4FHYA

Crystal structures of the cid1 poly (u) polymerase reveal the mechanism for utp selectivity - mg 3'-datp bound
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
338
structure length
318
Chain Sequence
SHKEFTKFCYEVYNEIKISDKEFKEKRAALDTLRLCLKRISPDAELVAFGSLESGLALKNSDMDLCVLMDSRVQSDTIALQFYEELIAEGFEGKFLQRARIPIIKLTSDTASFQCDIGFNNRLAIHNTLLLSSYTKLDARLKPMVLLVKHWAKRKQINSPYFGTLSSYGYVLMVLYYLIHVIKPPVFPNLLLSPLKQEKIVDGFDVGFDDKLEDIPPSQNYSSLGSLLHGFFRFYAYKFEPREKVVTFRRPDGYLTKQEKGWTRYILAIEDPFEISHNVGRTVSSSGLYRIRGEFMAASRLLNSRSYPIPYDSLFEEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly(A) RNA polymerase protein cid1
publication title Crystal structures of the Cid1 poly (U) polymerase reveal the mechanism for UTP selectivity.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Transferase
total genus 105
structure length 318
sequence length 338
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01909 NTP_transf_2 Nucleotidyltransferase domain
A PF03828 PAP_assoc Cid1 family poly A polymerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1410.10 Mainly Alpha Orthogonal Bundle Poly(a)-polymerase, middle domain Poly(a)-polymerase, middle domain 4fhyA01
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4fhyA02
8ICAA 1ZQCA 5J0UA 1ZQYA 5DKWA 4Z6CA 9ICSA 4R64A 4PHDA 4YMNA 4UB2A 9ICKA 4WBZA 4I2JA 5DBCA 4PGYA 2NRKA 7ICMA 3C5GA 5J0YA 1ZQVA 4RPZA 4QZHA 7ICOA 4R63A 4NLZA 8ICLA 1F5AA 4P4OA 3AUOA 4NM1A 4FO6A 4AT7B 3NYBA 4YMMA 4TURA 4M9NA 2DVIA 4M04A 7ICJA 4EP7A 4RQ8A 2B51A 3V7JA 4UBCA 7ICSA 4WC2A 4RWNA 3C2MA 8ICJA 2B4VA 7ICNA 4NKTA 9ICVA 3WFQE 4TUPA 9ICIA 4E8FA 9ICFA 4AT9B 1NO5A 4QZAA 4GXIA 4X4PA 4X0AA 8ICQA 4RT2A 3B0XA 2M2UA 4PHPA 5CWRA 4QZFA 4F5RA 3TFSA 1ZQLA 3K75D 2DR8A 3H38A 7ICTA 1BPXA 2ID1A 4F5NA 3AQMA 1JAJA 5HRLA 2HHPA 3V7LA 5J0RA 3ISDA 3ISBA 4KLLA 5EOZA 4RQ5A 1ZQQA 7ICKA 1TVAA 4WBYA 1Q79A 4QZIA 2PXIA 2BPGA 4X4NA 2PFPA 8ICCA 2PFQA 1ZQWA 3HX0A 9ICAA 5HREA 4QZBA 4QZEA 4F5QA 2DR9A 1UETA 4EBJA 9ICNA 3MDAA 2BCQA 4UBBA 5J2GA 2ZH1A 8ICNA 4KLUA 4KLFA 5CJ7A 7ICLA 4FHVA 2GWSA 3OUYA 9ICWA 4M0AA 1ZQRA 1UEVA 2FMPA 4DOBA 3MBYA 4P4PA 3LQCB 4RWPA 5DDYA 3HJ4A 8ICYA 1UEUA 4KLMA 4XQ7A 5J2JA 4RQ2A 4I2CA 4NM2A 3PMLA 3WFSC 4FH5A 1MIYA 4QZ9A 3UQ2A 4I27A 4O5EA 1XSNA 4UB1A 1ZQUA 5J2HA 3UXOA 1BPEA 3MGIA 1JN3A 4I2FA 5J0XA 8ICZA 2PBEA 4RWOA 4E80A 4I2IA 7ICUA 5HRDA 8ICKA 3JPTA 1BPBA 1MIWA 4KLJA 4UAZA 1ZQEA 1KEJA 2ZH5A 4WC7A 4NLKA 3ISCA 4UB4A 9ICEA 4O5KA 4P4MA 3GDXA 1WOTA 5D4BA 4WC0A 9ICJA 2P66A 9ICLA 5IIJA 4IQUA 2DRBA 4RPXA 4YN4A 4RPYA 4LZGA 4F5PA 4QZDA 5IIMA 4FHYA 1MIVA 4FHPA 5IILA 5DEDA 4I2DA 4PH5A 3C18A 8ICEA 9ICHA 4M9HA 1ZQXA 4R65A 1ZQNA 5DB7A 1HUOA 4M2YA 2RFFA 4KLGA 4WC6A 1VFGA 1Q78A 4I29A 9ICTA 1ZQSA 2ZH6A 2ISPA 3V7KA 4ATBA 1KNYA 2DR5A 3LK9A 4I2AA 4KLHA 4FHWA 2ISOA 3WFPA 4X4QA 3OUYB 1TFWA 5HR9A 4X4TA 2W9MA 4AT8A 3JPQA 1BPYA 4X4SA 5CP2A 2ZH9A 2FMSA 1RPLA 5J2DA 1R8AA 4GXJA 1ZQDA 1R8CA 1ZQGA 3AQLA 4IQWA 3PNCA 4UB3A 5DBAA 4WC3A 3JZ0A 9ICUA 1YLQA 5HRFA 5J29A 2ZHAA 4X5VA 9ICCA 5HRBA 3UXPA 1ZQPA 2BE3A 9ICOA 4RQ1A 4I2HA 4MF2A 5J2BA 2ZH8A 3UXNA 1JQRA 1ZQMA 3RJEA 5DECA 4RQ7A 3H3AA 2BCUA 3C2KA 4M9JA 8ICVA 4K4GA 2BPCA 1ZQOA 3HW8A 3AQNA 8ICSA 3AQKA 4I2GA 1RZTA 8ICXA 4RQ6A 3RH5A 8ICHA 3JPPA 3JPOA 8ICRA 4XA5A 2DR7A 4PGQA 1KDHA 5J2KA 2M2WA 5CA7A 4KLTA 2PFNA 4X4VA 4Z6DA 3RJHA 1XSPA 3HWTA 4MFFA 4XRHA 1ZQJA 4MFCA 7ICGA 4DOAA 3PMNA 5J0OA 2DRAA 1ZQZA 3RH6A 4WC1A 4X4RA 4M9GA 7ICFA 3WFRE 3OVSA 4I2BA 4ATBB 4M47A 4S3NA 4YD2A 1HUZA 5J0QA 5TZVA 4K4IA 4EBKA 5DB6A 4XQ8A 5CHGA 4MF8A 4UB5A 8ICIA 8ICGA 2M2TA 5HRKA 5IINA 4LT6A 1PX5A 4TUSA 4AT8B 5HRIA 1NOMA 9ICQA 5BOLA 4RQ4A 2FMQA 3OVAA 3UPSA 5CB1A 4IG8A 5BOMA 4TUQA 3HJ1A 4LVSA 5HRGA 5J0PA 3H39A 4PGXA 5DB8A 