4FHRB

Crystal structure of the complex between the flagellar motor proteins flig and flim.
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
215
structure length
208
Chain Sequence
HMDPVQLVNFLQSEHPQTIAVVLSYLDPPVAAQILGALPEELQTEVLKRIALLERTSPEVVKEIERNLEKKISGFVGGIDTAAEIMNNLDRTTEKKIMDKLVQENPELADEIRRRMFVFEDILKLDDRSIQLVLREVDTRDLALALKGASDELKEKIFKNMSKRAAALLKDELEYMGPVRLKDVEEAQQKIINIIRRLEEAGEIVIAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Flagellar motor switch protein FliM
publication title Structure of flagellar motor proteins in complex allows for insights into motor structure and switching.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Motor protein
total genus 79
structure length 208
sequence length 215
ec nomenclature
pdb deposition date 2012-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01706 FliG_C FliG C-terminal domain
B PF14841 FliG_M FliG middle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.220.30 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 4fhrB02
1.10.220.30 Mainly Alpha Orthogonal Bundle Annexin V; domain 1 Annexin V; domain 1 4fhrB01
1LKVX 4FHRB 3SOHB 3AJCA 3HJLA 4FQ0C 3USYA 3USWA 1QC7A
chains in the Genus database with same CATH superfamily
1AIIA 1BC3A 2XO2A 3AJCA 4MDUA 4OIYA 1XSZA 1M9IA 4JXHA 2ZHJA 4JMIA 4KN7X 2Q4CA 4FQ0C 1ANNA 1KU1A 3SWVA 4D7QA 1YJ0A 2HYUA 1BCWA 1I4AA 2IE7A 4JK1X 1ANXA 2R09A 1PBVA 3ANYA 1AOWA 4JWLA 1R8ME 2RANA 4EVFA 3SOHB 3TW5A 1N00A 1C1KA 1BCYA 1BCZA 1YIIA 2OY9A 1DM5A 1W3WA 1R8QE 2H0LA 1HAKA 2H0KA 3LTLA 1R4AE 4EVHA 1BC0A 3BRXA 1S9DE 1G5NA 4KMUX 3ABSA 1ALAA 3AO0A 1YCNA 1YGMA 1AEIA 3ABQA 2XO3A 1BC1A 1HVDA 1N42A 1Q8DA 1SAVA 1MCXA 1HVFA 2HSNA 3HJLA 1DK5A 3USYA 1HM6A 1QC7A 1LKVX 4FHRB 4C0AA 4L5MA 1BC9A 2QEZA 2ZOCA 1HVEA 2K6XA 4MDVA 4Z21A 2II2A 4X9PA 1A8AA 1A8BA 1AXNA 2HYWA 3L8NA 1HVGA 2VXGA 4KN4X 1UPTB 3USWA 1RE0B 1ANWA 1AVCA 1BO9A 4C7PA 4Q2SA 4A4PA 2IICA 1W7BA 2HYVA 4HREA 1XT0B 2R0DA 4D7RA 2IE6A 2H0MA 3ABOA 1N41A 1W45A 1N44A 3ABRA 1XJLA 4JMOA 1AVRA 1AVHA 2ZHIA 1R8SE
chains in the Genus database with same CATH topology
1RE0B 3SOHB 3TW5A 3AJCA 4OIYA 4C7PA 1XSZA 1Q8DA 4JXHA 4A4PA 4JMIA 4KN7X 2HSNA 1XT0B 2R0DA 3HJLA 4FQ0C 1KU1A 4D7RA 3SWVA 1R8QE 4D7QA 3USYA 3LTLA 1QC7A 1LKVX 4FHRB 4C0AA 4L5MA 1BC9A 4Z21A 2K6XA 1S9DE 4JMOA 4KMUX 4JK1X 3L8NA 2R09A 1PBVA 4KN4X 1R8SE 3USWA 4JWLA 1R8ME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LKV X;  4FHR B;  3SOH B;  3AJC A;  3HJL A;  4FQ0 C;  3USY A;  3USW A;  1QC7 A; 
#chains in the Genus database with same CATH topology
 1AII A;  1BC3 A;  2XO2 A;  3AJC A;  4MDU A;  4OIY A;  1XSZ A;  1M9I A;  4JXH A;  2ZHJ A;  4JMI A;  4KN7 X;  2Q4C A;  4FQ0 C;  1ANN A;  1KU1 A;  3SWV A;  4D7Q A;  1YJ0 A;  2HYU A;  1BCW A;  1I4A A;  2IE7 A;  4JK1 X;  1ANX A;  2R09 A;  1PBV A;  3ANY A;  1AOW A;  4JWL A;  1R8M E;  2RAN A;  4EVF A;  3SOH B;  3TW5 A;  1N00 A;  1C1K A;  1BCY A;  1BCZ A;  1YII A;  2OY9 A;  1DM5 A;  1W3W A;  1R8Q E;  2H0L A;  1HAK A;  2H0K A;  3LTL A;  1R4A E;  4EVH A;  1BC0 A;  3BRX A;  1S9D E;  1G5N A;  4KMU X;  3ABS A;  1ALA A;  3AO0 A;  1YCN A;  1YGM A;  1AEI A;  3ABQ A;  2XO3 A;  1BC1 A;  1HVD A;  1N42 A;  1Q8D A;  1SAV A;  1MCX A;  1HVF A;  2HSN A;  3HJL A;  1DK5 A;  3USY A;  1HM6 A;  1QC7 A;  1LKV X;  4FHR B;  4C0A A;  4L5M A;  1BC9 A;  2QEZ A;  2ZOC A;  1HVE A;  2K6X A;  4MDV A;  4Z21 A;  2II2 A;  4X9P A;  1A8A A;  1A8B A;  1AXN A;  2HYW A;  3L8N A;  1HVG A;  2VXG A;  4KN4 X;  1UPT B;  3USW A;  1RE0 B;  1ANW A;  1AVC A;  1BO9 A;  4C7P A;  4Q2S A;  4A4P A;  2IIC A;  1W7B A;  2HYV A;  4HRE A;  1XT0 B;  2R0D A;  4D7R A;  2IE6 A;  2H0M A;  3ABO A;  1N41 A;  1W45 A;  1N44 A;  3ABR A;  1XJL A;  4JMO A;  1AVR A;  1AVH A;  2ZHI A;  1R8S E; 
#chains in the Genus database with same CATH homology
 1RE0 B;  3SOH B;  3TW5 A;  3AJC A;  4OIY A;  4C7P A;  1XSZ A;  1Q8D A;  4JXH A;  4A4P A;  4JMI A;  4KN7 X;  2HSN A;  1XT0 B;  2R0D A;  3HJL A;  4FQ0 C;  1KU1 A;  4D7R A;  3SWV A;  1R8Q E;  4D7Q A;  3USY A;  3LTL A;  1QC7 A;  1LKV X;  4FHR B;  4C0A A;  4L5M A;  1BC9 A;  4Z21 A;  2K6X A;  1S9D E;  4JMO A;  4KMU X;  4JK1 X;  3L8N A;  2R09 A;  1PBV A;  4KN4 X;  1R8S E;  3USW A;  4JWL A;  1R8M E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...