4FHEA

Spore photoproduct lyase c140a mutant
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
340
structure length
340
Chain Sequence
KPFVPKLVYFEPEALSYPLGKELYEKFTQMGIKIRETTSHNQVRGIPGETELARYRNAKSTLVVGVRRTLKFDSSKPSAEYAIPLATGCMGHCHYCYLQTTLGSKPYIRVYVNLDDIFAQAQKYINERAPEITRFEAAATSDIVGIDHLTHSLKKAIEFIGATDYGRLRFVTKYEHVDHLLDARHNGKTRFRFSINSRYVINHFEPGTSSFDGRLAAARKVAGAGYKLGFVVAPIYRHEGWERGYFELFQELARQLEGMDLSDLTFELIQHRFTKPAKRVIEQRYPKTRLDLDETKRKYKWGRYGIGKYVYRDEEAKELEDTMRRYIEQFFPGAYVQYFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spore photoproduct lyase
publication title Structural insights into recognition and repair of UV-DNA damage by Spore Photoproduct Lyase, a radical SAM enzyme.
pubmed doi rcsb
source organism Geobacillus thermodenitrificans
molecule tags Lyase
total genus 124
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2012-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4fheA01
3.80.30.30 Alpha Beta Alpha-Beta Horseshoe pyruvate-formate lyase- activating enzyme pyruvate-formate lyase- activating enzyme 4fheA02
4FHCA 4FHDA 4RH0A 4K9RA 4FHGA 4RH1A 4FHEA 4FHFA
chains in the Genus database with same CATH superfamily
1TFUA 1ZD8A 1E2LA 2ZR7A 3C16C 3RVPA 3WVNA 5FAXA 1XCLA 4MQMA 1YJAA 3I9MA 3DWGA 4W7IA 4UEOA 3IQFA 1CQIB 2FZWA 3E3OA 3ONDA 1ZGHA 1RABA 3BB3A 3TWOA 1G3QA 2O5VA 2YVLA 4ZTUB 1XTUA 3G2PA 4EP1A 2W98A 2ZREA 1QX3A 2RGYA 1YHZA 3TN7A 5CA1A 3K0AB 1PQ4A 4RM2A 3K94A 1PTJA 1Z13A 1L1EA 1PV2A 3K35A 3QVGB 4TMKA 4RULA 3ZU3A 4PQYA 4KYVA 2OZKA 2A9QA 2I4RA 3ETLA 2K6GA 4GH5A 2O57A 4LSZA 2SKEA 4RVHA 4ZZ0A 5J4LA 4ND3A 4WERA 5BMVA 1ZOPA 4IYJA 3CRNA 3KPWA 4WZ6A 1WQ4A 3MWKA 3U56A 3DWFA 4QUIA 1PGQA 1HDRA 5KEIA 3AHFA 1FDVA 3LP6A 5P8WA 4IVNA 1V9LA 1S2LA 3UCFA 4UU1A 1YMVA 1JB9A 2JAXA 2PMEA 2C7VA 2Q3HA 3R5KA 2CXHA 2C2BA 2OOSA 3RIGA 2WHPA 4WBXC 2JVJA 2GO7A 1FP6A 1CY6A 1IOWA 3BSFA 4N12A 2X6RA 2XGJA 2VZ8A 2QVCA 1SY7A 3F6EX 1D6JA 3A11A 3LL4A 3R6GA 2GAFA 2EYQA 3N39C 4IFEA 4RSRA 3TCNA 4D3FA 4ALLA 4EYGA 4FR2A 1GOTA 4PLTA 4ZZ1A 1QTRA 2DB3A 1I0LA 2R6CA 1PI3A 4LZOA 2V5AA 4YMIA 4UEWA 1YZGA 2OD2A 3OF5A 1EK1A 4J03A 1VLQA 5AKZA 3UHFA 2BGLA 2Z8YA 3HCDA 3THSA 4B6OA 4BKRA 4WBNB 4GC9A 2RHJA 3PICA 5LA6A 3ZWQA 3MINB 5CDGA 5LP6B 1LJLA 3JZAA 5LQUA 2XA9A 4KU4A 4R1UA 4GWGA 2Q5QA 2ZJOA 3NXKA 2QI9C 2IITA 5F9HA 4A0RA 1UXOA 5M29A 2GCOA 3VBCA 4XD2A 4C9BA 4U7FA 5IFLA 4QYMA 1HE8B 1ZAKA 1GTL1 2Y1OA 2C03A 1GGFA 1ZGZA 1NQTA 3LQ1A 4MKHA 3D4OA 5GMOA 3RANA 2FRDC 4M1TA 2H06A 2VT2A 4UDNA 3VDMA 2JJQA 2FY8A 4DV5B 5BW6B 3AJRA 1X7ZA 1Q95A 2XBLA 1HDXA 3T61A 3WXBA 3NQ41 1J7KA 5ELLA 3ER9A 2IHBA 2X8JB 3QKSB 1E9BA 1O7JA 4MWDA 1ZWKA 4FYYA 4MB0A 2HNKA 3DFUA 4NABA 3ANNA 1HNNA 3JQRA 3AZOA 4H4CA 1T0PA 4RMHA 5D1NA 3A9TA 3CVYA 2XJ9A 3N5CA 2IHYA 4JX8A 4HFNA 1TW3A 4Q7MB 2YWEA 2KW5A 2CF5A 1E7SA 2NGRA 2QQGA 1EDOA 4DCMA 2J9YB 1TKRA 3OZIA 2J67A 3E81A 1NMSA 4H4DA 3KQPA 3FMVA 3SDZA 3OHMA 4I08A 2ZSHA 2Y99A 2NX2A 4FNGA 4XB2A 2O5EA 3LIIA 3N8GA 4PC2A 5G3ZA 1T10A 3TNYA 2WLTA 1PD1A 1SU8A 3EEIA 3IVMA 4WAUA 3T5CA 4B8ZA 4CWAA 4YV1A 5B2EA 5FUMA 1PJ2A 4MP6A 1YF3A 4Q66C 3GVHA 4AZ0B 4K9LA 5ALJA 4ZXPA 3MBIA 2Q3BA 1B3RA 2WQZA 1RWWA 2YNMC 3GLGA 4DV1B 3CX8A 2DUUA 2WWTA 2AN1A 2GJ8A 2HMYB 2ZPAA 3IJEB 1R9GA 2NPFA 4YUYA 2FZKA 1P2FA 3MZ0A 1TO1E 1PFUA 2ONJA 5HK9A 3WTCA 5EE3A 3GAZA 1YO6A 3NC4A 1FBNA 4HAWA 4ME6A 4U6QA 3ETHA 4LWPA 2BKEA 1W2WB 1NN1A 3SZGA 3F1KA 3G2IA 2PY6A 4FMCB 1B26A 4UAJA 2EWWA 1UAAA 2FXVA 5IT9A 4YCJA 1XEAA 1PNOA 3PVCA 1FFWA 3QE2A 3EGDA 3FFWA 5CPBA 3JQDA 4ONEA 1Y7PA 3EFBA 4K05A 4XIGS 2JGFA 4UUQA 2EGHA 2GAOA 1ECGA 2HOQA 2O2JA 2ZQYA 4W4TA 1TCVA 3OE1A 4XWGA 5FJIA 4AB1A 4ARIA 4Y3UA 3T3MB 2O2EA 2ZRNA 2C9DA 1P1KA 4JEMA 4L4RA 1ZK0A 2CFOA 3N6XA 2EYUA 2WWIA 2KLBA 3MD9A 4MRNA 5DT9A 3KSUA 3OCZA 3KQQA 5FFMA 3F98A 1M5UA 2E85A 1X14A 2Q1UA 3TE7A 2RJOA 2Q3JA 3U40A 1YCGA 1C0KA 1P18A 2D2EA 3W5HA 3O92A 3G8BA 3ZGXA 4OSOA 3FAKA 3L7AA 4OLBA 1Q1BA 1I51A 1VMEA 4YH1A 2WSIA 3WB9A 5B4VA 4X64B 4CL3A 4ZHSA 1I5RA 1O54A 4JXZA 2H48A 1DO8A 1FX1A 1KIFA 5E9QA 3T5PA 4OMUA 3N2GB 3IIEA 4R31A 4YDRA 2TMGA 3DE4X 2CJYA 4BEBA 1Z88A 2G7MC 3PU6A 4CCSA 1UKEA 4LHZA 1SJ9A 4A0FA 3WJ7A 4RW0A 2J5RA 3MHTA 4YROA 1P60A 4H35A 1OHHA 4MQ5A 2I2XB 5DM1A 3UHAA 5IXYA 3TSAA 1BMDA 1X7DA 4MOWA 4MUNA 4AP5A 2W8BB 1EJ0A 1VKOA 2VNKA 3K1TA 2Z9DA 5JIBA 2ZK7A 1V45E 3N76A 3BT7A 1EK5A 3EQ8A 4QPNA 4UMDA 1G5IA 5J2TF 5AW8A 1AKYA 4F12A 4C14A 5JW6A 1LKZA 4WZBA 5CTJA 2QG4A 1XYVA 2D62A 4IDPA 1MN6A 4XASA 3F67A 3WGNA 4AJ4A 1I13A 2PJDA 4DSAA 1SC1A 3R77A 4TMWA 1OBVA 3DEFA 4D3YA 1VRCA 1E6UA 4ID9A 3S2FA 1P77A 2DTXA 3GNLA 4HRYA 2P7HA 1SURA 4WBSA 4GSYA 1BDHA 1OU0A 5KYNA 2ANCA 4CT5A 4B3MB 4KZPA 1RRVA 4DR3B 4OHYA 4TWZA 3P45A 4UU0A 1TJNA 2AJCA 3EJWA 2LKCA 3LYHA 4KEAA 5AI4A 5DF1A 4EX6A 2X77A 2BFDA 2DBRA 3GLTA 1HKUA 3D8HA 5DMXA 3KOWA 2EW2A 5DW3A 3A3NA 3C3DA 4IKOA 1EE9A 1ORVA 1X7XA 1XP8A 2RJ3A 2VAMA 2VK1A 3A6KA 1PJZA 1R0XA 3K2BA 4ZAWA 3Q3CA 4CMIB 2H29A 4QECA 5CXQA 1H85A 5EZQA 1RAAA 5L7YA 1ODFA 4R84A 5BSVA 3KEQA 3OM8A 5TEVA 4HH4A 4RIIA 4B3FX 3KIPA 4UZFA 1FIUA 2BEWB 1Z6YA 2W48A 4MUYA 3ASYA 2BFEB 1KGDA 2I8LA 3BMNA 1EUDB 2N46A 5CT8A 5I4BA 1H23A 1U90A 3UCEA 3ZJVA 2Y6VA 