1XSLA 4P2HA 3C2LA 3V72A 5DBBA 4X4UA 2ZHBA 5IIOA 1TFYA 5J2IA 5HHIA 5HHHA 4KLEA 9ICMA 5F2VO 3RH4A 5CR0A 2PFOA 5J0SA 4RWQA 4FHXA 4KLSA 3OGUA 3OV7A 9ICPA 2BCSA 4YCXA 3AU2A 3RJIA 4DOCA 2ZH3A 4I2EA 4F5OA 2ZH4A 5HRHA 4E7XA 4YD1A 1ZQKA 4O5CA 1OU5A 5J2EA 1ZJMA 5IIIA 4WC4A 9ICBA 4KLDA 2B56A 1ZJNA 4XUSA 5J0TA 7ICRA 3MDCA 3C66A 2ZH2A 3MGHA 3L9DA 1ZQBA 5DDMA 5BPCA 2BCRA 5J0WA 1MQ3A 4JWNA 4RQ0A 4Z6EA 2BPFA 2BCVA 8ICMA 7ICHA 4X0BA 5D49A 4M5DA 8ICPA 4RT3A 1VJ7A 3JPRA 4UD4A 3JPSA 2O5AA 4UAWA 1ZQHA 9ICRA 5J2FA 4Z6FA 4PPXA 1BPZA 3RJFA 3B0YA 8ICWA 1MQ2A 9ICGA 4KLIA 2M2VA 3H37A 2O1PA 4AT7A 3UQ0A 4IQVA 8ICFA 4KLOA 4GXKA 7ICPA 7ICQA 4NY8A 4R66A 4FH3A 1R8BA 8ICTA 1FA0A 3RJJA 4WC5A 4NKUA 2VANA 3OVBA 2IHMA 4MFAA 4YMOA 7ICVA 4AT9A 2Q66A 4LZDA 5IIKA 7ICEA 4JWMA 3TFRA 1ZQIA 3C5FA 4O9MA 3JPNA 5DB9A 5J2CA 3HIYA 4DO9A 3AU6A 1ZQTA 1BPDA 1ZQFA 4KLQA 4PHAA 2ZH7A 7ICIA 8ICBA 4PHEA 4NXZA 1JMSA 4WCWA 3WFOA 5J2AA 4UAYA 4UD5A 4M9LA 4RQ3A 4QZGA 4QZ8A 4IQTA 3RJGA 5HC9A 4K4HA 3JYYA 1R89A 4I28A 1TV9A 3RJKA 3UPQA 1ZQAA 9ICXA 8ICUA 1V4AA 4QZCA 4NLNA 8ICOA 4X4OA 5D46A 2I9GA
chains in the Genus database with same CATH superfamily
8ICAA 5B3QA 1ZQCA 5JTGA 5J0UA 1ZQYA 5DKWA 4Z6CA 9ICSA 4R64A 4NXVA 4PHDA 4YMNA 4UB2A 9ICKA 3OWGA 4WBZA 4I2JA 5DBCA 4PGYA 2NRKA 7ICMA 3C5GA 5J0YA 1ZQVA 4RPZA 4QZHA 7ICOA 4R63A 4NLZA 8ICLA 1F5AA 4P4OA 3AUOA 4NM1A 4FO6A 4AT7B 3NYBA 4YMMA 4TURA 2BBJA 2DVIA 4M9NA 3ERCC 4M04A 7ICJA 4EP7A 4RQ8A 2B51A 3V7JA 4UBCA 7ICSA 4WC2A 4RWNA 3C2MA 8ICJA 2B4VA 4EEDA 7ICNA 4NKTA 9ICVA 3WFQE 4TUPA 9ICIA 4E8FA 9ICFA 4AT9B 1NO5A 1GPJA 4K9AA 4QZAA 4GXIA 4X4PA 4O68A 4X0AA 8ICQA 4RT2A 3B0XA 2M2UA 4PHPA 5CWRA 4QZFA 4F5RA 3TFSA 1ZQLA 3K75D 2DR8A 5D63A 3H38A 7ICTA 1BPXA 2ID1A 4F5NA 3AQMA 1JAJA 5HRLA 2HHPA 3V7LA 5J0RA 3ISDA 3ISBA 4KLLA 5EOZA 4RQ5A 1ZQQA 7ICKA 1TVAA 4WBYA 1Q79A 4OAFA 4QZIA 2PXIA 2BPGA 4X4NA 3PHZA 2PFPA 8ICCA 2PFQA 4HX0A 1ZQWA 5B3PA 3HX0A 9ICAA 5HREA 4QZBA 2DR9A 4QZEA 2HN2A 4F5QA 1UETA 4EBJA 9ICNA 3MDAA 2BCQA 4UBBA 2ZH1A 5J2GA 8ICNA 4KLUA 4KLFA 5CJ7A 4NXWA 4K98A 7ICLA 5D61A 4FHVA 2GWSA 3OUYA 9ICWA 4M0AA 1ZQRA 1UEVA 2FMPA 4DOBA 3MBYA 4P4PA 3LQCB 4RWPA 5DDYA 3HJ4A 8ICYA 1UEUA 4KLMA 4XQ7A 5J2JA 4K97A 4RQ2A 4NM2A 4I2CA 3PMLA 3WFSC 4FH5A 1MIYA 4QZ9A 3UQ2A 4I27A 4O5EA 1XSNA 4UB1A 1ZQUA 5J2HA 3UXOA 1BPEA 4LEZA 3MGIA 1JN3A 4LEWA 4I2FA 5J0XA 8ICZA 2PBEA 4RWOA 4E80A 4I2IA 7ICUA 5HRDA 8ICKA 3JPTA 1BPBA 1MIWA 4KLJA 2BBHA 4UAZA 1ZQEA 1KEJA 2ZH5A 4WC7A 4NLKA 3ISCA 4UB4A 9ICEA 4O5KA 4P4MA 3GDXA 1WOTA 5D4BA 4WC0A 9ICJA 2P66A 9ICLA 5IIJA 2DRBA 4IQUA 4RPXA 4YN4A 4RPYA 4LZGA 4F5PA 4QZDA 5IIMA 4FHYA 1MIVA 4K99A 4FHPA 5IILA 5DEDA 4I2DA 4PH5A 3C18A 8ICEA 9ICHA 4M9HA 1ZQXA 4R65A 1ZQNA 4I0UA 5DB7A 1HUOA 4M2YA 2RFFA 4KLGA 4WC6A 1VFGA 1Q78A 4WH5A 4I29A 9ICTA 1ZQSA 5CFTA 2ZH6A 2ISPA 3V7KA 5CFUA 4ATBA 1KNYA 2DR5A 3CK6A 2FCLA 3LK9A 4I2AA 4KLHA 4FHWA 2ISOA 3WFPA 4X4QA 3OUYB 1TFWA 5HR9A 4X4TA 2W9MA 4NXUA 4AT8A 3JPQA 2IHOA 4JLZA 1BPYA 4X4SA 2ZH9A 3NWIA 5CP2A 2FMSA 1RPLA 5J2DA 1R8AA 4O69A 4GXJA 5D62A 1ZQDA 1R8CA 1ZQGA 3AQLA 4IQWA 3PNCA 4UB3A 5DBAA 4WC3A 3JZ0A 9ICUA 1YLQA 5HRFA 4N7RA 5J29A 2ZHAA 4X5VA 9ICCA 5HRBA 3UXPA 1ZQPA 2BE3A 3NKUA 9ICOA 4RQ1A 4I2HA 4MF2A 5J2BA 2ZH8A 3UXNA 1JQRA 1ZQMA 3RJEA 5DECA 4RQ7A 3H3AA 2BCUA 4EEBA 3C2KA 4M9JA 8ICVA 4K4GA 2BPCA 1ZQOA 3EF2A 3JCFA 3HW8A 3AQNA 8ICSA 3AQKA 4I2GA 1RZTA 8ICXA 3ER9B 4RQ6A 3RH5A 8ICHA 3JPPA 3JPOA 8ICRA 2DR7A 4XA5A 4PGQA 1KDHA 4XJEA 5J2KA 2M2WA 5CA7A 4KLTA 3K7DA 4X4VA 2PFNA 4Z6DA 3RJHA 1XSPA 3HWTA 4MFFA 4XRHA 1ZQJA 4MFCA 7ICGA 4DOAA 3PMNA 5J0OA 2DRAA 4WOYA 1ZQZA 3RH6A 4WC1A 4X4RA 4M9GA 7ICFA 3WFRE 3OVSA 4I2BA 4ATBB 4M47A 4S3NA 4WQLA 4YD2A 1HUZA 5J0QA 5TZVA 4K4IA 4EBKA 5DB6A 4XQ8A 5CHGA 4MF8A 4UB5A 8ICIA 8ICGA 2M2TA 