The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
124
|
sequence length |
340
|
structure length |
340
|
Chain Sequence |
KPFVPKLVYFEPEALSYPLGKELYEKFTQMGIKIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSSKPSAEYAIPLATGCMGHCHYCYLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAAATSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural insights into recognition and repair of UV-DNA damage by Spore Photoproduct Lyase, a radical SAM enzyme.
pubmed doi rcsb |
| molecule keywords |
Spore photoproduct lyase
|
| source organism |
Geobacillus thermodenitrificans
|
| molecule tags |
Lyase
|
| total genus |
124
|
| structure length |
340
|
| sequence length |
340
|
| ec nomenclature | |
| pdb deposition date | 2012-06-06 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Rossmann fold | ||
| Alpha Beta | Alpha-Beta Horseshoe | pyruvate-formate lyase- activating enzyme | pyruvate-formate lyase- activating enzyme |