2QV7A 2BUBA 1BXZA 3G3EA 4CMBA 5EFZA 1C4WA 3K1YA 4G9GA 3BF7A 5DP2A 4J0EA 1IUNA 1N3IA 1QIMA 1I4OA 3WAJA 5EESA 4XM1A 2HL6A 4EJSA 3O94A 2A5JA 3UN1A 5MF6A 2FUG6 3B5EA 5DE3A 1DB3A 1T9DA 1ZVMA 1BE6A 1K5DA 4D0LB 2K4MA 5BQOA 3VAYA 3LQ4A 5FT9A 4IILA 3PR1A 5BUSA 2D0DA 2VHZA 2JFFA 2QYSA 1EFRA 3NHAA 5H7XA 3TSCA 5CLFA 2QT1A 5EQJB 1HT3A 3FRIA 1V11A 1RI4A 1OZAA 2DJ5A 1G6KA 2YN4A 4Z0PA 1A8PA 1Q6ZA 2BF4A 1HTWA 4PVDA 1PHRA 1GZ3A 5TX7A 4ZI7F 4FMDB 4GDFA 1XZCA 5EXTA 1GGKA 2B3DA 2GEKA 2JDID 4OHCA 3OIWA 2PZLA 4MWSA 1J25A 1SBTA 1F51E 4LBZA 2HA6A 4FYIA 1N2OA 3FTCA 3LFUA 3RWBA 1EHIA 4DRXA 1OYWA 3BM5A 5ABPA 1LDGA 2F62A 1NASA 2BMEA 2QVGA 4YFYA 3S55A 2VPIA 4JIGA 2W9XA 1CDOA 3IIJA 1BYIA 3HCPA 4RAOA 1EFVB 1XN1A 2R62A 4WESB 3WWPA 5J1TB 2PRZA 2GRAA 3M4NA 4RNCA 4RZ3A 3ZNNA 4PZ0A 3QFFA 4ABTA 1U9IC 4HPJB 4R9RA 2FQQA 2CZGA 1S1CA 3K53A 2QE7D 3JR3A 5CDTA 2MSEB 5BYJA 1GUAA 2GERA 1CP3A 2XYPA 4B82A 1LS1A 3SQXA 4MW0A 4GG1A 3JYQA 3GRYA 4TN1A 5F2KA 3SSNA 3A4VA 5D3ZA 5C1IA 4B2YA 5AW2A 3VZSA 4BPBA 1OYVA 4AL4A 1ONPA 2VAXA 2FLWA 2PS9A 3IEXA 3OZFA 4XTCS 1J23A 3S81A 1T9HA 4TL7A 4JT4A 2PX6A 2GGSA 3N2NA 1W4CA 3IMCA 2BUAA 4MGKR 1M1NA 4YIHA 1NVMB 3QF7A 1ZLYA 2X86A 2HMWA 2PBRA 4RELA 4CNQA 5FNVB 3UK1A 1OFUA 1ZJYA 5IG2A 1CR1A 3MF4A 3OLXA 4JHXA 2OV8A 4C7KA 5C8YF 5KYTA 2QRVB 3W0LB 2QY6A 4DR7B 4K3VA 4PIPA 4B3RB 4ZAGA 1NG9A 3KWMA 1JFVA 3RV4A 5L4SA 2H18A 2WABA 3GUYA 2GEDA 1HDCA 1PD0A 2NZ8A 3AESB 2I34A 3KCQA 4OB6A 3CV3A 3NTQA 2DPHA 4U02A 5KSPA 1ZRSA 2CW5A 3TXYA 3JASB 3W9UA 3C3KA 2ZULA 2OK8A 2PK3A 4JXXA 1ZRNA 2FSSA 3BXGA 4HN2A 4WN3A 2RGRA 2Q0XA 3MYRA 4RKWA 1TECE 1Y8RA 4H1UA 3TX2A 2FJPA 2ZU6A 3Q9LA 2V4MA 1BWQA 2X76A 3A4MA 1PJ8A 3EMKA 3N05A 2BI7A 2FSVC 3HCFA 3HKEB 1GSIA 4HVTA 4PGAA 1ZXLA 3EVTA 3O7WA 1U0EA 3U81A 4RF5A 2WP8J 3URMA 5DYIA 4BUCA 2HJRA 1L5FA 1NBAA 3IAXA 3KHUA 4D5EA 2JLQA 3DCJA 3GFPA 4OQNA 3WYAA 4BXOA 1AG9A 2ZSAA 1RYMA 4MLZA 5JTTA 3CLRC 4BQFA 1VI5A 3NBAA 3PEYA 1ONBA 3SGLA 4B0OA 1XI2A 5KOIA 3U5ZB 4JDUA 2BONA 1MB4A 1LDMA 1W4AA 4N6OA 1UC4B 3AFMA 4S1PA 4H77A 4YRFA 5JHGB 3GEBA 4MW7A 5IDQA 3CB4A 4XOIA 3IKMB 1VCMA 4HP8A 1X8XA 3HJNA 3K70C 3RFTA 5DKFA 3BB4A 1WHTA 4ZHQB 1BDMA 3TOVA 3HU2A 5DCUA 3AIIA 4R1SA 1EVKA 2WWRA 4UBMA 5LXTF 4EG3A 4EA9A 1OFIA 1Y5LA 3CNNA 5EKSA 3A6JA 4P32A 4J07A 4AYXA 1L7AA 2A78A 4DB2A 3HXLA 4PHTA 4Z9YA 1SKYB 4E51A 2QRGA 3PYMA 3ZS8A 4EY3A 3GDHA 3FCSB 3LYLA 4ICIA 5C4GB 2FZGA 2W4IA 3O4VA 6REQA 4WD3A 5K6TA 2AV6A 1KMNA 3H11B 3A05A 1D09A 4HLCA 4HWSA 1BW9A 1PJ3A 2A92A 4BKUA 3HHPA 5J4KA 1GWNA 3RD5A 3P7MA 4YQYA 3PQCA 3L8GA 3SJAA 5J4YA 4NL4H 2R6HA 5HQ3A 2C1XA 3UJ6A 3X1JA 3A1FA 3TG8A 2BFNA 1KYYA 3R0QA 4Y2VA 2WQ6A 2P8JA 3JD3A 3LZ6A 4YT4A 4Q4AB 3HYNA 2ZSDA 5ED4A 3R7SA 3RABA 2XRFA 1OZGA 3BTVA 5EVJA 4D79A 4YO7A 4JASB 3DDNA 3HXMA 1R50A 2XE6A 2XMZA 4EY4A 2A35A 3F8TA 4J6FA 5L3QB 4F38A 2JVIA 3VKVA 4BVEA 1P2UA 4DA6A 1FDUA 3B5IA 2WB4A 3M70A 1WA5A 3LDGA 3SHFA 4ZODA 1DG3A 4L28A 4EKDA 2ZQ5A 4FHGA 4DLNA 4FCVA 1EUYA 2I3BA 2ZIXB 5DX8A 2Q5JA 1W88A 2BDEA 3S68A 3INTA 1R1DA 1BDJA 3A2KA 1QZTA 2J46A 1JVNA 2OQRA 1N2CE 2XVXA 3DE0X 1SUSA 2UVDA 3ISTA 3PXAA 4MRVA 4Q5IA 3B70A 3VMFA 1WB4A 2WC1A 2Q0QA 3CUVA 1E4OA 1F5NA 3LPAA 1ZM7A 3NV9A 5T3UA 4X97A 5E1DA 1IUPA 2YHAA 4LSGA 4MQFA 1ESCA 4HXFB 1MGPA 4CQLB 4TTQA 2AWOA 4DCOA 3D8TA 4NF2A 1J5EB 4JU8A 3AF1A 4V1CA 2WE7A 1T0IA 1R0YA 2PMKA 4Z0HO 4BVAA 1S9DA 1DTWA 3NEPX 3OIDA 1Z25A 3A4YA 4WK6A 3GFRA 2BW0A 4PV7A 4BGUA 1MC1A 3L7NA 2C31A 2PGAA 4QSHA 3DVAA 5A4IS 4ENWA 4CQMD 2V7EA 2XF8A 2OBFA 5LZ9A 4QXRA 4Z4EA 2EBFX 2J3DA 3PEFA 1W4BA 5ALZA 3D1JA 3ZN2A 1Z5UA 4EG7A 4D9FA 5EWMB 4X3OA 2AVNA 1MO5A 1ETUA 4EW6A 3EYWA 2AFRA 5DXJA 3B9QA 3HB4X 1V8PA 2WV9A 4RK1A 4TTPA 4KXUA 3SF0A 5JS6A 1C9JA 3FNIA 5BNZA 4W8OA 1OREA 2X15A 2J0SA 4LHVA 1VLJA 3RW9A 3HWWA 4MRSA 5EIXA 1YZVA 3OUZA 4WIAA 2LPMA 5T4FA 1CJCA 2FWJA 2ZS7A 4S05A 2PH1A 1CU1A 2WVHA 3MQ4A 2NZ2A 3ND6A 4KI7A 4ZT3A 2PS3A 2VF4X 1YIOA 4RE6A 5CLLA 3UA4A 1BS1A 1Y98A 2RC5A 3FYUB 3KLPX 3RF6A 5AW7A 1DIRA 1OF1A 1RMYA 1XZBA 2XNJA 4JYCA 1GZDA 3PWKA 4AQ7A 4CLRA 4CM4A 1FDSA 4D6XA 3V8PA 2R1VB 5B1IA 3U1BA 4JUIA 2VTKA 2P65A 3WXMA 1D9XA 1PGJA 2QNIA 4XGQA 5TNXA 1ZL2A 3L0ZA 4ZAYA 5AKHA 2IYZA 3EZXA 4GGOA 3MCTA 2W2KA 3F4BA 2JJ1D 2HK7A 4C78A 2EG9A 1XLTA 2WIJA 5BOSA 4ZIRB 1SOVA 2CV1A 1LLFA 1PT8A 4EW3A 3G0BA 1FB5A 3HDJA 4NULA 1FFHA 1T6XA 2AA3A 4TV9A 4AF6A 3Q3HA 5ITZA 3NEAA 1KFBB 2IELA 2QRKA 4L0CA 2Z8XA 2Q9UA 2VPZA 4W5NA 1GD1O 2AG0A 4LYDA 1J2UA 5LC1A 1BXRB 1XJCA 5L6LB 2VNJA 3S7ZA 1DC3A 3AXTA 2YJ3A 3CLUC 1E3TA 2GUGA 3PWSA 4B6QA 5ICEA 4JYZA 4JVSB 2BSQA 1RKVA 1SUDA 2CDNA 1QQ6A 3MMNA 2H1VA 2P5UA 1T9KA 1YE3A 3WMRA 3CEHA 4BTVA 2BGKA 3VAAA 4X85A 1YZLA 2JDIA 4FNAA 4F91B 3L0YA 1UINA 1JHYA 4W9NC 5BQFA 1XFAA 3MMSA 1CBUA 5K3FB 3X43A 4DE5A 3EIFA 1M8PA 4F72A 2PXHA 1YBHA 3DMDA 2O4UX 3N0TA 2IPMA 1FDTA 1BMQA 1ENYA 1P4JA 3VDQA 4AM8A 1ONOA 4ZZ3A 1XEFA 2FWRA 4UOZA 1F60A 1I3LA 2GEJA 4V0LA 2FPPB 3V7NA 4Z9BA 4AS2A 4D25A 1FOEB 2VBCA 3OZSA 4LOJA 5G40A 3OEHD 2CL5A 4YREA 5CXUA 2Q5EA 3VQTA 1TQHA 3UUWA 4D44A 1BU5A 2QAIA 1XD9A 1MPXA 1QYIA 2FR8C 1FRQA 2JJ2D 2PPVA 3E7XA 3IMKA 1ZDMA 1IK6A 2D8MA 2QE7A 2TMKA 3KNZA 4BGIA 5KTSA 1UFKA 5LUAA 4B6GA 1S8AA 1TZCA 1I4DD 