5HRKA 5IINA 4LT6A 1PX5A 4KB6A 4TUSA 4AT8B 5HRIA 1NOMA 9ICQA 5BOLA 4RQ4A 2FMQA 3OVAA 3UPSA 4IG8A 5CB1A 5BOMA 4TUQA 3HJ1A 4EV6A 4LVSA 5HRGA 5J0PA 3H39A 5DB8A 4PGXA 1XSLA 4JLXA 4P2HA 3C2LA 3V72A 5DBBA 4X4UA 2ZHBA 5IIOA 4EGWA 1TFYA 5J2IA 5HHIA 5HHHA 4KLEA 9ICMA 2HN1A 4O6AA 5F2VO 3RH4A 5CR0A 2PFOA 5J0SA 4RWQA 4FHXA 4KLSA 3OGUA 3OV7A 9ICPA 2BCSA 4K96A 4YCXA 3AU2A 3RJIA 4DOCA 2ZH3A 4I2EA 4F5OA 2ZH4A 5HRHA 4K9BA 4E7XA 4YD1A 1ZQKA 4NXTA 4O5CA 1OU5A 5J2EA 2IUBA 5IIIA 1ZJMA 4WC4A 9ICBA 4KLDA 2B56A 1ZJNA 4XUSA 5J0TA 7ICRA 3MDCA 3C66A 2ZH2A 3MGHA 3L9DA 1ZQBA 2GAFD 5DDMA 5BPCA 2BCRA 5J0WA 1MQ3A 4JWNA 4RQ0A 4Z6EA 2BPFA 2BCVA 8ICMA 7ICHA 4X0BA 5D49A 4M5DA 8ICPA 4RT3A 1VJ7A 3JPRA 4UD4A 5CFSA 3JPSA 4FO1A 2O5AA 5CHEA 4UAWA 1ZQHA 9ICRA 5J2FA 4Z6FA 4PPXA 2GA9D 1BPZA 3RJFA 3B0YA 8ICWA 1MQ2A 4NXXA 9ICGA 4KLIA 2M2VA 3H37A 2O1PA 4AT7A 4MKPA 3UQ0A 4IQVA 8ICFA 4KLOA 4GXKA 7ICPA 7ICQA 4NY8A 4R66A 4KM5A 4FH3A 1R8BA 4LEYA 1FA0A 8ICTA 3RJJA 4WC5A 3OVBA 4NKUA 2VANA 2IHMA 4OAHA 4MFAA 4YMOA 7ICVA 4AT9A 2Q66A 4O67A 4LZDA 5IIKA 4JWMA 7ICEA 3TFRA 1ZQIA 3C5FA 4O9MA 4LEVA 3JPNA 5DB9A 5J2CA 3HIYA 2EWRA 4DO9A 3AU6A 1ZQTA 1BPDA 1ZQFA 4KLQA 2ZH7A 4PHAA 7ICIA 8ICBA 4K8VA 4NXZA 4PHEA 1JMSA 4WCWA 3WFOA 5J2AA 4UAYA 4UD5A 4M9LA 4RQ3A 4QZGA 4QZ8A 3NVOA 4IQTA 3ER8C 4OAIZ 3RJGA 5HC9A 4K4HA 3JYYA 1R89A 4I28A 1TV9A 3RJKA 3UPQA 1ZQAA 9ICXA 3MCRA 8ICUA 1V4AA 4QZCA 4NLNA 4OAGA 8ICOA 4X4OA 5D46A 2I9GA 4WQKA
chains in the Genus database with same CATH topology
8ICAA 1ZQCA 5J0UA 1ZQYA 5DKWA 4Z6CA 9ICSA 4R64A 4NXVA 4PHDA 4YMNA 4UB2A 9ICKA 4WBZA 4I2JA 5DBCA 4PGYA 2NRKA 7ICMA 3C5GA 5J0YA 1ZQVA 4RPZA 4QZHA 7ICOA 4R63A 4NLZA 8ICLA 1F5AA 4P4OA 3AUOA 4NM1A 4FO6A 4AT7B 3NYBA 4YMMA 4TURA 4M9NA 2DVIA 4M04A 7ICJA 4EP7A 4RQ8A 2B51A 3V7JA 4UBCA 7ICSA 4WC2A 4RWNA 3C2MA 8ICJA 2B4VA 7ICNA 4NKTA 9ICVA 3WFQE 4TUPA 9ICIA 4E8FA 9ICFA 4AT9B 1NO5A 4K9AA 4QZAA 4GXIA 4X4PA 4O68A 4X0AA 8ICQA 4RT2A 3B0XA 2M2UA 4PHPA 5CWRA 4QZFA 4F5RA 3TFSA 1ZQLA 3K75D 2DR8A 3H38A 7ICTA 1BPXA 2ID1A 4F5NA 3AQMA 1JAJA 5HRLA 2HHPA 3V7LA 5J0RA 3ISDA 3ISBA 4KLLA 5EOZA 4RQ5A 1ZQQA 7ICKA 1TVAA 4WBYA 1Q79A 4OAFA 4QZIA 2PXIA 2BPGA 4X4NA 2PFPA 8ICCA 2PFQA 1ZQWA 3HX0A 9ICAA 5HREA 4QZBA 2DR9A 4QZEA 4F5QA 1UETA 4EBJA 9ICNA 3MDAA 2BCQA 4UBBA 2ZH1A 5J2GA 8ICNA 4KLUA 4KLFA 5CJ7A 4NXWA 4K98A 7ICLA 4FHVA 2GWSA 3OUYA 9ICWA 4M0AA 1ZQRA 1UEVA 2FMPA 4DOBA 3MBYA 4P4PA 3LQCB 4RWPA 5DDYA 3HJ4A 8ICYA 1UEUA 4KLMA 4XQ7A 5J2JA 4K97A 4RQ2A 4NM2A 4I2CA 3PMLA 3WFSC 4FH5A 1MIYA 4QZ9A 3UQ2A 4I27A 4O5EA 1XSNA 4UB1A 1ZQUA 5J2HA 3UXOA 1BPEA 4LEZA 3MGIA 1JN3A 4LEWA 4I2FA 5J0XA 8ICZA 2PBEA 4RWOA 4E80A 4I2IA 7ICUA 5HRDA 8ICKA 3JPTA 1BPBA 1MIWA 4KLJA 4UAZA 1ZQEA 1KEJA 2ZH5A 4WC7A 4NLKA 3ISCA 4UB4A 9ICEA 4O5KA 4P4MA 3GDXA 1WOTA 5D4BA 4WC0A 9ICJA 2P66A 9ICLA 5IIJA 2DRBA 4IQUA 4RPXA 4YN4A 4RPYA 4LZGA 4F5PA 4QZDA 5IIMA 4FHYA 1MIVA 4K99A 4FHPA 5IILA 5DEDA 4I2DA 4PH5A 3C18A 8ICEA 9ICHA 4M9HA 1ZQXA 4R65A 1ZQNA 5DB7A 1HUOA 4M2YA 2RFFA 4KLGA 4WC6A 1VFGA 1Q78A 4I29A 9ICTA 1ZQSA 2ZH6A 2ISPA 3V7KA 4ATBA 1KNYA 2DR5A 3LK9A 4I2AA 4KLHA 4FHWA 2ISOA 3WFPA 4X4QA 3OUYB 1TFWA 5HR9A 4X4TA 2W9MA 4NXUA 4AT8A 3JPQA 4JLZA 1BPYA 4X4SA 2ZH9A 5CP2A 2FMSA 1RPLA 5J2DA 1R8AA 4O69A 4GXJA 1ZQDA 1R8CA 1ZQGA 3AQLA 4IQWA 3PNCA 4UB3A 5DBAA 4WC3A 3JZ0A 9ICUA 1YLQA 5HRFA 5J29A 2ZHAA 4X5VA 9ICCA 5HRBA 3UXPA 1ZQPA 2BE3A 9ICOA 4RQ1A 4I2HA 4MF2A 5J2BA 2ZH8A 3UXNA 1JQRA 1ZQMA 3RJEA 5DECA 4RQ7A 3H3AA 2BCUA 3C2KA 4M9JA 8ICVA 4K4GA 2BPCA 1ZQOA 3HW8A 3AQNA 8ICSA 3AQKA 4I2GA 1RZTA 8ICXA 4RQ6A 3RH5A 8ICHA 3JPPA 3JPOA 8ICRA 2DR7A 4XA5A 4PGQA 1KDHA 5J2KA 2M2WA 5CA7A 4KLTA 4X4VA 2PFNA 4Z6DA 3RJHA 1XSPA 3HWTA 4MFFA 4XRHA 1ZQJA 4MFCA 7ICGA 4DOAA 3PMNA 5J0OA 2DRAA 4WOYA 1ZQZA 3RH6A 4WC1A 