB 4M6NH 5HDQH 5IESH 4JQIL 2V7NA 3LPFA 3LD8B 3UTZA 5C0DA 3BZ4B 5KW9L 4WW1B 4DTGH 1NCTA 1YEDB 3BPNB 1XGTA 3P9LB 4QTHB 5DHVH 1MFBL 3DLQR 1BOGB 2ERJB 4K3JH 1FO0L 4WI7A 3FAWA 2NW3B 2GFBB 1CK0H 5FKAB 3TBYA 5J1AB 3V52H 4L4VD 8FABA 1CFTA 4OIIH 4UIKH 1HSAB 5EA0H 4S1RH 5I8EB 3RQ3A 4CUCA 5JMOC 3A6OA 2UUDH 3RWIA 1I1AB 2BDNH 3FFCD 5EO1B 4Z7WE 5T1DL 2D9QB 1YEFL 1VGEH 4UMGA 5HSFA 1J87A 2YS4A 5SWSD 4E5XA 3DX7A 4TNWF 5AUMA 3T1FB 4TYUA 1AJ7H 3L3GB 2PKDA 4HKBB 2AXGB 4JFYA 1SBSH 4DK6A 4OT1H 3MFGB 1U8OB 1RU9L 4NBZB 3RIAK 4Q6YA 5K33A 4BH8B 4NQDE 4MZ2A 5HDLA 2WBKA 3SDXB 1FNAA 1A6WL 2ZCHL 1NEUA 3RTQB 3WUZA 1W2KT 3IFPB 2DMKA 1QLRA 2ZUVA 1UM4L 3K7UA 3KJ4B 3RBSA 3UP1A 4QHNA 2J2ZA 2OMNA 2NTFB 5AEAA 3W82A 5I73B 2VIRB 4LQ1A 4U7MA 4YDLB 1WT5A 2BRRL 3OKEB 1KGCE 3ARPA 1DQQA 2VDRL 2JJVA 3NPSC 2FBJH 4I18C 4H0GA 4MCZA 1MF2H 4LSTL 5ACMA 4P46C 2VXVL 1I1YB 3PQYA 1IM9B 2W38A 1SVZA 4N90D 3EYVA 4BSVA 4N9GA 4YUEH 1JZ4A 1DQTA 2XN9B 4FRWA 4GBXA 2R29H 3BOVA 4LRNL 1A22B 1J12A 1XF3B 5ICYA 1JZ6A 4HAFA 4XNZB 3RPIB 4RIRB 1U6AH 3P0VH 1C1EH 1MPAH 4PG2C 2ICWB 2VDKH 3ZT7A 5DRXA 3OKOB 4IRJC 4GAYB 3CK0L 3W0WE 2DI9A 1MH5B 4TPRH 1U58A 2OTUA 3WNMA 2R0KL 4PJBF 2DRUA 2DDQH 5DMJB 1RURL 4LGPB 3DXAD 3GK8H 3Q5TA 4WJ5B 2BX5A 3CSYA 1BIHA 5CJQL 5E2UH 4F15C 2I25N 5EOQH 1IAIM 2LU4A 4GQPH 1CLZL 1NUGA 2NNAB 2IG2H 3WFHB 1RK1B 1WBZA 3BX7C 2JK5B 3ARWA 1W0WB 2UV3A 5AYUL 1T20A 1QSFE 3KDMB 3VFNA 5LQBH 4FN0A 7FABL 1RZ8A 2XWJA 3TNMB 3MRLB 1S9VB 2CGRH 4NO2A 2YRLA 1IVLA 3IDJA 4RMUA 2AJYH 4IRZH 1NCDH 4LARL 5GRJH 3OKMB 1R24B 4FABL 5HVFB 1NDMA 3GRWA 4XCEB 3ARFB 2I9TA 4TSBH 3RUGA 4HJ0D 3DX8B 1YDPB 2BXZA 3K46A 2XRAL 2DQUL 1D6VL 4POZC 1PW3A 3CXHK 1LE9A 3B2VL 5A16B 1OVZA 1U8PB 2ADIB 1KN2H 5FDWB 3QIWD 3WCYA 3LH2H