3I6QA 4NQRA 1OUMA 2P6PA 3KP1A 1F12A 1M75A 4YUAA 3DZJA 2IQ5A 4LPKA 3RTDA 3T1OA 3ZE8A 1Y7TA 3A6GA 2QD4A 3L7DA 5H80A 1U1DA 2BP7A 3BUSA 4GL2A 2YQZA 4OO3A 3OFJA 1VA5A 1R8JA 1RIIA 2CBXA 2O48X 4HADA 5B37A 3W3ZB 2IH5A 3VX3A 2YV3A 5FD8A 2YC2C 3UWKA 3VM6A 2Q3DA 1Q84A 1PO7A 1W46A 5CHYA 3B3AA 3PE6A 2RBKA 1V16A 2B78A 2B6HA 3QXXA 1NURA 1Z62A 3R3ZA 5THXA 5DDIP 2HLNA 3EPKA 3IIKA 1VGVA 1ADBA 3GO4A 4PG8A 5LD2B 4GPTA 2ZS9A 4LI3X 2R44A 4RWZA 4P58A 1P0MA 2X3YA 4Z7QB 4NKRA 5BNWA 3UVEA 3L82B 4MYHA 4NRDA 1VJTA 4ED9A 5J47A 3TPCA 1TLFA 1Y3DE 3DPIA 3K2IA 3K73O 1Y5NA 5BSRA 2PGXA 2DSTA 3BMCA 3KWFA 2MYPA 4L9RA 2RCNA 3GBSA 4NNPA 1B8UA 1MAUA 1SOAA 1YGPA 3EVNA 3A06A 3O2JA 4C03A 4EHAA 3T9AA 1I4LD 3GHHA 4DMMA 5KWVA 2O54A 3CU5A 4RPLA 1CY4A 1JS1X 3FSEA 5TB5A 1Y5RA 3CSUA 2ZRGA 4XQEA 3NHLA 3ZQKA 3ANLA 4EJMA 3C6YA 5JVDF 2RHOA 2ZBDA 3MJCA 4WFQA 4J7AA 1GRNA 2VF8A 4A0SA 2YRFA 2DTEA 2L82A 4OFBA 4I2NA 2PE5A 4BO1A 2EX4A 2Y0BA 3GUVA 4RY0A 1NQOA 3BF8A 3RVLA 5GIOE 3DMYA 2O3JA 2QJFA 5FIUA 4EKIA 1U1CA 2P6NA 5GJBA 4QPZA 3K9LA 5CT4A 1T25A 1G8HA 1UBEA 4YJKA 5HZMA 4EDHA 2Q6KA 2C4WA 3OMXA 4UTXA 3W5UA 2UUAB 1TA9A 2GF0A 3LL7A 3R3YA 5EMNA 5CH8A 5G1PA 3BEOA 4V1CI 1NVDA 4CT0A 1CXZA 1GUZA 1Y81A 4JQZA 4NFYA 2IS2A 4MVJF 1YGYA 2UYOA 2F8MA 4L4UA 1X7YB 3PA6A 2ZB7A 3ZQ4A 5JR3A 3HGMA 2A0UA 1QIFA 4NWIA 4I5FA 4QQRA 3ZIDA 4MI6A 1FSPA 2CEAA 3VNSA 3OU6A 1A9YA 5I9IA 5IUJC 4F96A 3KD2A 5DN9A 1GHTA 2VXYA 5LBIA 3IAHA 2RHHA 1X2BA 1HYEA 5CXSA 5BV2P 2UVPB 5CFOA 5IJ0B 1S3IA 1U4NA 1M2NA 1PFYA 1ZKMA 3R20A 1MOPA 4ZJYA 2A33A 3Q88A 3EBLA 1P81A 3S2YA 2A0FA 3KOXA 2YRWA 4PR3A 3O0DA 4AY6A 3LUAA 4OI1A 3VISA 4LZPA 3TLBA 4CTKA 5K0CA 1WKCA 4HEA1 3DYVA 3G5MA 1U0BB 5FPHA 1RYEA 4MIOA 3ZJTA 1AN9A 4XARA 5F7ZA 3CFYA 2WIDA 4R2IA 3EISA 1Z36A 5JYCA 1USGA 1X1AA 3BILA 3CF4A 3MSCA 1QCCA 2CNWD 2JPDA 3E70C 4LS3A 2ZXFA 1KYXA 4CGZA 3Q40A 1MXHA 5EMHA 1KMHA 3KQWA 3MAGA 2XOKD 4OY3A 3H0KA 4CM9D 1ZZGA 3WKAA 3INRA 4D80A 3N2LA 3DJFA 4YCCA 1A4UA 3FR8A 3TTWA 2BFAA 4B8YA 1FJXA 4R98A 2H2AA 2YJNA 2D1RA 3KTAB 4L5CA 4EGSA 5IT0A 4QYIA 4Q7JB 3RVNA 1DQNA 3I2HA 2I9PA 1AKTA 2X7HA 8AT1A 1UWVA 1KH1A 4KNVA 2GKGA 3IT3A 4GZ3A 2H4XA 1KBZA 3DBRA 3EPPA 2HRBA 3GMSA 2BM9A 3GP3A 4FEGA 4WT7A 3SQOA 2CK3D 2VRBA 4GXQA 3ZHUA 4GMGA 4Q24A 3TL2A 2FN4A 5JEEA 3FFTA 1ZOIA 2FW7A 2XADA 4UM9D 3PCXA 4GF5A 2QLMA 1RM4A 2NU8B 1WUKS 2PT6A 4HRXA 3OY7A 1ZM3A 3E27A 4KMMA 2H92A 4W82A 1TZKA 2HK6A 5KNBH 4P5DA 1TTTA 4E5PA 4B46A 2F59A 2VJAA 4QPPA 2F4VB 1R0KA 1DLIA 5ALVA 3TBKA 2H63A 2JLBA 4M9CA 2JARA 4FE7A 1UQTA 2GD0A 5KREA 4CQMA 3QK7A 4TWBA 4DQVA 2IBMA 4AK9A 5DHSA 2G82A 2W37A 2IF2A 4TS3A 4BNVA 2QQ5A 4URUR 5A5DA 3KG2A 1DEHA 2V54A 4Q1BA 1M1UA 4II7A 4UE3S 4WVFA 1EM6A 3SJ7A 3SWWA 4BVGA 3ZVNA 1L7BA 4WNCA 5DNYB 4MO9A 3V8EA 4BMOB 5KOJA 2DFPA 1WNFA 3L4JA 2ODBA 4RVNA 3UWSA 2BI4A 3QVKA 3LD9A 4KGDA 1CCWA 1FX0B 1X8KA 3B3QA 5EQDA 1UUFA 1AMUA 3ZHRA 2X42A 3RAPR 4XKJA 1VECA 1RWPA 2GQ0A 2GARA 2ETVA 3F6PA 1KYVA 7ADHA 1OR8A 1NI3A 2IHVA 1H4TA 3C5HA 4K3UA 3VH4A 3AOGA 1VMIA 5C34B 5IYZA 3LWDA 3BJEA 4NHEA 2QMEA 3KJFA 4J9VA 3EIHA 4CLDA 3L8YA 3GGGA 4I1IA 1HTTA 1YDEA 2FEXA 3CPJB 4MICA 3MWGA 4BQRA 1ZMOA 4RU1A 2UUCB 2CNDA 3ETDA 4R9UC 3UK6A 5F64A 4J94A 3QFCA 1S3GA 4K7JA 4ZA2A 3QI7A 1CEXA 2JJ1A 1QHXA 1ADJA 5HIJA 4BLWA 1ES9A 5JZSA 2DBQA 1H22A 2YQ4A 4QAQA 2G40A 2ZYUX 1V48A 2N3ZA 4RQUA 5AK6A 1A8IA 2R8EA 4GBGA 1SXJC 3LGXA 5FO1A 3T3DA 2XQFA 4EY8A 2DHDA 1KDZA 1YCFA 2VZ0A 1DBIA 1E32A 1BCRA 3UWPA 4OXNA 1BN6A 3R76A 3LY9A 3DMNA 4KR2A 5ALIA 3G6WA 4GLFA 5D5HA 2EZTA 1EPUA 4LJYA 4PINA 3EYAA 4QRIA 3UH0A 3ZGVA 2MMGA 4EHNA 1IZ9A 1UFRA 1QH8A 1FRZA 3FYHA 3H5IA 3NDRA 5SY4A 3R7AA 4BO3A 5KYUB 2PJUA 4DA8A 1N0IA 3T9CA 1XTKA 1E0JA 2EBHX 3DUFB 3GUHA 3PHBE 4IUYA 1U81A 4PZEA 4WY8A 5ILQA 1ZYUA 2M1ZA 1K3TA 3QUTA 5AVRA 2H2WA 2RGWA 4E4YA 3DEZA 1OYOA 1BWSA 2B2NA 2QMOA 2EEPA 4ZZ2A 4OJKA 1PKXA 2D2XA 4Q1AA 4URWR 1CUUA 4TVKA 3JX9A 3VSBA 1Z63A 1DFHA 4LE2A 3OEHA 5EINA 1CUBA 3QG1A 4ZKDA 4TV8A 3UMVA 1ENOA 3PHIA 3JWIA 1XVTA 7REQB 2K87A 2JJ2A 1CUAA 3KOUA 3MW8A 3NATA 4PAMA 2HPHA 1WNTA 2B5WA 5DM0A 5HGJA 3RBXA 5G02A 1XRLA 4X24A 1U8XX 3ZXXA 3P2IA 4BTLA 2X6QA 1Y42X 4HVCA 4CU5A 2R7LA 3F9IA 2VP2A 1QQAA 1KJWA 2B21A 2V6BA 1Z18A 3F8WA 3NCHA 2G09A 4WACA 1U0GA 2FAXA 1ZL0A 4HJRA 2C4UA 3DXFA 3PGA1 4FDTA 4IR7A 2RGXA 1J8YF 1SH7A 3J7TA 2N9UA 1ZR4A 1CZLA 4V0OA 1UZAA 2J9FA 4FDUA 3A6EA 4RCYA 3FPBA 1JSZA 5CUQA 3B82A 4Q01A 3W1EA 1U3FA 5CLJA 2CXOA 4QAJA 5FFNA 5F4BA 1RHRA 3V4FA 1S7GA 2G25A 4XIFA 5J5VA 1AMNA 4ZAVA 3I34X 3U7JA 3VH2A 2H08A 4YRSA 3UOAB 4OEHA 4DCGA 1RJEA 4R9VA 2XWQA 4U5QA 3AUJB 3I4CA 4ESOA 1SIUA 2JIMA 3P32A 4D41A 1A82A 4UMFA 4LDJA 4C6TA 3A6FA 3C39A 3HS3A 4DLZA 4IZOA 4KMOA 4LZJA 1KL7A 3B78A 1DIBA 4MX8A 2CV0A 1Z35A 1SCUA 4ETNA 1U8YA 1SBHA 4NAVA 3JYPA 1YHYA 2H6EA 3MGAA 4D45A 4J8PA 2PUDA 1TYEB 3ELUA 1MJGM 4OFWA 3JWPA 2ZRJA 4W5WA 2OGSA 4Y30A 1CV2A 1XXHE 2AS0A 5DBIA 2RE8A 2PYIA 4F6CA 4QRDA 3TVYA 3G2HA 1Y1LA 3EDYA 3WWDA 2C5HA 3Q15C 4BVHA 5C8YB 1R4NA 2D0OB 3I72A 1LS6A 4LZAA 1YAJA 1VSQA 5K3CA 3U3XA 4J76A 4KOEC 3UMBA 1JQKA 1MOQA 4LQLA 4CYMA 4F3RA 3N59A 4L0MA 3BHJA 4G0UA 3AVYA 4KO1S 4M0KA 3PJRA 5BWMA 1WU7A 1CYDA 4JBGA 3VKUA 1C9MA 5TF4A 3EIXA 1QIEA 5HCNA 