4X4RA 4M9GA 7ICFA 3WFRE 3OVSA 4I2BA 4ATBB 4M47A 4S3NA 4YD2A 1HUZA 5J0QA 5TZVA 4K4IA 4EBKA 5DB6A 4XQ8A 5CHGA 4MF8A 4UB5A 8ICIA 8ICGA 2M2TA 5HRKA 5IINA 4LT6A 1PX5A 4KB6A 4TUSA 4AT8B 5HRIA 1NOMA 9ICQA 5BOLA 4RQ4A 2FMQA 3OVAA 3UPSA 5CB1A 4IG8A 5BOMA 4TUQA 3HJ1A 4LVSA 5HRGA 5J0PA 3H39A 5DB8A 4PGXA 1XSLA 4JLXA 4P2HA 3C2LA 3V72A 5DBBA 4X4UA 2ZHBA 5IIOA 1TFYA 5J2IA 5HHIA 5HHHA 4KLEA 9ICMA 4O6AA 5F2VO 3RH4A 5CR0A 2PFOA 5J0SA 4RWQA 4FHXA 4KLSA 3OGUA 3OV7A 9ICPA 2BCSA 4K96A 4YCXA 3AU2A 3RJIA 4DOCA 2ZH3A 4I2EA 4F5OA 2ZH4A 5HRHA 4K9BA 4E7XA 4YD1A 1ZQKA 4NXTA 4O5CA 1OU5A 5J2EA 1ZJMA 5IIIA 4WC4A 9ICBA 4KLDA 2B56A 1ZJNA 4XUSA 5J0TA 7ICRA 3MDCA 3C66A 2ZH2A 3MGHA 3L9DA 1ZQBA 5DDMA 5BPCA 2BCRA 5J0WA 1MQ3A 4JWNA 4RQ0A 4Z6EA 2BPFA 2BCVA 8ICMA 7ICHA 4X0BA 5D49A 4M5DA 8ICPA 4RT3A 1VJ7A 3JPRA 4UD4A 3JPSA 2O5AA 4UAWA 1ZQHA 9ICRA 5J2FA 4Z6FA 4PPXA 1BPZA 3RJFA 3B0YA 8ICWA 1MQ2A 4NXXA 9ICGA 4KLIA 2M2VA 3H37A 2O1PA 4AT7A 4MKPA 3UQ0A 4IQVA 8ICFA 4KLOA 4GXKA 7ICPA 7ICQA 4NY8A 4R66A 4KM5A 4FH3A 1R8BA 4LEYA 1FA0A 8ICTA 3RJJA 4WC5A 3OVBA 4NKUA 2VANA 2IHMA 4OAHA 4MFAA 4YMOA 7ICVA 4AT9A 2Q66A 4O67A 4LZDA 5IIKA 4JWMA 7ICEA 3TFRA 1ZQIA 3C5FA 4O9MA 4LEVA 3JPNA 5DB9A 5J2CA 3HIYA 4DO9A 3AU6A 1ZQTA 1BPDA 1ZQFA 4KLQA 2ZH7A 4PHAA 7ICIA 8ICBA 4K8VA 4PHEA 4NXZA 1JMSA 4WCWA 3WFOA 5J2AA 4UAYA 4UD5A 4M9LA 4RQ3A 4QZGA 4QZ8A 4IQTA 4OAIZ 3RJGA 5HC9A 4K4HA 3JYYA 1R89A 4I28A 1TV9A 3RJKA 3UPQA 1ZQAA 9ICXA 8ICUA 1V4AA 4QZCA 4NLNA 4OAGA 8ICOA 4X4OA 5D46A 2I9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 8ICA A;  1ZQC A;  5J0U A;  1ZQY A;  5DKW A;  4Z6C A;  9ICS A;  4R64 A;  4PHD A;  4YMN A;  4UB2 A;  9ICK A;  4WBZ A;  4I2J A;  5DBC A;  4PGY A;  2NRK A;  7ICM A;  3C5G A;  5J0Y A;  1ZQV A;  4RPZ A;  4QZH A;  7ICO A;  4R63 A;  4NLZ A;  8ICL A;  1F5A A;  4P4O A;  3AUO A;  4NM1 A;  4FO6 A;  4AT7 B;  3NYB A;  4YMM A;  4TUR A;  4M9N A;  2DVI A;  4M04 A;  7ICJ A;  4EP7 A;  4RQ8 A;  2B51 A;  3V7J A;  4UBC A;  7ICS A;  4WC2 A;  4RWN A;  3C2M A;  8ICJ A;  2B4V A;  7ICN A;  4NKT A;  9ICV A;  3WFQ E;  4TUP A;  9ICI A;  4E8F A;  9ICF A;  4AT9 B;  1NO5 A;  4QZA A;  4GXI A;  4X4P A;  4X0A A;  8ICQ A;  4RT2 A;  3B0X A;  2M2U A;  4PHP A;  5CWR A;  4QZF A;  4F5R A;  3TFS A;  1ZQL A;  3K75 D;  2DR8 A;  3H38 A;  7ICT A;  1BPX A;  2ID1 A;  4F5N A;  3AQM A;  1JAJ A;  5HRL A;  2HHP A;  3V7L A;  5J0R A;  3ISD A;  3ISB A;  4KLL A;  5EOZ A;  4RQ5 A;  1ZQQ A;  7ICK A;  1TVA A;  4WBY A;  1Q79 A;  4QZI A;  2PXI A;  2BPG A;  4X4N A;  2PFP A;  8ICC A;  2PFQ A;  1ZQW A;  3HX0 A;  9ICA A;  5HRE A;  4QZB A;  4QZE A;  4F5Q A;  2DR9 A;  1UET A;  4EBJ A;  9ICN A;  3MDA A;  2BCQ A;  4UBB A;  5J2G A;  2ZH1 A;  8ICN A;  4KLU A;  4KLF A;  5CJ7 A;  7ICL A;  4FHV A;  2GWS A;  3OUY A;  9ICW A;  4M0A A;  1ZQR A;  1UEV A;  2FMP A;  4DOB A;  3MBY A;  4P4P A;  3LQC B;  4RWP A;  5DDY A;  3HJ4 A;  8ICY A;  1UEU A;  4KLM A;  4XQ7 A;  5J2J A;  4RQ2 A;  4I2C A;  4NM2 A;  3PML A;  3WFS C;  4FH5 A;  1MIY A;  4QZ9 A;  3UQ2 A;  4I27 A;  4O5E A;  1XSN A;  4UB1 A;  1ZQU A;  5J2H A;  3UXO A;  1BPE A;  3MGI A;  1JN3 A;  4I2F A;  5J0X A;  8ICZ A;  2PBE A;  4RWO A;  4E80 A;  4I2I A;  7ICU A;  5HRD A;  8ICK A;  3JPT A;  1BPB A;  1MIW A;  4KLJ A;  4UAZ A;  1ZQE A;  1KEJ A;  2ZH5 A;  4WC7 A;  4NLK A;  3ISC A;  4UB4 A;  9ICE A;  4O5K A;  4P4M A;  3GDX A;  1WOT A;  5D4B A;  4WC0 A;  9ICJ A;  2P66 A;  9ICL A;  5IIJ A;  4IQU A;  2DRB A;  4RPX A;  4YN4 A;  4RPY A;  4LZG A;  4F5P A;  4QZD A;  5IIM A;  4FHY A;  1MIV A;  4FHP A;  5IIL A;  5DED A;  4I2D A;  4PH5 A;  3C18 A;  8ICE A;  9ICH A;  4M9H A;  1ZQX A;  4R65 A;  1ZQN A;  5DB7 A;  1HUO A;  4M2Y A;  2RFF A;  4KLG A;  4WC6 A;  1VFG A;  1Q78 A;  4I29 A;  9ICT A;  