3R4VA 4N5DA 4ISBA 1JG7A 3Q0TA 3BICA 3B20A 2ZQZA 3DOIA 3KVOA 3PQ6A 4HEJA 2VP6A 4N6NA 4TXLA 1BYUA 3T3HA 4EARA 5JEDA 4PNEA 1DBVO 3G0OA 1PCXA 3L8MA 3GT3A 1JHUA 5EIHA 3VTZA 1HG0A 2J7KA 4DA0A 5C37A 1FDOA 2JCXA 1OT3A 3RYHB 1PGOA 1G1AA 2J3MA 3VXKA 3ZLBA 4QJ3A 5CBPA 1L4UA 4LVNA 1RQRA 3QEMB 2RK3A 4QLBA 5C0OE 4DQLA 2EFEB 2PMWB 4LE1A 1RC1A 1P5JA 1VSTA 2ICAA 4Q1DA 3ZCUA 5JC8A 3AUUA 2NV6A 4P8RA 2P9JA 3S3TA 3DEJA 4YRGA 4LMAA 2QXYA 2RBEA 1RPZA 5B1SA 4PYMA 3DYBA 2WTBA 4NOKA 3V8RA 4ARAA 3B1JA 4KE6A 3UATA 4K1XA 4HDOB 4MSUA 3P94A 3QMPA 3M3PA 2I2AA 5G3YA 2QW0X 4O1HA 4ZOBA 2O7QA 1F6BA 2FPSA 3LDHA 1PEAA 4DEYA 4E5KA 3BFVA 1QZ3A 4ZVSA 3Q85A 2FSVA 2ZE5A 2AX3A 1ZP6A 2BFFB 3NUZA 4JSYA 4R3NA 3W5VA 3FJYA 1GPWB 1TU3A 4KAJA 1KO7A 1OX6A 4E2YA 4QE3A 5E4TA 4I5DA 3ECSA 1YVEI 2P9FA 3B1VA 5LQCA 4ESVA 3I92A 2CXNA 3ESBA 3WLQA 1OIWA 1GV0A 2NACA 2HA2A 2ZJ3A 3PB3A 5JMPA 2GAJA 1RHQA 1E9SA 5JZ9A 5KINB 1GZHB 1C30B 3ABOB 3O9ZA 2ROQA 1XKLA 1JXOA 4GOJA 3SCZA 3BA1A 2VSNA 3O8OB 4JC0A 1AQNA 1OH6A 2CNWA 4G2TA 4DCVA 1C50A 1VPEA 1MOZA 1E3WB 1R8QA 4HGZA 4WNAA 3FHLA 3L8FA 4G67A 1KI8A 5CCEA 2XOKA 4XQCA 4YJ3A 1UP6A 2X0JA 3ZDRA 4CM9A 4MV7A 1OA0A 5FR2A 4IHQA 4OF4A 3DOUA 1AUVA 4YJDA 1LD3A 2K2QB 4HXGA 3ZUGA 2HTFA 1VB5A 1KHTA 3FDFA 3FXAA 2AFIA 3E2MA 2QX7A 3JZMA 3NOVA 4LXYA 4V0KA 3ERCA 8MHTA 1D2RA 1ZHHA 3MGKA 2DWPA 4MI9A 4DJ5X 3GG2A 3ZNQA 5LP1A 2IEDA 5LQNA 4XQ9A 5BSKA 5A05A 5ICFA 3F6BX 1VJRA 1XMJA 2AOXA 2YZNA 3UWOA 3CZMA 2YQ5A 2CK3A 2QT9A 1NWCA 3BQNB 2O8EA 1VGRA 1LZLA 4TTTS 1JIVA 1RADA 3AB3A 2QTTA 4EBBA 1Q0UA 1RLTA 3HG7A 2I22A 3CWZA 4R8MA 5DX1A 3TPFA 4C29A 3BEDA 4MJLA 2WJWA 1ZXXA 1U02A 4N40A 4WADA 4L5AA 2QVZX 1QZZA 3BE8A 4BASA 3AC0A 5BR8B 1JHAA 4G4JA 2EZUA 3D64A 2AKAB 1VIDA 1XRRA 4MWTA 4DVGA 4DB4A 4FI3C 1CE8A 1P7VA 3F74A 3G2KA 3NOXA 1RQLA 4N47A 2B69A 2VUIB 5GM1A 3IAEA 3DFZA 1V71A 3CW9A 3MCAA 2GN8A 1U9CA 3DPSA 3MPUA 3OJLA 5K8CA 5HJ2A 2VWGA 3MWYW 2FX3A 2WAYA 3P0RA 4NCIA 1XTIA 1KK3A 2PH3A 3GUCA 5AKEA 3ZCQA 4IHKA 1TVMA 4U7PB 1G3MA 3JWEA 4A0HA 2ATVA 2HM7A 3OQMA 1AV6A 4LTNA 2D1FA 4QICA 2PSHA 2CE2X 3C4QA 5B55A 1H6BA 2YHUA 3C15C 1X1SA 3GK3A 3T8YA 5KNDD 4QDTA 5FADA 2XPCA 1KEEA 1QHGA 3FKJA 3C5CA 1TVKA 2H16A 1GN8A 1Z8NA 4UDXX 3ETJA 1PVVA 2JLSA 2DXIA 5CFMA 1PR6A 4G8DA 4E2XA 3M6AA 2GM9A 2J4CA 5K6AC 2Q28A 3JR7A 6GPBA 5JAZA 3GN1A 2IXAA 3UKDA 4DUGD 4BLTA 1JYFA 2BBWA 2CJFA 2XTJA 1ZEJA 4JNKA 4LJ8A 3W7BA 4DNQA 3PLRA 5B1DA 1JIXA 3U4AA 1EDEA 4X1YB 4NBNA 3IQWA 1WUTA 4PFQA 1RWNA 2PZBA 4E94A 3GD5A 1GGVA 1OLSB 2QAGC 3L1IA 1KAQA 1PR5A 5IPFA 3G0GA 3CISA 4CKEA 2IX3A 1WKBA 1WIWA 3HNOA 4II3A 1PL0A 1RP7A 2PHZA 4WY2A 3EIEA 4GECA 4MVJG 5IM4F 2EVWX 2PWYA 3IO5A 4YALA 3VO8A 2VPWA 2Q8NA 4O4IF 2C7BA 2VJMB 4AURA 1LPOA 3B8EA 3JQAD 3IHKA 4QIHA 2P78A 3ESYA 4Q4LA 3VR6H 1LRJA 3RU7A 2FQ1A 2JH3A 1LI5A 4NU0A 3PDHA 1PFGA 4AP9A 4YT2A 1SELA 4QPCA 1QVWA 3WS7A 4PWZA 4JBLA 1AXGA 2FX2A 1R64A 3KCNA 3TW0A 1SQGA 1MRZA 5FQNA 5KQSA 4YAWA 3T7DA 3G1WA 4L02A 2FX5A 3HKBB 3VYVA 1Q1NA 4BFSA 1T4CA 1U94A 2FHSA 2V4ZA 3WHLA 1BQEA 1RR6A 1X42A 2CJWA 2XNCA 2IU3A 1Z2CA 1SVWA 2DSNA 1N6RA 2BMFA 3IPLA 3RC3A 3L77A 3WAGA 4DV7B 3T9FA 1X19A 2BFPA 2VF2A 5AUQA 4Z2AA 1A7AA 1JHZA 2R4TA 3ILXA 1QGUB 3OI7A 4AG6A 1L9KA 2GD2A 2SICE 5JNWA 2H0RA 3MB5A 4PSVA 1IOLA 1JXMA 4XCQA 1M1YE 1NR5A 1YQGA 1WRBA 5B36A 2OM2A 4UKDA 2OORA 2MYNA 4M9SA 2E4YA 1L2TA 1ZUNA 4F4JA 1BVHA 1G21A 4ZYVA 4LF7B 4XGNA 2QTNA 2DKOA 5CA1F 5FWAA 1OPRA 4YA6A 2CVQA 1CTQA 3ZW7A 1MFPA 2AFHB 2PZGA 4HH1A 2YWHA 2OG2A 3AP1A 3NKFA 1FUEA 4H3KB 1KFCB 1G18A 2NU9A 4GX1A 4EO7A 2JCSA 4J2OA 4WNYA 2IU0A 2BYTA 1T9GR 1EHYA 3DZGA 2DPLA 5BMVF 3ELWA 3PJEA 2IOYA 2NVWA 3UJCA 4NU5A 4CV3A 1NOJA 1RSZA 1MFZA 5E6RA 1TIBA 1NUUA 2ID8A 3NT4A 3LP8A 5FKJA 4ZCLA 2IRWA 2LKDA 1HTBA 2MYTA 3MEQA 5B1YA 2WJPA 2BHNA 1D5CA 4JMLA 2EARA 5H4GA 2GYVA 1N8KA 2C96A 1FNNA 2WFLA 1QYRA 2JHFA 2QGFA 2FR0A 5E6UB 2ECQA 2GBIA 4HDKA 3IP3A 5AXBA 1P1BA 2YXNA 2XT6A 4LGCA 5CTAA 3ENVA 3PJDA 1CD5A 3EAQA 1IPEA 1U5AA 4H15A 1B15A 1VRWA 2J3IA 2UUPA 4OV6B 3ZDYB 2Z6VA 1QZUA 4HFMA 2C58A 3GEDA 5CVCA 1Y3CE 3PK0A 1G5QA 5FJJA 2I4IA 5IKEA 3TECE 1VE1A 4RPCA 3SHQA 3Q8KA 1UXHA 2R5FA 2JW5A 5DM60 4DPMA 5BUCA 3VR5D 1B6RA 2XUZA 1EGVB 4ETWA 3RQIA 4LYHA 3AH8A 3JRXA 2V3CC 2W2NA 1IBSA 2WD7A 4C4YA 3JQ7A 4GZMA 2OHJA 2QZJA 3T3GA 2QLNA 4EPVA 1L7PA 1M6NA 2GPTA 3V9PA 3Q5DA 2ONKA 2Z6AA 4L2IB 1LC3A 2P8SA 2BHTA 3B48A 1F06A 1SHKA 5KYYB 2P5YA 4M6WB 5KHAA 1XJWA 2YX1A 4UQOA 3CUUA 2P9QA 4QXOA 4M0CA 2BOVA 4QODA 4PC3A 4WZZA 1A5BB 2QUKA 3RYIA 3FM9A 1OU4A 4PGFA 3KM0A 2YWDA 1HUQA 1CK4A 1UK6A 3EC7A 1PR9A 2IT1A 4LDNA 1V8ZA 2OCAA 4RBNA 4FE4A 4PZUA 4DRZA 2A4MA 1SXIA 3UV6A 5K2OA 1XV5A 1T8WA 1DFIA 1NLYA 4KE9A 5BT9A 4GRAA 4KIJA 1NR7A 1G20E 5JVDB 1I1OA 1UKVY 2JASA 3UXEA 3UY4A 1LDEA 2YXDA 2O59A 3O93A 3GQBB 4LYFA 1P44A 5FI0B 4FVTA 4P2BA 4XPIB 4RXTA 1QP8A 4M2LA 4MA4A 3HY4A 3R9WA 2DFDA 2PT5A 3DO5A 3N7AA 3KT0A 2VJDA 4HBZA 3U16A 4QBHA 2WE8A 1KNXA 1OBOA 3H4IA 2J0UA 2VP5A 2IWHA 2GZ3A 1NRWA 3ROFA 3N58A 3UB3A 3QSGA 3QUQA 5FP0A 4UXHA 3I2GA 3KKLA 5H83A 4GR5A 1DINA 1XMQB 3K8ZA 3SJCA 5KHOC 5LSAA 2WVJA 1G2PA 1DIHA 5DNVA 4M7PA 3U4IA 5DHTA 5CP8A 3GFGA 2CD9A 1A7JA 1E1KA 1TGVA 4Q3OA 4EGQA 1P1CA 3IQGX 4K2AA 3IDQA 