1ZQS A;  2ZH6 A;  2ISP A;  3V7K A;  4ATB A;  1KNY A;  2DR5 A;  3LK9 A;  4I2A A;  4KLH A;  4FHW A;  2ISO A;  3WFP A;  4X4Q A;  3OUY B;  1TFW A;  5HR9 A;  4X4T A;  2W9M A;  4AT8 A;  3JPQ A;  1BPY A;  4X4S A;  5CP2 A;  2ZH9 A;  2FMS A;  1RPL A;  5J2D A;  1R8A A;  4GXJ A;  1ZQD A;  1R8C A;  1ZQG A;  3AQL A;  4IQW A;  3PNC A;  4UB3 A;  5DBA A;  4WC3 A;  3JZ0 A;  9ICU A;  1YLQ A;  5HRF A;  5J29 A;  2ZHA A;  4X5V A;  9ICC A;  5HRB A;  3UXP A;  1ZQP A;  2BE3 A;  9ICO A;  4RQ1 A;  4I2H A;  4MF2 A;  5J2B A;  2ZH8 A;  3UXN A;  1JQR A;  1ZQM A;  3RJE A;  5DEC A;  4RQ7 A;  3H3A A;  2BCU A;  3C2K A;  4M9J A;  8ICV A;  4K4G A;  2BPC A;  1ZQO A;  3HW8 A;  3AQN A;  8ICS A;  3AQK A;  4I2G A;  1RZT A;  8ICX A;  4RQ6 A;  3RH5 A;  8ICH A;  3JPP A;  3JPO A;  8ICR A;  4XA5 A;  2DR7 A;  4PGQ A;  1KDH A;  5J2K A;  2M2W A;  5CA7 A;  4KLT A;  2PFN A;  4X4V A;  4Z6D A;  3RJH A;  1XSP A;  3HWT A;  4MFF A;  4XRH A;  1ZQJ A;  4MFC A;  7ICG A;  4DOA A;  3PMN A;  5J0O A;  2DRA A;  1ZQZ A;  3RH6 A;  4WC1 A;  4X4R A;  4M9G A;  7ICF A;  3WFR E;  3OVS A;  4I2B A;  4ATB B;  4M47 A;  4S3N A;  4YD2 A;  1HUZ A;  5J0Q A;  5TZV A;  4K4I A;  4EBK A;  5DB6 A;  4XQ8 A;  5CHG A;  4MF8 A;  4UB5 A;  8ICI A;  8ICG A;  2M2T A;  5HRK A;  5IIN A;  4LT6 A;  1PX5 A;  4TUS A;  4AT8 B;  5HRI A;  1NOM A;  9ICQ A;  5BOL A;  4RQ4 A;  2FMQ A;  3OVA A;  3UPS A;  5CB1 A;  4IG8 A;  5BOM A;  4TUQ A;  3HJ1 A;  4LVS A;  5HRG A;  5J0P A;  3H39 A;  4PGX A;  5DB8 A;  1XSL A;  4P2H A;  3C2L A;  3V72 A;  5DBB A;  4X4U A;  2ZHB A;  5IIO A;  1TFY A;  5J2I A;  5HHI A;  5HHH A;  4KLE A;  9ICM A;  5F2V O;  3RH4 A;  5CR0 A;  2PFO A;  5J0S A;  4RWQ A;  4FHX A;  4KLS A;  3OGU A;  3OV7 A;  9ICP A;  2BCS A;  4YCX A;  3AU2 A;  3RJI A;  4DOC A;  2ZH3 A;  4I2E A;  4F5O A;  2ZH4 A;  5HRH A;  4E7X A;  4YD1 A;  1ZQK A;  4O5C A;  1OU5 A;  5J2E A;  1ZJM A;  5III A;  4WC4 A;  9ICB A;  4KLD A;  2B56 A;  1ZJN A;  4XUS A;  5J0T A;  7ICR A;  3MDC A;  3C66 A;  2ZH2 A;  3MGH A;  3L9D A;  1ZQB A;  5DDM A;  5BPC A;  2BCR A;  5J0W A;  1MQ3 A;  4JWN A;  4RQ0 A;  4Z6E A;  2BPF A;  2BCV A;  8ICM A;  7ICH A;  4X0B A;  5D49 A;  4M5D A;  8ICP A;  4RT3 A;  1VJ7 A;  3JPR A;  4UD4 A;  3JPS A;  2O5A A;  4UAW A;  1ZQH A;  9ICR A;  5J2F A;  4Z6F A;  4PPX A;  1BPZ A;  3RJF A;  3B0Y A;  8ICW A;  1MQ2 A;  9ICG A;  4KLI A;  2M2V A;  3H37 A;  2O1P A;  4AT7 A;  3UQ0 A;  4IQV A;  8ICF A;  4KLO A;  4GXK A;  7ICP A;  7ICQ A;  4NY8 A;  4R66 A;  4FH3 A;  1R8B A;  8ICT A;  1FA0 A;  3RJJ A;  4WC5 A;  4NKU A;  2VAN A;  3OVB A;  2IHM A;  4MFA A;  4YMO A;  7ICV A;  4AT9 A;  2Q66 A;  4LZD A;  5IIK A;  7ICE A;  4JWM A;  3TFR A;  1ZQI A;  3C5F A;  4O9M A;  3JPN A;  5DB9 A;  5J2C A;  3HIY A;  4DO9 A;  3AU6 A;  1ZQT A;  1BPD A;  1ZQF A;  4KLQ A;  4PHA A;  2ZH7 A;  7ICI A;  8ICB A;  4PHE A;  4NXZ A;  1JMS A;  4WCW A;  3WFO A;  5J2A A;  4UAY A;  4UD5 A;  4M9L A;  4RQ3 A;  4QZG A;  4QZ8 A;  4IQT A;  3RJG A;  5HC9 A;  4K4H A;  3JYY A;  1R89 A;  4I28 A;  1TV9 A;  3RJK A;  3UPQ A;  1ZQA A;  9ICX A;  8ICU A;  1V4A A;  4QZC A;  4NLN A;  8ICO A;  4X4O A;  5D46 A;  2I9G A; 
#chains in the Genus database with same CATH topology
 8ICA A;  5B3Q A;  1ZQC A;  5JTG A;  5J0U A;  1ZQY A;  5DKW A;  4Z6C A;  9ICS A;  4R64 A;  4NXV A;  4PHD A;  4YMN A;  4UB2 A;  9ICK A;  3OWG A;  4WBZ A;  4I2J A;  5DBC A;  4PGY A;  2NRK A;  7ICM A;  3C5G A;  5J0Y A;  1ZQV A;  4RPZ A;  4QZH A;  7ICO A;  4R63 A;  4NLZ A;  8ICL A;  1F5A A;  4P4O A;  3AUO A;  4NM1 A;  4FO6 A;  4AT7 B;  3NYB A;  4YMM A;  4TUR A;  2BBJ A;  2DVI A;  4M9N A;  3ERC C;  4M04 A;  7ICJ A;  4EP7 A;  4RQ8 A;  2B51 A;  3V7J A;  4UBC A;  7ICS A;  4WC2 A;  4RWN A;  3C2M A;  8ICJ A;  2B4V A;  4EED A;  7ICN A;  4NKT A;  9ICV A;  3WFQ E;  4TUP A;  9ICI A;  4E8F A;  9ICF A;  4AT9 B;  1NO5 A;  1GPJ A;  4K9A A;  4QZA A;  4GXI A;  4X4P A;  4O68 A;  4X0A A;  8ICQ A;  4RT2 A;  3B0X A;  2M2U A;  4PHP A;  5CWR A;  4QZF A;  4F5R A;  3TFS A;  1ZQL A;  3K75 D;  2DR8 A;  5D63 A;  3H38 A;  7ICT A;  1BPX A;  2ID1 A;  4F5N A;  3AQM A;  1JAJ A;  5HRL A;  2HHP A;  3V7L A;  5J0R A;  3ISD A;  3ISB A;  4KLL A;  5EOZ A;  4RQ5 A;  1ZQQ A;  7ICK A;  1TVA A;  4WBY A;  1Q79 A;  4OAF A;  4QZI A;  2PXI A;  2BPG A;  4X4N A;  3PHZ A;  2PFP A;  8ICC A;  2PFQ A;  4HX0 A;  1ZQW A;  5B3P A;  3HX0 A;  9ICA A;  5HRE A;  4QZB A;  2DR9 A;  4QZE A;  2HN2 A;  4F5Q A;  1UET A;  4EBJ A;  9ICN A;  3MDA A;  2BCQ A;  4UBB A;  2ZH1 A;  5J2G A;  8ICN A;  4KLU A;  4KLF A;  5CJ7 A;  4NXW A;  4K98 A;  7ICL A;  5D61 A;  4FHV A;  2GWS A;  3OUY A;  9ICW A;  4M0A A;  1ZQR A;  1UEV A;  2FMP A;  4DOB A;  3MBY A;  4P4P A;  3LQC B;  4RWP A;  5DDY A;  3HJ4 A;  8ICY A;  1UEU A;  4KLM A;  4XQ7 A;  5J2J A;  4K97 A;  4RQ2 A;  4NM2 A;  4I2C A;  3PML A;  3WFS C;  4FH5 A;  1MIY A;  4QZ9 A;  3UQ2 A;  4I27 A;  4O5E A;  1XSN A;  4UB1 A;  1ZQU A;  5J2H A;  3UXO A;  1BPE A;  4LEZ A;  3MGI A;  1JN3 A;  4LEW A;  4I2F A;  5J0X A;  8ICZ A;  2PBE A;  4RWO A;  4E80 A;  4I2I A;  7ICU A;  5HRD A;  8ICK A;  3JPT A;  1BPB A;  1MIW A;  4KLJ A;  2BBH A;  4UAZ A;  1ZQE A;  1KEJ A;  2ZH5 A;  4WC7 A;  4NLK A;  3ISC A;  4UB4 A;  9ICE A;  4O5K A;  4P4M A;  3GDX A;  1WOT A;  5D4B A;  4WC0 A;  9ICJ A;  2P66 A;  9ICL A;  5IIJ A;  2DRB A;  4IQU A;  4RPX A;  4YN4 A;  4RPY A;  4LZG A;  4F5P A;  4QZD A;  5IIM A;  4FHY A;  1MIV A;  4K99 A;  4FHP A;  5IIL A;  5DED A;  4I2D A;  4PH5 A;  3C18 A;  8ICE A;  9ICH A;  4M9H A;  1ZQX A;  4R65 A;  1ZQN A;  4I0U A;  5DB7 A;  1HUO A;  4M2Y A;  2RFF A;  4KLG A;  4WC6 A;  1VFG A;  1Q78 A;  4WH5 A;  4I29 A;  9ICT A;  1ZQS A;  5CFT A;  2ZH6 A;  2ISP A;  3V7K A;  5CFU A;  4ATB A;  1KNY A;  2DR5 A;  3CK6 A;  2FCL A;  3LK9 A;  4I2A A;  4KLH A;  4FHW A;  2ISO A;  3WFP A;  4X4Q A;  3OUY B;  1TFW A;  5HR9 A;  4X4T A;  2W9M A;  4NXU A;  4AT8 A;  3JPQ A;  2IHO A;  4JLZ A;  1BPY A;  4X4S A;  2ZH9 A;  3NWI A;  5CP2 A;  2FMS A;  1RPL A;  5J2D A;  1R8A A;  4O69 A;  4GXJ A;  5D62 A;  1ZQD A;  1R8C A;  1ZQG A;  3AQL A;  4IQW A;  3PNC A;  4UB3 A;  5DBA A;  4WC3 A;  3JZ0 A;  9ICU A;  1YLQ A;  5HRF A;  4N7R A;  5J29 A;  2ZHA A;  4X5V A;  9ICC A;  5HRB A;  3UXP A;  1ZQP A;  2BE3 A;  3NKU A;  9ICO A;  4RQ1 A;  4I2H A;  4MF2 A;  5J2B A;  2ZH8 A;  3UXN A;  1JQR A;  1ZQM A;  3RJE A;  5DEC A;  4RQ7 A;  3H3A A;  2BCU A;  4EEB A;  3C2K A;  4M9J A;  8ICV A;  4K4G A;  2BPC A;  1ZQO A;  3EF2 A;  3JCF A;  3HW8 A;  3AQN A;  8ICS A;  3AQK A;  4I2G A;  1RZT A;  8ICX A;  3ER9 B;  4RQ6 A;  3RH5 A;  8ICH A;  3JPP A;  3JPO A;  8ICR A;  2DR7 A;  4XA5 A;  4PGQ A;  1KDH A;  4XJE A;  5J2K A;  2M2W A;  5CA7 A;  4KLT A;  3K7D A;  4X4V A;  2PFN A;  4Z6D A;  3RJH A;  1XSP A;  3HWT A;  4MFF A;  4XRH A;  1ZQJ A;  4MFC A;  7ICG A;  4DOA A;  3PMN A;  5J0O A;  2DRA A;  4WOY A;  1ZQZ A;  3RH6 A;  4WC1 A;  4X4R A;  4M9G A;  7ICF A;  3WFR E;  3OVS A;  4I2B A;  4ATB B;  4M47 A;  4S3N A;  4WQL A;  4YD2 A;  1HUZ A;  5J0Q A;  5TZV A;  4K4I A;  4EBK A;  5DB6 A;  4XQ8 A;  5CHG A;  4MF8 A;  4UB5 A;  8ICI A;  8ICG A;  2M2T A;  5HRK A;  5IIN A;  4LT6 A;  1PX5 A;  4KB6 A;  4TUS A;  4AT8 B;  5HRI A;  1NOM A;  9ICQ A;  5BOL A;  4RQ4 A;  2FMQ A;  3OVA A;  3UPS A;  4IG8 A;  5CB1 A;  5BOM A;  4TUQ A;  3HJ1 A;  4EV6 A;  4LVS A;  5HRG A;  5J0P A;  3H39 A;  5DB8 A;  4PGX A;  1XSL A;  4JLX A;  4P2H A;  3C2L A;  3V72 A;  5DBB A;  4X4U A;  2ZHB A;  5IIO A;  4EGW A;  1TFY A;  5J2I A;  5HHI A;  5HHH A;  4KLE A;  9ICM A;  