3MMPA 4RPJA 421PA 4GPZA 3RYCB 3FI9A 5JNSA 1H3NA 2LCFA 2QD5A 3B13B 1JQAA 1RIFA 3BZUA 3EZYA 3GN2A 4P0TA 4PYKA 3OQIA 2QLTA 5FWDA 3QE9Y 3V4SA 1YSCA 1SUPA 4RQBA 2EFHB 1HORA 1HLGA 1V6CA 1CIJA 2V6MA 4EUSA 621PA 3LGAA 5D00A 3STHA 4W5TA 1EFHA 1GDDA 1EYZA 3TD9A 4Q6WA 1KMMA 5PGMA 3D3WB 4LJKA 2P3OA 4DNFA 4LDAA 1H0KA 1CRWG 1RBZA 3O21A 2HLDD 2FA9A 3T3IA 4BKPA 4AS1A 1NBIA 5DWQA 3FROA 2FCAA 1JG6A 3AR4A 1LPAB 3LKBA 2ORIA 2I80A 1R00A 3H4MA 1TU0A 2GPWA 4LZWA 2RONA 2OFFA 4KG7A 4TYYA 1AGNA 1O3YA 2ZVQX 1XCJA 3KYCA 2OAGA 3HLYA 2W6MA 5FNZA 3UJ8A 2UXBB 3NBFA 4Y1RA 1KRHA 1NV9A 4HUQB 3EUFA 3I5YA 1ZGAA 2ZWPA 1TUBB 4C04A 1Z7BA 4XFDA 1J8DA 2GN1A 4F4FA 3P0HA 3OQVA 1XVVA 3A3KA 3OECA 4JLNA 1EZ1A 5E7QA 1N77A 3TF5A 3QU9A 4MGEA 4NYMQ 4FP9A 4RKFA 4F84A 5JHHB 3ZDAA 2QX8A 4R69A 2LP4Y 3SZ3A 2JAOA 1YRLA 3KALA 3KSMA 4RY8A 5EE1A 4UC0A 1QG4A 4YN3A 5KKAA 3SEFA 5J2UA 2ZYIA 1SVLA 1XLWA 1O4WA 2Q07A 2V0NA 3DTVD 2GPYA 3OJWA 5GV8A 5TDHA 2Q7OE 2QL9A 3E9RA 1JDBB 1ZWLA 2MR6A 1GNLA 5KNDA 5FBQB 1DJPA 2G67A 5IXJA 2AK2A 1I5OA 1TUGA 4HB4A 3NVKI 3E0QA 4MDYA 2DR0A 2B37A 3PIDA 4K28A 4YGXB 4MS4B 3FCAA 5TPZD 1RRMA 1QG0A 3AI3A 3TM5A 1ZK2A 3VYTB 1JWLA 4DUGA 3D7KA 3NOOA 3AZPA 5EKXA 1E9CA 1AD2A 3DWIA 4JLOA 3RFCA 3OKAA 3WYBA 1CZKA 4M22A 5B4UA 3QX7A 4MITA 2Q9AA 1E92A 1XZGA 2ZUUA 2C5BA 2Q99A 3BSSA 3ONWA 4HMOA 3EVCA 4XUCA 3P4YA 5F3DA 3Q4GA 3A6PC 1H0HA 1W6UA 1Y8QB 2AT1A 3EZGA 2YC4C 3GJ5A 1D8TA 3HJCA 3LT4A 3I2KA 5DFAA 3W5SA 5FORA 3WL4A 4D9IA 1JMYA 1I4TD 1CS0B 3CB2A 5GJCA 4G1FA 1R6UA 4I1SA 5FQOA 5REQA 1EDBA 3LP5A 4X1KB 5KKCA 4LF8B 3RBZA 4YYZA 1YDMA 1YZ3A 2BISA 1E2DA 4UMVA 1E5TA 4HTFA 4EB8A 1T9AA 3JQAA 2B3TA 5EJEA 3FOEC 1LI7A 5DO9A 3ZJYA 2KB0A 2NSHA 4CG0A 4D4KA 1QMGA 2FZCA 2WAMA 3UANA 4KMSA 3A9VA 3PDIA 1E18A 2GR9A 3LDUA 3M4JA 4LOKA 4XLZA 4Y0VA 3KKOA 5KOHB 4LF4B 4G24A 1JRLA 2XR1A 3TOXA 5DM70 1F2TA 1N2IA 1P29A 1RP1A 1DBQA 4Z54A 2VAVA 1GQSA 1QONA 3AEKB 1IN6A 3Q87B 2IYQA 2NG1A 5A71A 3R23A 1U8FO 4FIZA 4LF6B 2B9EA 1DAOA 2OCYC 1U31A 3U44A 3EVZA 4TN5A 4BRWA 3G2OA 2IZ0A 4KVAA 2IPAB 1UQRA 4HDRA 3PPYA 4GLLA 4AZSA 4IOKA 4W6QA 4L3WA 1TTQB 2C8KA 2RI1A 2CDAA 3S1LA 1XCMA 4JX9A 3SF8A 4DY6A 1UWKA 4FOPA 4OI2A 4TSFD 1BS2A 1LPSA 1G9XA 4BNIA 3BD6A 3H1GA 3O3OB 4ZYWA 1GITA 3VJLA 1P31A 2OHIA 3ACBA 3E5HA 4LHXA 2RFLA 2ERYA 1VE9A 3X2FA 4C7JA 3NBKA 1EK6A 3GOQA 4MWBA 3UJAA 3HWSA 4TQAA 1GAWA 2OT3B 4C4PA 4G5YA 1WHSB 1WCYA 3GARA 1R0WA 4MUFA 3TQCA 1KKLA 3CPSA 4JDPA 4R8LA 2A0YA 1ISSA 1YRAA 1ECPA 1NW4A 1IEQA 1QLHA 1KHHA 2DFTA 2ZSUA 3DNPA 1JQLB 1Y4ZA 3FBWA 3MTIA 1P2GA 3RF7A 3T12A 4B6EA 4GNRA 5BN1A 3S2SA 4QJ5A 1YZFA 1QWOA 3Q5EA 1BHJA 4PNPA 1JE1A 8ADHA 4I6EA 1JMVA 1A5AB 2PD4A 6Q21A 5DNCA 4D81A 4RENA 3FSJX 3M33A 5LYJA 1A3CA 3KLBA 3UTCA 3ZI0A 3W8FA 4AF7A 2ZB8A 4OQXA 3E8MA 1XAHA 2PO5A 1ZK3A 4Y67A 3SKVA 1E8DA 1IHOA 1UIMA 3HBMA 5C32A 4MWOA 4UBKA 5SV2A 4FYXA 1Z6TA 1W73A 1ZFNA 3MMZA 4U63A 2ID7A 3H5WA 1G0NA 4NCXA 2WUFA 2JF0A 3QW2A 1FP7A 4A27A 4ZMRA 5F77A 3N74A 1KF0A 3HO6A 4ZK6A 3K9FC 5AW9A 1WB9A 1ZN2A 4IJVA 3VR5A 1NDQA 4S0XA 4WCFC 1S96A 2NVBA 1K5HA 4KXVA 4G0PA 2FSIA 2TS1A 5HKKD 1PYGA 3QLVC 1U7XA 1OWMA 5JG7A 2JGDB 1M1YB 2O2ZA 4HS4A 2H2DA 3IAS6 3WLOA 3OD5A 4MQUA 4R8SA 1JFFB 4YMTA 3COWA 3AVTA 1QK4A 1ACJA 4KLZA 3C3JA 3DHEA 2FVXA 4OXRA 4I9UA 4ER6A 5LDGA 3WDSA 4KWHA 2C2MA 2IFTA 5D85A 3ZDDA 3CRZA 1UAYA 4UE2A 2FUKA 4Y18A 1NVTA 2ONCA 1NYQA 1GNTA 1P73A 2E87A 1VJ5A 2H4ZA 2IY8A 2J5XA 2OXFA 4P3NA 1B8PA 4P3PA 5HGXA 3EC2A 5EMKA 1K0FA 1Q0PA 1TCCA 2NWQA 2P2YA 4G81A 4MGYR 4RV4A 1OLXB 4AUEA 4BNUA 5JFTA 1GGEA 1OIXA 4G5OA 2O50A 1QH1A 4RL6A 4EJFA 1V3QE 3UJPA 1N2HA 3QVUA 4OUDB 3DPUA 5FOUA 4EECA 2VK4A 2OD9A 1XELA 3NHYA 2QDKA 4BLPA 3WA7A 2H52A 3A9SA 3BMOB 1WZCA 4GOND 4Q3AA 1ESMA 1HLDA 1ZVJA 3M4ZA 2FPLA 5G2OA 1NW7A 3S6JA 1CFJA 1Z5GA 4WCVA 3TNFA 4OYYA 1E59A 2HGZA 3H2JA 4QFMA 4DV6B 2GDJA 2WT9A 3RTBA 1SNYA 1OJLA 3OZGA 4DUPA 5I6DA 1JEYA 2IGBA 3DVSX 1I7DA 2VNSA 1JWBB 3HACA 4OBXA 1OXUA 3L1KA 2LXNA 4NYJQ 4Q9HA 4EQ6B 3R9XA 2C84A 4JQCA 1SD5A 3NPMA 5FR1A 1ZMBA 4C30A 3TX6A 1O77A 4IGEA 2QZ9A 4I8DA 5FWYB 1V1RB 4C89A 1FDWA 5A9RA 4Q05A 3E7WA 4H9GA 3ISVA 4KC0A 4WKOA 4DMRA 5D3MA 1OD6A 2O8DA 2GO1A 4P4SA 3C3BA 2A5GA 1X94A 4CW7A 1EFPB 1UR5A 5A04A 4DR6B 2FN8A 2OXRA 3STVA 5EHXA 1W59A 1MRNA 4H7HA 4B3GA 1EQ2A 3OPXA 4FX2A 1HDIA 3S4YA 4YAFA 1I7QB 2DFVA 3E3AA 2YDXA 2O7NA 3UGKA 3I3SR 1S3SA 3R6WA 4WZBE 2JEOA 2PX0A 3C6BA 2HLDA 1U80A 4J7UA 1IHYA 1WW3A 4GLOA 2Q50A 4HZUA 2B4AA 3FCUB 4HV4A 4OM8A 2DWOA 2FFAA 4G6ZA 4KO2S 3WNDA 5IU6A 3K31A 2B5OA 1KRXA 2XH8A 1J2RA 3CR3C 4JH0A 4QULA 1P61B 3UAXA 3MCVA 2J7PD 4KSBA 1RQNA 2HDHA 1N9GB 3RCBA 1VPWA 1VCHA 1DRJA 2HHJA 1KOJA 1W0JD 5BPFA 5CW1A 3DOFA 4KXNA 2AN4A 5IS2A 4YCNA 4RSGA 3TZEA 3B2NA 1RJDA 1GILA 1G4AE 3AHIA 5J59A 3L43A 1TOAA 4ZDWA 5E3IA 3WQBA 1EA7A 4LY9A 3RR2A 1WZEA 2OAP1 1BEEA 1A0OA 5BUZA 1ZK4A 3A1WA 3NG1A 4TOIA 4KKXB 4LPSA 1UF9A 2V97A 3VJKA 1GDTA 1Q0TA 3L0IB 4JB8A 2QTGA 1UOOA 5EERA 2MSKA 2ZI7A 3HSSA 1Z22A 3DTVA 3U0BA 4AWAA 3ZOZA 3AMVA 2WJVA 1C4OA 4NFSA 2W6CX 3ED5A 1P3DA 3W79A 4PTYA 1I24A 4J1TA 4CMHA 1SVMA 3KZXA 3WGGA 4ZEMA 3IQIX 1GV1A 4Y0AA 1VHQA 5TQ2A 2YWXA 5K9ZA 1YFLA 1DL5A 2EKLA 5DOZA 1CZOA 4F92B 1MGOA 3TGLA 1IHXA 4US0R 4Q21A 