2HN1 A;  4O6A A;  5F2V O;  3RH4 A;  5CR0 A;  2PFO A;  5J0S A;  4RWQ A;  4FHX A;  4KLS A;  3OGU A;  3OV7 A;  9ICP A;  2BCS A;  4K96 A;  4YCX A;  3AU2 A;  3RJI A;  4DOC A;  2ZH3 A;  4I2E A;  4F5O A;  2ZH4 A;  5HRH A;  4K9B A;  4E7X A;  4YD1 A;  1ZQK A;  4NXT A;  4O5C A;  1OU5 A;  5J2E A;  2IUB A;  5III A;  1ZJM A;  4WC4 A;  9ICB A;  4KLD A;  2B56 A;  1ZJN A;  4XUS A;  5J0T A;  7ICR A;  3MDC A;  3C66 A;  2ZH2 A;  3MGH A;  3L9D A;  1ZQB A;  2GAF D;  5DDM A;  5BPC A;  2BCR A;  5J0W A;  1MQ3 A;  4JWN A;  4RQ0 A;  4Z6E A;  2BPF A;  2BCV A;  8ICM A;  7ICH A;  4X0B A;  5D49 A;  4M5D A;  8ICP A;  4RT3 A;  1VJ7 A;  3JPR A;  4UD4 A;  5CFS A;  3JPS A;  4FO1 A;  2O5A A;  5CHE A;  4UAW A;  1ZQH A;  9ICR A;  5J2F A;  4Z6F A;  4PPX A;  2GA9 D;  1BPZ A;  3RJF A;  3B0Y A;  8ICW A;  1MQ2 A;  4NXX A;  9ICG A;  4KLI A;  2M2V A;  3H37 A;  2O1P A;  4AT7 A;  4MKP A;  3UQ0 A;  4IQV A;  8ICF A;  4KLO A;  4GXK A;  7ICP A;  7ICQ A;  4NY8 A;  4R66 A;  4KM5 A;  4FH3 A;  1R8B A;  4LEY A;  1FA0 A;  8ICT A;  3RJJ A;  4WC5 A;  3OVB A;  4NKU A;  2VAN A;  2IHM A;  4OAH A;  4MFA A;  4YMO A;  7ICV A;  4AT9 A;  2Q66 A;  4O67 A;  4LZD A;  5IIK A;  4JWM A;  7ICE A;  3TFR A;  1ZQI A;  3C5F A;  4O9M A;  4LEV A;  3JPN A;  5DB9 A;  5J2C A;  3HIY A;  2EWR A;  4DO9 A;  3AU6 A;  1ZQT A;  1BPD A;  1ZQF A;  4KLQ A;  2ZH7 A;  4PHA A;  7ICI A;  8ICB A;  4K8V A;  4NXZ A;  4PHE A;  1JMS A;  4WCW A;  3WFO A;  5J2A A;  4UAY A;  4UD5 A;  4M9L A;  4RQ3 A;  4QZG A;  4QZ8 A;  3NVO A;  4IQT A;  3ER8 C;  4OAI Z;  3RJG A;  5HC9 A;  4K4H A;  3JYY A;  1R89 A;  4I28 A;  1TV9 A;  3RJK A;  3UPQ A;  1ZQA A;  9ICX A;  3MCR A;  8ICU A;  1V4A A;  4QZC A;  4NLN A;  4OAG A;  8ICO A;  4X4O A;  5D46 A;  2I9G A;  4WQK A; 
#chains in the Genus database with same CATH homology
 8ICA A;  1ZQC A;  5J0U A;  1ZQY A;  5DKW A;  4Z6C A;  9ICS A;  4R64 A;  4NXV A;  4PHD A;  4YMN A;  4UB2 A;  9ICK A;  4WBZ A;  4I2J A;  5DBC A;  4PGY A;  2NRK A;  7ICM A;  3C5G A;  5J0Y A;  1ZQV A;  4RPZ A;  4QZH A;  7ICO A;  4R63 A;  4NLZ A;  8ICL A;  1F5A A;  4P4O A;  3AUO A;  4NM1 A;  4FO6 A;  4AT7 B;  3NYB A;  4YMM A;  4TUR A;  4M9N A;  2DVI A;  4M04 A;  7ICJ A;  4EP7 A;  4RQ8 A;  2B51 A;  3V7J A;  4UBC A;  7ICS A;  4WC2 A;  4RWN A;  3C2M A;  8ICJ A;  2B4V A;  7ICN A;  4NKT A;  9ICV A;  3WFQ E;  4TUP A;  9ICI A;  4E8F A;  9ICF A;  4AT9 B;  1NO5 A;  4K9A A;  4QZA A;  4GXI A;  4X4P A;  4O68 A;  4X0A A;  8ICQ A;  4RT2 A;  3B0X A;  2M2U A;  4PHP A;  5CWR A;  4QZF A;  4F5R A;  3TFS A;  1ZQL A;  3K75 D;  2DR8 A;  3H38 A;  7ICT A;  1BPX A;  2ID1 A;  4F5N A;  3AQM A;  1JAJ A;  5HRL A;  2HHP A;  3V7L A;  5J0R A;  3ISD A;  3ISB A;  4KLL A;  5EOZ A;  4RQ5 A;  1ZQQ A;  7ICK A;  1TVA A;  4WBY A;  1Q79 A;  4OAF A;  4QZI A;  2PXI A;  2BPG A;  4X4N A;  2PFP A;  8ICC A;  2PFQ A;  1ZQW A;  3HX0 A;  9ICA A;  5HRE A;  4QZB A;  2DR9 A;  4QZE A;  4F5Q A;  1UET A;  4EBJ A;  9ICN A;  3MDA A;  2BCQ A;  4UBB A;  2ZH1 A;  5J2G A;  8ICN A;  4KLU A;  4KLF A;  5CJ7 A;  4NXW A;  4K98 A;  7ICL A;  4FHV A;  2GWS A;  3OUY A;  9ICW A;  4M0A A;  1ZQR A;  1UEV A;  2FMP A;  4DOB A;  3MBY A;  4P4P A;  3LQC B;  4RWP A;  5DDY A;  3HJ4 A;  8ICY A;  1UEU A;  4KLM A;  4XQ7 A;  5J2J A;  4K97 A;  4RQ2 A;  4NM2 A;  4I2C A;  3PML A;  3WFS C;  4FH5 A;  1MIY A;  4QZ9 A;  3UQ2 A;  4I27 A;  4O5E A;  1XSN A;  4UB1 A;  1ZQU A;  5J2H A;  3UXO A;  1BPE A;  4LEZ A;  3MGI A;  1JN3 A;  4LEW A;  4I2F A;  5J0X A;  8ICZ A;  2PBE A;  4RWO A;  4E80 A;  4I2I A;  7ICU A;  5HRD A;  8ICK A;  3JPT A;  1BPB A;  1MIW A;  4KLJ A;  4UAZ A;  1ZQE A;  1KEJ A;  2ZH5 A;  4WC7 A;  4NLK A;  3ISC A;  4UB4 A;  9ICE A;  4O5K A;  4P4M A;  3GDX A;  1WOT A;  5D4B A;  4WC0 A;  9ICJ A;  2P66 A;  9ICL A;  5IIJ A;  2DRB A;  4IQU A;  4RPX A;  4YN4 A;  4RPY A;  4LZG A;  4F5P A;  4QZD A;  5IIM A;  4FHY A;  1MIV A;  4K99 A;  4FHP A;  5IIL A;  5DED A;  4I2D A;  4PH5 A;  3C18 A;  8ICE A;  9ICH A;  4M9H A;  1ZQX A;  4R65 A;  1ZQN A;  5DB7 A;  1HUO A;  4M2Y A;  2RFF A;  4KLG A;  4WC6 A;  1VFG A;  1Q78 A;  4I29 A;  9ICT A;  1ZQS A;  2ZH6 A;  2ISP A;  3V7K A;  4ATB A;  1KNY A;  2DR5 A;  3LK9 A;  4I2A A;  4KLH A;  4FHW A;  2ISO A;  3WFP A;  4X4Q A;  3OUY B;  1TFW A;  5HR9 A;  4X4T A;  2W9M A;  4NXU A;  4AT8 A;  3JPQ A;  4JLZ A;  1BPY A;  4X4S A;  2ZH9 A;  5CP2 A;  2FMS A;  1RPL A;  5J2D A;  1R8A A;  4O69 A;  4GXJ A;  1ZQD A;  1R8C A;  1ZQG A;  3AQL A;  4IQW A;  3PNC A;  4UB3 A;  5DBA A;  4WC3 A;  3JZ0 A;  9ICU A;  1YLQ A;  5HRF A;  5J29 A;  2ZHA A;  4X5V A;  9ICC A;  5HRB A;  3UXP A;  1ZQP A;  2BE3 A;  9ICO A;  4RQ1 A;  4I2H A;  4MF2 A;  5J2B A;  2ZH8 A;  3UXN A;  1JQR A;  1ZQM A;  3RJE A;  5DEC A;  4RQ7 A;  3H3A A;  2BCU A;  3C2K A;  4M9J A;  8ICV A;  4K4G A;  2BPC A;  1ZQO A;  3HW8 A;  3AQN A;  8ICS A;  3AQK A;  4I2G A;  1RZT A;  8ICX A;  4RQ6 A;  3RH5 A;  8ICH A;  3JPP A;  3JPO A;  8ICR A;  2DR7 A;  4XA5 A;  4PGQ A;  1KDH A;  5J2K A;  2M2W A;  5CA7 A;  4KLT A;  4X4V A;  2PFN A;  4Z6D A;  3RJH A;  1XSP A;  3HWT A;  4MFF A;  4XRH A;  1ZQJ A;  4MFC A;  7ICG A;  4DOA A;  3PMN A;  5J0O A;  2DRA A;  4WOY A;  1ZQZ A;  3RH6 A;  4WC1 A;  4X4R A;  4M9G A;  7ICF A;  3WFR E;  3OVS A;  4I2B A;  4ATB B;  4M47 A;  4S3N A;  4YD2 A;  1HUZ A;  5J0Q A;  5TZV A;  4K4I A;  4EBK A;  5DB6 A;  4XQ8 A;  5CHG A;  4MF8 A;  4UB5 A;  8ICI A;  8ICG A;  2M2T A;  5HRK A;  5IIN A;  4LT6 A;  1PX5 A;  4KB6 A;  4TUS A;  4AT8 B;  5HRI A;  1NOM A;  9ICQ A;  5BOL A;  4RQ4 A;  2FMQ A;  3OVA A;  3UPS A;  5CB1 A;  4IG8 A;  5BOM A;  4TUQ A;  3HJ1 A;  4LVS A;  5HRG A;  5J0P A;  3H39 A;  5DB8 A;  4PGX A;  1XSL A;  4JLX A;  4P2H A;  3C2L A;  3V72 A;  5DBB A;  4X4U A;  2ZHB A;  5IIO A;  1TFY A;  5J2I A;  5HHI A;  5HHH A;  4KLE A;  9ICM A;  4O6A A;  5F2V O;  3RH4 A;  5CR0 A;  2PFO A;  5J0S A;  4RWQ A;  4FHX A;  4KLS A;  3OGU A;  3OV7 A;  9ICP A;  2BCS A;  4K96 A;  4YCX A;  3AU2 A;  3RJI A;  4DOC A;  2ZH3 A;  4I2E A;  4F5O A;  2ZH4 A;  5HRH A;  4K9B A;  4E7X A;  4YD1 A;  1ZQK A;  4NXT A;  4O5C A;  1OU5 A;  5J2E A;  1ZJM A;  5III A;  4WC4 A;  9ICB A;  4KLD A;  2B56 A;  1ZJN A;  4XUS A;  5J0T A;  7ICR A;  3MDC A;  3C66 A;  2ZH2 A;  3MGH A;  3L9D A;  1ZQB A;  5DDM A;  5BPC A;  2BCR A;  5J0W A;  1MQ3 A;  4JWN A;  4RQ0 A;  4Z6E A;  2BPF A;  2BCV A;  8ICM A;  7ICH A;  4X0B A;  5D49 A;  4M5D A;  8ICP A;  4RT3 A;  1VJ7 A;  3JPR A;  4UD4 A;  3JPS A;  2O5A A;  4UAW A;  1ZQH A;  9ICR A;  5J2F A;  4Z6F A;  4PPX A;  1BPZ A;  3RJF A;  3B0Y A;  8ICW A;  1MQ2 A;  4NXX A;  9ICG A;  4KLI A;  2M2V A;  3H37 A;  2O1P A;  4AT7 A;  4MKP A;  3UQ0 A;  4IQV A;  8ICF A;  4KLO A;  4GXK A;  7ICP A;  7ICQ A;  4NY8 A;  4R66 A;  4KM5 A;  4FH3 A;  1R8B A;  4LEY A;  1FA0 A;  8ICT A;  3RJJ A;  4WC5 A;  3OVB A;  4NKU A;  2VAN A;  2IHM A;  4OAH A;  4MFA A;  4YMO A;  7ICV A;  4AT9 A;  2Q66 A;  4O67 A;  4LZD A;  5IIK A;  4JWM A;  7ICE A;  3TFR A;  1ZQI A;  3C5F A;  4O9M A;  4LEV A;  3JPN A;  5DB9 A;  5J2C A;  3HIY A;  4DO9 A;  3AU6 A;  1ZQT A;  1BPD A;  1ZQF A;  4KLQ A;  2ZH7 A;  4PHA A;  7ICI A;  8ICB A;  4K8V A;  4PHE A;  4NXZ A;  1JMS A;  4WCW A;  3WFO A;  5J2A A;  4UAY A;  4UD5 A;  4M9L A;  4RQ3 A;  4QZG A;  4QZ8 A;  4IQT A;  4OAI Z;  3RJG A;  5HC9 A;  4K4H A;  3JYY A;  1R89 A;  4I28 A;  1TV9 A;  3RJK A;  3UPQ A;  1ZQA A;  9ICX A;  8ICU A;  1V4A A;  4QZC A;  4NLN A;  4OAG A;  8ICO A;  4X4O A;  5D46 A;  2I9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...