5EFOA 2JC3A 1TJ4A 2V9CA 2VUSA 2ATEA 4LK2A 5TPZA 5IABA 1FSFA 4W5OA 1YKGA 1PJQA 1VHDA 2I7CA 5AVOA 2XMGA 1DOHA 3WZMA 3G89A 1WMSA 4GVLA 1AZWA 5AJHA 1C1XB 1UEIA 1JHOA 1ZD4A 1N2JA 4CTNA 4I0WB 1R6AA 5KJ1A 3FETA 3PWZA 3DOHA 1QU2A 1Z5WA 4M0EA 5T57A 3QJGA 3EPRA 1M34E 2ALJA 2Z6QA 1QO7A 1ILWA 2CHQA 3OG9A 4LJLA 2YYZA 2QN3A 3K9CA 5D5PA 3AEZA 3RS3A 4EG0A 2HWXA 2VK2A 4R41A 3FF1A 3GLVA 4IIJB 2D5IA 4YRBA 4IDOA 5F7JA 4YK7A 3WK8A 4N4AA 3RQSA 1L5HB 5TPWA 3LKZA 1LK5A 1QF6A 2OCDA 1U98A 4R8RA 2VBGA 3SYRA 1B8NA 4O1MA 2MU1A 2W43A 4NE7A 2YIDA 5DX0A 1WXHA 1L5LA 4TVOA 2QJTA 5DXFA 2QPAA 1VE5A 3O03A 1NBMD 4TV9F 5KWSA 3RE1A 2HF9A 2DKNA 3GCWA 4EVRA 1YA8A 1YRWA 4KSCA 2A59A 3DAOA 3ZX4A 4V3BA 1UT5A 1LK0A 4K03A 4JR2A 2EX1A 1KDTA 4DMHA 2DYKA 1RMQA 1DLJA 1H69A 4NJMB 1V35A 3GRVA 3HDGA 3S8MA 1CQJA 3AO0B 3MT0A 4X5OA 3QV2A 3SBDA 4BBJA 2GWRA 1VRVA 1VL1A 2WM8A 4LCJA 3ZWVA 1MP0A 4HYEA 2C61A 5BPHA 3IVCA 1FW8A 3KS9A 4TSFA 1JKJA 1QJ4A 3SN6A 1WPQA 5JSUA 2DWUA 3JD4A 2DTDA 1GPH1 4UM7A 1NZFA 4G5HA 5BN5B 2LR0A 3BD9A 3KEFA 5WRFA 5FF9A 2AIRA 4KXXA 3FHCB 1JPUA 3D8BA 2NLOA 3D8RA 3O8BA 1RE1A 3TLCA 1QS0A 4C0SA 2ZUCA 1XKTA 1F1JA 4BCDA 2R6DA 1RBYA 2WBLC 3BH0A 3GA0A 2UV8A 2AMJA 2OBMA 4JBHA 1BQ3A 3QEJA 4G07A 4Q4JA 4BE7B 3OTQA 4DLUA 3LX8A 1BNCA 1OFHA 1W5AA 3F5MA 1ORHA 2P4HX 2VR1A 2ZE7A 4BMVA 2ZI5A 3PNYA 2IV7A 1C8VB 1KO4A 2LD4A 2WOJA 4OREX 5D87A 5BWLA 3AJ9A 2WNSA 2C4NA 3IR6A 2FH5B 4PCUA 4LV8B 3QNUA 3U61B 4HX5A 1E2GA 5IARA 4IIYA 1ORWA 2A0XA 4DIDA 5CA1B 1CR2A 3KJZA 3OC6A 3RK0A 5J43A 4JT2A 5K3OA 1UJMA 3OETA 4KXMA 2PBFA 1TF2A 4QOSA 3VC1A 2ASVA 1GVHA 1JHMA 1KU6A 1O03A 1KI6A 3E53A 3M6IA 4KIWA 3T1VA 4TMXA 1E6WA 4WN9A 4POOA 3L6BA 5BMVB 2NVUA 3ILHA 3NP7A 1XGKA 2VPQA 4C3VA 1IZ7A 2DGDA 1D1SA 1FMJA 1EA5A 1Z34A 5HP4A 1GGJA 5GM2A 4IDFA 2BGTA 3FTNA 1R74A 4TKLA 2CHUA 3KOYA 4TMZA 3EZ7A 5HRCA 1PGPA 1QGED 4G25A 2RAPA 1I3OA 5KQMA 4KB5A 4X8OA 5HKKA 2C94A 1K7SN 1CJKC 2WHPB 1XL1A 3PXDA 1S2OA 2P67A 2PGNA 4JAVC 2Q3FA 4W9RA 4RTJA 4DJEC 2PUEA 4KQGA 4YMGA 1KARA 3QPBA 3VC3A 3A9UA 4MAAA 1WXIA 3A27A 4IEIA 4BWGA 3D6UA 2TMDA 5L4NA 1EQAA 1AMOA 1XRSB 3L0OA 4BKQA 1D9ZA 1TVEA 3K0KA 2OQVA 3O8DA 3AHGA 3ID6C 1QO9A 2E5WA 2F64A 4PC7A 4BNXA 2HYIC 4G0VA 1ZRHA 3KO8A 5J5AA 1CR6A 3O82A 5LA6B 3R3JA 4BHTA 4ZCIA 5BNTA 5ALMA 3RJ5A 4K6FA 1VLVA 1RWXA 2BMDA 3PZRA 4HG2A 1Q16A 5CB8A 1WXDA 2IYUA 4MR9A 5K2MA 1NNUA 3B6ZA 2GCOB 2C78A 3U3ZA 4Z4IA 4HN9A 3IEKA 2PYZA 3VH1A 4AC9A 1GRVA 1WDMA 1TYZA 2DU8A 3ZU4A 2UVQA 2V1XA 3HZHA 2FV8A 2OC4A 1WDTA 2KBFA 4HXYA 4EEKA 4A5SA 4IMRA 1GPYA 2XZDA 2BEVA 2IZZA 1GZUA 1G291 1X7ZB 2ZJAA 4ZO4A 1RQXA 4KX3A 2IPNA 1YL7A 3IXMA 1E3JA 1ZNWA 1EVIA 1H0RA 1WULS 4ZI3A 1W47A 3HYSA 1ADCA 2WYWA 4BLQA 2VTDA 1RHKA 1WS6A 2YBEA 3LTEA 5BVHB 1VJ1A 2V59A 3WLJA 1GVNB 1YB7A 2HRCA 4TMYA 1SR8A 3RRZA 3EEYA 3NEJA 4DVJA 2RHBA 3ADDA 3H18A 1G2QA 1QIDA 3K3PA 4MKXA 4EJ0A 4MVYA 4UNPA 3R5FA 4AW9A 2J3LA 3GEPA 3R5JA 3E3LA 2ZTVA 2HXGA 3N7TA 4I36A 1FP4A 2YJ6A 4ZGBA 5JCPA 2OV2A 5FUVA 1YK0A 2FEMA 1FJ2A 3AR9A 5AOAA 3H5OA 1QQ7A 1UFVA 4QUKA 3WRVA 4HD8A 4GPIB 4A1FA 1NVBA 3GLGB 2ODEA 1T1IA 4I1OA 4M0LA 3HP7A 3L4BC 3PNBA 4QOHA 4F45A 2YZ2A 2ZUVA 1KZ7B 3VGJA 1PF7E 2REOA 3HU5A 1BFDA 5CURA 4Q7KA 4E5UA 4RYDA 3H3FA 3X1YA 1NR1A 2D5BA 3CJRA 4KRGA 2ZIZA 1VP3A 2P62A 5J1SB 3UA3A 5IZCA 4ZREA 4QUHA 3OPYI 3EGDB 2ZSBA 4BV9A 1JAHA 4AY5A 4RLHA 2J7PA 4DBLE 1K2VN 2R65A 4GI7A 3OWXA 4O2AA 1NVAA 3M4YA 1YS2X 3K0CA 3I83A 4ZEWA 4UU7A 3OZAA 4ZI2A 3V34A 3I5XA 2Z1DA 4FFVA 1W0JA 1H2BA 5C7IO 4QOJA 4IRMA 4QGSA 5M34A 3ZZUA 4JJEA 4MRPA 4W9MC 3CF2A 1IZYA 4RFSA 1WMDA 1YS6A 2QVBA 2WTAA 4X44A 6PFKA 5IBCA 4XE5A 2Q2WA 3SHVA 1GG2A 1ULZA 2O2HA 1DQYA 3QEAZ 1QHYA 4QGBA 4OQQA 2YZGA 3GJZA 1QE0A 4BLUA 3MN1A 3UEOA 3DAFA 5JMOA 1MQ8B 1Y6ZA 3C6MA 4M46A 4J3JA 1QBKC 4BO2A 1P1HA 2KJQA 3F7MA 4MUJA 4N3AA 2IUUA 1SQ6A 1F2VA 2I4LA 3CN7A 3T7IA 1W6RA 4LRQA 1K4KA 4PSAA 2CFCA 4HAXA 5AK3A 4BGVA 2XYGA 4GD3Q 2ZUTA 3TZ6A 1KGSA 2XCIA 3VGPA 2WJ4A 4BNTA 1O0BA 4CMGA 5JAPA 3Q8XB 4BJ5A 3PRHA 4YRZA 5LDHA 4Q4CA 3WX0A 4Z4HA 1T5TA 3D2BA 3D6AA 2F8SA 5F33A 1DKUA 1EEXB 3ILSA 3W6ZA 2QUJA 3QZUA 4KRFA 3CRVA 1O87A 1JQ3A 2BE7A 1GSAA 1U8EA 2JVKA 3FPKA 3KVYA 5LVAA 2G63A 3AUFA 3ZY5A 1HLFA 2CHVA 3CLSD 1EWQA 3H99A 4N54A 5DGIA 1E98A 1QE5A 5DHQA 1KJNA 2ANBA 4UTRA 3REOA 1Z33A 1JHDA 3AZQA 2XVMA 3FKQA 3LKDA 1IY9A 1NJ6A 2PKXA 4XXHA 2C3UA 1E4EA 5EXPA 4WZBB 1AJEA 3ICCA 4EF6A 1J49A 4XJXA 5IYZF 2CXQA 3KFVA 3UJBA 1ISFA 5JXJA 1JKFA 2X14A 3RAGA 4KXYA 5CU7A 4AJJA 3MS4A 4QM6A 3QPWA 5KYGA 3WWOA 1EVEA 5BSWA 3T35A 1KOLA 3RFFA 4BMXA 4G65A 4R81A 4A2QA 2YMMA 3KVVA 1OC2A 4ZWNA 5H3HA 5A3SA 5KZMB 3A2MA 3MHPA 3R0VA 4KO4S 1K6IA 3KL2A 2XUKA 3FPAA 4S2UA 1TK2A 3DZ8A 3EY9A 3UHPA 1X7XB 4E5SA 1RW4A 2ZWIA 4GLJA 4HAZA 1U9JA 2WG1A 1K5PA 2GFQA 3I58A 4JLPA 4NMXB 1Q0RA 5EYPA 2GNAA 3LC0A 5GWXA 4JENA 4PTZA 4BNDB 4EEXA 3IP1A 3SX0A 4MDEA 1JN0A 2PZ8A 4PO1A 1NBMA 2BFCA 3HN2A 4BO8A 3LV8A 2G1JA 4EL0A 5JJBA 1YJCA 4S1OA 4Z9XA 1B0UA 1FUKA 3UPDA 2K7FA 1DKRA 1FXWA 3BMNB 5IJWA 3GG9A 4FCTA 3C4JA 4ZQGA 1YI0A 4QUGA 4RQTA 3EW7A 4YR7A 5JNVA 5IT5A 1GCUA 3BXEA 1J0XO 4KN5A 1GADO 3DDHA 2XTAA 3VU1A 4WZAA 3CUTA 3HBNA 3FKSD 1WX1A 4DM7A 4EJSB 4D9BA 3HBAA 2X9LA 1M7BA 5DGXA 5K0GA 5IVKA 4DDVA 3CLTC 3I04M 3P9NA 2EJBA 2O8FA 2BM8A 4E5VA 4NC9A 5JD5A 2BGWA 2B9VA 3SEZA 3CKLA 4K6GA 4QELA 4BJHB 4J16C 2WLSA 2E82A 2VYCA 3L18A 3WLHA 2H0AA 3C8HA 5TIIA 2XCTB 2D54A 3SYKA 1D2AA 1JT9A 1V11B 1SKAA 2OYCA 3VTKA 5JMWA 4C6HA 4OKIA 3G7SA 4ZCPA 1XEXA 1G5FA 2IDKA 3DZHA 4Z0TA 3FUTA 4CF6A 4RL4A 3BIFA 1SMKA 4B4VA 3T5TA 1K6JA 2GN9A 2CSXA 1XDGA 1AF7A 3NXSA 3QVJA 3ZYZA 4EHLA 2VAPA 3ENWA 4R0NA 2QR5A 2ZR0A 4DRXB 2XUPA 4KZKA 2F3SA 3CNEA 4RLSA 2YR0A 1MX9A 3ZDBA 1T9GS 1V7CA 2V9ZA 1W36D 3DCIA 1BXKA 1YJ8A 1C3OB 3K5WA 5LDDC 1Z4JA 5I7FA 1T9ZA 4TMVA 3LF1A 3RKUA 1LRKA 3BXFA 1A2OA 4OMDA 1QAMA 2QRNA 2DQSA 3ETGA 2Y4OA 4YP9A 2JLUA 2DQZA 4TGLA 5CCDA 2QLFA 3SNHA 2ZSIA 4D97A 4UCFA 3OFKA 1PAUA 5A6VA 2XYRA 1SZDA 3HBFA 4UREA 3HEAA 3PFCA 1NA5A 5KX5A 2PRYA 4AXXA 1VSBA 4RHYA 3EVBA 3PFGA 4D0RA 4D8XA 3EXHA 1NXXA 1VCIA 3HYRA 4YQEA 3VTAA 2FMUA 2G9UA 4O25A 1M1NB 3PEUA 3PC3A 4RVGA 4CNBA 1J07A 1N5DA 2ZETA 3JU3A 4XYGA 5E8RA 1BC5A 5IVPA 2R8XA 4BMSA 4S2EA 2GS9A 4CMCA 3PV0A 1KVRA 2OCPA 4QVIA 2GPBA 4BWVA 4U3JA 3OIUA 3IT0A 2IOFK 4MKIA 4C2UA 3B7GA 4RVCA 2F1RA 2OVFA 2RHCA 3HV0A 4LCEA 1EDDA 1LPPA 2X41A 2Y1LA 4UJ3A 4XJTA 4B6FA 4C0JA 1KEWA 1NVGA 4GVPA 4P53A 3U3JA 3PXBA 2WA2A 5CB4A 4PZPA 2A1TS 2JHAA 1Y6JA 1OMOA 4JA0A 5EIOA 4TXMA 4ER5A 2BKAA 3NBUA 4DDHA 4IQ0A 1K6EA 2IXGA 3C7CB 3KDAA 3E3MA 5AK4A 1Y8RB 5CM2Z 3I5UA 3QYAA 3IV9A 4EZIA 2MJLA 1V1MA 5JWRA 1DAEA 1DKNA 2H4HA 3LE8A 1OB5A 1HDGO 4S1VA 4G0WA 4AKHA 2HZBA 4MVWA 4OJTA 4D0SA 5IT4A 2ONYA 3EVDA 4X93A 4P4TA 3USZA 2AH5A 4QYWA 5IJ9A 5JCOC 4YRJA 2FZEA 1NW6A 4GX2A 2B7LA 1MW8X 1O1YA 3G5LA 3GGJA 3CVJA 4ZYZA 4LY0A 1S6YA 2H3HA 1UXGA 1Y0BA 3FVVA 4DEVA 4O0MA 3AT1A 1Y6GA 4BXOB 4OGKA 4R68A 3KQYA 3EFEA 3QLVA 5KC9A 3SFTA 1PT7A 1HZZA 1GCAA 2XMPA 2O06A 4NOJA 4XFKA 3I23A 3VX4A 2Q4EA 3FVTA 1ZN8A 2WM9B 4Y2YA 3R3HA 5EXEA 2Q1YA 4C0LA 5MN5A 4HDNA 2CLHB 1YC5A 2XAAA 1SU6A 3WQSB 1BMTA 3ZHBA 1P9RA 1XD8A 1WHTB 3OSUA 2B2XA 4V38A 4DLBA 4P54A 3CE6A 2X4IA 3ZLJA 5KDLA 1NVVR 4OH1A 4QBTA 5LZ7A 3ROXA 3T1NA 3D4IA 2CUKA 3SVTA 3QOFA 2RDMA 5KQGA 1Z0ZA 1FVHA 1XMXA 4GMHA 1FYVA 2ZWAA 3K1AA 2GEUA 3AP3A 1RXUA 1I10A 2DJIA 3A1UA 4N7BA 1Q6YA 6REQB 4CMEA 2ZTSA 5JAUA 2NQ2C 5CPFA 4TWAA 4JJIA 1Z73A 3W1WA 4YJ2A 2DP4E 3ESDA 1BW9B 5JI2E 4RZIA 1XDSA 5TY0A 3IAM1 3CLVA 1YBFA 2ADOA 3G0CA 3PCTA 3S2EA 3UAVA 1A7UA 2Q8QA 2OY0A 2ZXEA 5HQ3B 2CZCA 2YFKA 1NJ5A 5FO0A 2DZDA 1YS4A 3DM5A 3HYCA 2EL9A 4TL8A 5IAAA 3JRWA 2BSXA 2FMFA 4J0KA 1DHRA 3DYIA 3T1TA 2F1IA 3U4QA 1FLAA 4LOHA 5KWIA 4XIJA 3KU4A 4W5QA 2RBGA 5IVHA 5IH7A 4UBLA 2FB9A 2JAUA 2RHGB 4JMPA 2ZIEA 1KDRA 1JW9B 3DSRA 3OMLA 3RSZA 4TVSA 2QM0A 3WSVA 5FOQA 2BV3A 2QN9A 5JALA 3C24A 3KB1A 1F38A 2P35A 4L5BA 2FPIA 5EP1A 4BO5A 1KJJA 4U2BA 5CK5A 5BYKA 1L1RA 3QYFA 3O3NB 2HLHA 2P40A 1B14A 1W88B 3NASA 3CZ9A 5KAPA 3RSOA 5C1BA 3WGUA 3ZVKA 1ZM4A 4FFSA 5CG2A 1WP9A 6LDHA 1T2NA 3A7DA 3EWAA 1G7TA 1KVTA 3B6JA 4XGKA 2QGQA 2IEYA 1FJHA 1K8YB 4FZ5A 2PKRA 4P35A 5ESXA 3N9IA 3WSWA 3F2IA 1XZ8A 3D6TB 5K03A 4DDMA 3VKGA 2RHLA 1Z5NA 3BGVA 4X20B 5JSFA 3EXIA 2PLNA 1W1WA 2BCGY 3NDPA 2Q5HA 1G8FA 4MQFB 4LWZA 2Z2ZA 4RE5A 4DIKA 4E21A 4P83A 2OQIA 1J6UA 2ZBFA 4QOIA 1XTTA 1E1RD 1UEJA 1GYRA 3JD0A 4ZOLA 2IY9A 1MAHA 3ZR4B 4A6DA 4HEA6 5I9LA 3K0SA 5C1DA 4B3CA 2PZJA 4D99A 3M6UA 4C4AA 4AZ3A 1N4DA 1HZJA 2HUNA 1DTWB 2AC2A 2CL6X 1CKEA 1L5NA 1ZU5A 2X5KO 2ZDGA 3R0JA 1Q1GA 2XMQA 4K8RB 3NBMA 1TJYA 1QP7A 2VXCA 4FYHA 3DVAB 5HFJA 3HDHA 4ZT7A 2GH1A 4ZOAA 3KJEA 2WYHA 3ZU2A 4L5JA 4XI9A 1ISHA 4JYAB 4AWBA 1L4HA 1Z15A 4O59O 4G5GA 1E99A 2SCUA 1ZH0A 4BNLA 4F8EA 3LS2A 5J58A 4E46A 1REQA 4YV2A 2MMCA 5DTIA 1WMFA 3PR2B 3I0MA 4M1MA 3WL5A 1OXSC 1XDZA 4CMAA 1E5VA 4IEEA 3WYEA 1Z75A 1WDKA 1A27A 2YWGA 1R5BA 3AUTA 3ECCA 3IFSA 1U8AA 3OJEA 1SUWA 1LVGA 2XCQA 3Q72A 4UOQA 1FFAA 3GFSA 1CY2A 3IB3A 5AO9A 3ZWKA 1EFCA 1TUEA 2CXUA 4EAAA 1LY1A 4KNYA 4QX6A 3U3DA 3H1FA 5KU7A 2ZAMA 1I2DA 3P27A 3Q0EA 3IAAA 2XB2A 1CR4A 3F96A 4ZOCA 4AKEA 3ZD9A 3LQFA 3PJGA 1YFKA 2B1IA 2JGKA 4XAQA 4DLSA 1BKYA 1Q50A 3DEAA 4CM4B 1R15A 4L8LA 3NJ4A 4TMTA 4FM9A 3JD1A 2JAQA 5D1HA 1L1QA 2KLHA 3ROKA 1NXQA 4R6XA 3FLMA 4KXFB 2PGDA 1IRXA 3FUWA 4WWHA 2WQ7A 2R7AA 4JELA 3OQPA 4LN1A 5DBEX 3W6OA 3TLEA 2VZ9A 4LYAA 3M1IA 1VM6A 1T8PA 2W2KB 3E15A 3LA8A 1EUCA 1BWRA 2QX4A 3OQBA 4MS3A 4WSOA 5CAEA 2BM0A 2GKOA 2HFJA 3FKSA 5BOSB 3O7MA 3MTAA 1RM0A 1STOA 1BMFD 5ESDA 1IB6A 1D4OA 4TV9B 4EK9A 3AIOA 5HX7A 1OW3B 1Z6AA 2BZ0A 5ITZB 4O4HA 2DQYA 4AROA 4F4DA 5HSGA 4KI0A 3ZV4A 4C3UA 3C0KA 1XMPA 4KR7A 1WBJB 3AUSA 1MVLA 1U3VA 4YUXA 4H4EA 4URFA 1GR0A 4UEQA 4PR0A 5EC8A 4HQLA 4BCBA 5EY5B 2NSJA 1YDGA 1U3CA 4J6EA 1JFRA 2NUBA 4F3KA 4RTKA 4TTJA 1SCBA 4AIIA 3A1EA 5TEWA 2EFCB 3CH6A 5HTKA 4GI2A 4AJ2A 5AJZA 5HM6A 4AX8A 2AOVA 3QBVA 5JU6A 4CM7A 4KH1A 2ZATA 1QHEA 5GJVC 3QWAA 3UT0A 2IEGA 3DKPA 4FEYA 4RVDA 3AONB 4I1UA 2QGZA 3Q6MA 4G09A 1I4WA 4B40A 4GGMX 4C07A 1WZNA 2W00A 1NQWA 3U7FB 4C0BA 3CJTA 2VTEA 5ENDA 1KDVA 4FGKA 3DV0A 1R6VA 4YHBA 4ND6A 4XSGA 2R6FA 2QL7A 1E9FA 4JP2A 2PEYA 2X5OA 4PZAA 4UZSA 4B6PA 2X0FA 2PVPA 4NESA 5AHOA 4GUAA 4TUYB 4G3XA 2BP7B 3CLTD 1FTGA 2ODWA 2PM8A 3O4HA 2QT0A 4YHHB 4TZKA 2VF7A 1P9OA 4EO4A 1WJGA 3KUDA 1WL8A 1Y4UA 3QUSA 2OZEA 3BXHA 3TLKA 1CVIA 1CY7A 4E3ZA 4KQFA 5TVGA 3KQTA 3AWIA 4DC1A 4KPGA 1PQWA 3LC7O 4HGRA 4NH0A 4KTTE 1MX1A 1NI5A 1V16B 2GCIA 5I9TA 2GXSA 4Q03A 4H1WA 3KKQA 5HEKA 4UOEA 2C2KA 3EVFA 4FZJA 5LQSA 2H5JA 4OB8A 1R5OA 2F2TA 2W2VA 3GEEA 4HSGA 4NX2A 3GJ7A 3R5SA 4U2EA 3TMYA 3Q3VA 1VCNA 1DHTA 1ZVKA 3IUQA 4OQZA 2IIBA 2QN1A 2I29A 4IHJF 3QE3A 4RSMA 5L3ZA 4B9AA 1J2EA 1XQWA 4PLYA 2ZJ2A 2YXPX 2GM3A 2JFWA 3GRZA 5DIZA 1I6WA 4AD8A 3QBEA 2V7QD 3BMXA 3ZHTA 3BMCB 3E5NA 1IFXA 1JX6A 3PC6A 1R6BX 2W6QA 2E4AA 2VDNB 3HB5X 4O8ZA 3HJUA 5U4XA 1OILA 1P19A 1T5SA 2C9ZA 1M10A 2VEDA 4MQ6A 3WFZA 2EGGA 1T6ZA 3DMTC 3SIXA 3WLTA 5E4JA 3T9BA 1MJFA 3X1DA 3HO8A 4R1NA 4MHOA 4G0QA 1DSSG 2C04A 4YGYA 1EB8A 2FFQA 4BX2A 3VV3A 3M9XA 5GVRA 2BI8A 1YK1A 2FSGA 1R4AA 2ZSEA 5GOZA 3H16A 4ZRNA 4W8GA 2OR3A 3GLSA 3QX8A 2Q4DA 2MDTA 3UB4A 1GKLA 1ML3A 3BCUA 1IATA 1W5FA 2AFIE 3IJPA 3OPYB 3DR5A 4UATA 3HKCA 2H1RA 3GZJA 1YRBA 4IDNA 1YS9A 4Y6GB 1FUUA 4TRRA 3RBVA 4QU5A 5CVTA 1GL6A 1WO8A 4A8TA 1XDDA 3VHLB 2W2QA 4KQHA 1Q0QA 3THWB 1G8AA 3DL2A 4ZOEA 4C4SA 3IVRA 4RMIA 3WQRA 3Q1KA 1ODTC 1J09A 1DDIA 1NYLA 4JV5B 1A96A 1U8ZA 4OP1A 5JLAA 3G02A 1QCZA 3C97A 2PSSA 1SKUA 2O2XA 3SS9X 4YRNA 1VKJA 2AMLA 2COEA 2XB6A 1G6Q1 4HSEA 4MP3A 5ALGA 1M0TA 4ND1A 3COJA 2BMVA 3U19A 2F43A 4CF5A 4K81B 4G01B 4LC0A 3SR4A 3OIFA 5KYXB 4DJFC 1OH8A 4DJJA 1E4YA 1OIVA 1Q1QA 3FG9A 1OGIA 5LP6C 1CP2A 1JPNA 1QRAA 1BJTA 3PXGA 3ROTA 3K1ZA 2OV6A 1C5KA 1VBFA 4QJBA 4AS3A 4D43A 2AE2A 5T5QA 2Q2NA 1D0VA 1XDUA 1Z8FA 3GLKA 3WLNA 3W2TA 4CUZA 1R9JA 4F97A 5BWOA 1VXOA 2BR5A 2QW1A 4JVMA 5EIEA 1AQIA 5I7SA 5J2TA 4FNMA 7MHTA 4ZFNA 1KK0A 3FTPA 4YVFA 1AIPA 3L7CA 3U3KA 1IM8A 1LBHA 3MJHA 1SCJA 3SZLA 3Q0IA 4OK3A 4PO9A 3FBTA 4PPNA 1U0HC 1YZUA 1THMA 3HU1A 5EL0A 3GLFA 2HA4A 1TF5A 2PGLA 4RESA 5DP1A 1N2CA 4DV3B 2YOGA 1BROA 1Y1QA 1ZUD1 1AQUA 2H4FA 3FJOA 2EIXA 3IBCA 1KMHB 3PI7A 4O08A 4RJJA 2D06A 2JFUA 1QUEA 3GAMA 1HRKA 3PQ4A 3C1AA 4RHEA 4DWOA 4RK7A 2C1ZA 3UG6A 2IXEA 2ZAIA 3PNPA 1QGDA 4NBSA 3ZHYA 4QYIB 1JGTA 2IP1A 1NPYA 4MV4A 3DP7A 3H5LA 3U2QA 3I4FA 3MTEA 4URVR 3OJ0A 1IG0A 1KZ1A 1G7SA 3VH3A 3UG7A 3N2EA 2F9MA 4NJEA 5GV7A 3DBRB 4DQ0A 1YQXA 3D2AA 2ZU0C 1DJQA 1I1QB 3MS7A 3HB9A 2OGUA 2NXWA 4UUBA 2RH8A 4KH0A 3P5BA 2V7BA 3BREA 3ANMA 5B1EA 5J2UF 4A4DA 1RYBA 1SC4A 3MUEA 4KN9S 4MVCA 5HIIA 3EJ6A 2PLWA 1FP1D 2BEKA 1E1RA 4C2AA 4K6OA 1BZYA 3B6MA 4RANA 1A8SA 4AY3A 1C14A 1P45A 2XYQA 3BGWA 3FGZA 4GUDA 3HSYA 4IDQA 3M7IA 1GSOA 1K88A 2J41A 3FHOA 4JQSA 3LLCA 3OQHA 5KJEA 2XODA 3D2LA 2R8OA 4B76A 4AY4A 4CQMB 1GPDG 1H2HA 3F6SA 1MCZA 2F9FA 2WSSD 2ZTHA 3GCZA 4FDAA 4G84A 4CF4A 1AKUA 1C29B 4R3UC 1FMTA 3JARB 1E3DA 4DEXA 3OA2A 3Q7QA 5CDYA 1A8HA 4C87A 1LXCA 3MC1A 3STWA 1Z8DA 2GJ9A 1PEYA 5K7SA 1SBZA 2EOAA 4Q9LA 4ZDKA 3CBQA 3M6MD 4GZ5A 3V6MA 5ULLA 4ZI7A 5E0OA 2I3ZA 2OECA 5BQXA 5CFRA 1XBTA 3MUFA 2NYAA 2AUTA 4JLBA 3VZPA 5KOJB 3QTTA 3PXCX 3RWOA 4PGGA 2PX5A 5ECGC 3ADBA 3EK2A 3EIOA 4GU5A 4QHYA 2HO5A 1BXGA 3SSOA 5DHUA 1MJNA 3C7KA 1TM4E 1UK8A 2IVFA 3RUIA 5IYZB 5I5GA 1AE1A 4HQRA 2X0DA 2XEDA 1PL8A 3HGQA 3PIIA 5I7WA 2IC5A 4A5OA 2GVZC 1NLUA 3C3XA 1JBEA 1ADYA 2Z58A 2Y0PA 3GH1A 1ECLA 1G21E 1IC6A 2JFYA 4KFSA 4WXEA 3S5JA 4UVGA 4U2FA 1UJBA 2P9HA 4M8NE 4YJGA 3TIGA 3AR2A 3HPQA 4OMFG 2LCIA 3OD1A 2G0AA 1K63A 1H2WA 4HKTA 4YJFA 4CCAA 3E8XA 1P9NA 2CBGA 3INNA 5AM0A 3WBFA 4D0GA 2GZSA 2VNIA 4KP7A 3UV3A 2Z83A 3CMCO 4NCJA 1BMFA 4JBIA 5AIAA 5L7TA 1E60A 2FFHA 2KMLA 1KZYC 1O9HA 2PGJA 5A02A 1FEZA 5M7EA 1D1QA 1BCRB 3E9ZA 3IQDB 2XUHA 3KEMA 4OU4A 1YJXA 1CHDA 1JHQA 3TW8A 1YR2A 3CUEF 1U2ZA 1G7CA 1YH3A 3CEPB 1NQ5A 3D54D 1JU9A 3OWOA 3T9DA 4BFLA 5LN1A 5IAKA 2WF9A 2C4KA 2VJYA 1QH8B 3I2FA 3UJDA 4LVCA 1SQ0A 2A9KA 4MKGA 1YFZA 5EP3A 1Z5ZA 4INJA 3L41A 2GJKA 4JGIA 4K6HA 3PQ8A 3GVCA 3L0BA 2HF2A 3HUEA 4FPXA 2WU0A 3DDWA 4ZEVA 1ZN7A 2H17A 1NJFA 2H59A 3CONA 1RZVA 2WIAA 4YRDA 4PO3X 1PR3A 2DT8A 2QRUA 2D5LA 2BE9A 4K40A 4KK3A 4NOLA 2J0QA 3CNOA 2OE2A 5I8ZA 3FTEA 3WYFA 2BJVA 5FBZA 2I1LA 4B17A 4I8XA 2PLFA 2H9IA 1NQUA 2A84A 4TV8B 4XTRA 2ID9A 4X6LA 3HFSA 3OO1A 1RXCA 3JYOA 2ZITA 1AGXA 5ER9A 3RHSA 3ESXA 3PE4A 2PG3A 2QMUA 4UBJA 4F93B 2C7PA 2BFWA 2VH1A 1J42A 1OI2A 2ATIA 2Z30A 2RKWA 4BB9A 3BRWD 5I7UA 3JY6A 3NHZA 5AKXA 4HCJA 5LYJF 1MC5A 3O91A 4LBYA 4ZAZA 2BELA 1WSAA 2J9FB 2ZT7A 3HMQA 3Q7IA 5EKTA 3LG2A 5DJ5A 5JDIC 2UYYA 4D02A 4EY7A 3BSYA 4Z7JA 2CYCA 1GEGA 1V39A 2XDAA 3ITNA 1KI3A 2Q3CA 4Z9AA 3VKHA 1YA6A 1QHNA 1XJ0A 2JL1A 1EVJA 4MLCA 4R2LA 2HF7A 5IN5A 5LXTA 1XG5A 1GGMA 4PRZA 4YMLA 1GQYA 4Y2JA 4DSZA 3N8DA 3IELA 1L4EA 4K9QA 1SHZA 1BE8A 2VZEA 3AGQA 3EXG2 4RMNA 4FU0A 3V7YA 3A36A 1VKNA 4C6TB 1IZ8A 3KKPA 4UCWA 1SCUB 3OKCA 3D7MA 2Q6VA 4CUKA 4OLJA 1H94A 3D1LA 2JIRA 5IAOA 1TGYA 1UADA 3N8HA 4TWIA 2C57A 2CDRA 4EYQA 3LXRA 2V7QA 4RORA 3EXG1 5K0NA 4P82A 5AQ1A 3S40A 5EXXA 2B30A 2R8ZA 2WHXA 2J3HA 5FUBA 3OP1A 3DBIA 4OOEA 4L6CA 3UXYA 1FMFA 1EGHA 5AVSA 1M8JA 1XK6A 3K4QA 3FSRA 4URHA 1NU6A 1R4NB 5KS2A 2EKZA 4YT5A 2GHTA 3JQPA 5TMDA 4EI7A 4V24A 4BATA 1T2EA 1FMCA 3KSZO 3CXUA 4QXAA 4OP2A 4CIXA 2IDMA 3PGMA 4MYDA 5DIFA 1H3EA 1J9ZA 5GONA 2HU2A 4DHEA 1C1DA 4FFNA 2ADFA 1AA9A 3KR0A 2QYOA 2JIZD 2L17A 1JH8A 1E9RA 2P0AA 4ALKA 1J97A 2J9XB 5KNCH 3HL0A 3HM9A 3LUKA 4CKXA 3E9YA 5HF6A 5BN3A 4EI9A 3K8QA 4FD3A 5EKDA 1DRWA 5CK4