4FI5A

Crystal structure of the n-terminal domain of hantaan virus strain 76-118 nucleoprotein
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
71
structure length
71
Chain Sequence
SMTMEELQREINAHEGQLVIARQKVRDAEKQYEKDPDELNKRTLTDREGVAVSIQAKIDELKRQLADRIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the N-terminal domain of Hantaan virus strain 76-118 nucleoprotein
rcsb
source organism Hantaan virus
molecule tags Viral protein
molecule keywords Nucleoprotein
total genus 34
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2012-06-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4fi5A00
2X9XA 2XTLA 3FXDB 2KWIB 3CKDA 1LVFA 3L3PA 3CVRA 4FI5A 1LRZA 4B6XA 2C5IT 1IJ6A 1Z0PA 3TKLB 3S4UA 2X9YA 4CQIA 2IC9A 1QSDA 1H7CA 1ZKEA 2MBGA 2IC6A 3P7IA 3QK6A 2G0UA 2CA5A 3N5LA 2K48A 4DNDA 2C5JA 4J2CA 2C5KT 4L0RA 3MXZA 2KWHA 4EYYR 3FXEB 2X9WA 1IJ5A 3QUJA
chains in the Genus database with same CATH superfamily
4COFA 2A9UA 3CIRA 2LOPA 4KX6A 2W61A 2Q9QA 1ZV4X 3P4QA 3IBPA 2XQ8A 5KXJA 2WWVA 4DIDB 2ZM6T 4QWNB 1WCRA 1FMWA 2FBWA 4E7SA 4UV9B 4DUYT 3LK3B 4QHOA 3OJAA 4EAHA 3NRYA 2LSKA 5ABEA 2XQ9A 1ZKEA 3T1HT 1YKEB 3ZC0A 3ANWA 5JRCA 3A7MA 2J47A 2MYSA 2VWAA 4DMVA 2G0UA 2CBIA 2PJQA 3CK6A 4F6RC 3DTOA 5JQGE 2WY2A 3N9MA 4A5XA 4JI0T 4UVBB 1BR2A 5IHYA 2UXCT 2DWKA 3ZC1A 3ZJ1A 5FL1A 1HF8A 2LSYA 4JEHB 2XAJB 3AA6B 3AA0B 5AQTB 3PTRB 4WZXA 3B13A 2VURA 2JQQA 2X9WA 3IHRA 1W0BA 3VU7H 4ZZBA 2KSRA 3KDSE 2X9XA 4AQGA 4CXXA 5LHHB 1WYBA 4TWFA 5L47A 4AQFA 4NUVA 3KVBA 4U7IA 4ILBA 5JR9B 2ES0A 3FHNA 4JI6T 3O4XE 5JRCB 3NWIA 2YEVC 4MLKA 5HXSA 4ANJA 3CQGB 2BS3A 4AKLA 3PU8A 4YY3T 4HFHA 4CN6A 2X9YA 2DNXA 1HG2A 4H9QC 1QSDA 2V7JA 3RIUC 2VVNA 4CQIA 5A1LA 4H63V 1HX1B 2CMRA 2KT9A 2RPAA 5F8PA 2HN1A 2VL8A 2LEHA 4IIJE 2IUBA 1I94T 4GKJT 2UU9T 2UXXB 5FVKA 3RRWA 2LKHA 2W67A 1D1CA 4V1Av 4EB6E 2HH7A 1D0XA 3AEAA 3K3QC 4KI0F 4OK0A 2FJBA 2WU2A 1B7TA 4ZS2A 3RYFE 4I4TE 3ZT7A 2NOXA 2W66A 5AQPB 1U4QA 2DHRA 4IE6A 3U78A 4HEAA 4X1IE 2LLYA 4UR9A 3AE6A 4LF5T 2AXDS 3IA3A 2KNDA 3G06A 3AA1B 3PURA 3ZN1B 4F8HA 4WYVA 3RX6A 2WMOA 3EABA 2Y6XA 3M65A 2CRBA 3JC6C 5HWXA 2OLTA 5HXEA 4JYAT 1ZHCA 2I59A 1W9RA 4PW8A 2E9XC 5AQMB 1N34T 1Z0PA 1HG5A 2YDSA 3S4UA 1NAFA 5HCJA 4HFDA 3ZSTA 3P4WA 1KK7A 3NVOA 1BR0A 3QK6A 5L3FB 3ZSSA 1WLXA 3MK7C 2IDOB 2WCAA 4PFOA 2X0LB 1W09A 2XQ6A 3OYZA 3PUSA 2ACZA 3QB5A 5JDMA 4ZOLE 2WZHA 2JQ9A 3N9NA 2GK9A 4OHFA 5FY1A 3RQWA 4A97A 5CA0E 5LJNA 4MFRA 2YOEA 3CPZA 2M6BA 2Q9QB 3UUMA 4JI5T 2IHR1 1T98A 3HKEE 4YXDA 2WBLA 2YDQA 5AQKB 5IUXA 4HKAA 3OTOT 2FJAA 2LRKA 3HKBE 3AE2A 1N32T 3SFEA 3ZEFB 3AVRA 5L3CB 3VHLA 3VRBA 3HKDE 4JBWF 4P09A 2E2AA 2XUEA 3QC9A 4AKIA 1OEDC 3LSVA 5AQVB 1QLBA 2VQET 3AXJA 3B5MA 4H9PC 2BBHA 3E08A 4N78D 4QX7B 2VL0A 3ZMUB 4PJJA 5L2LA 5JREA 2UXNB 2H7OA 5FMNA 1XWMA 3LG7A 4IT4A 3KVAA 4LMKA 3N9PA 2KLQA 2Z6EA 4MBQA 2CLYC 4JEUB 4KMCA 2LSIA 2ZM0A 2MTQA 2YN6A 3GWHA 3LJCA 4DV1T 5LOVE 4IDZA 3ETUA 1MMDA 1XZYA 4L0RA 5HEUA 4LF7T 2B76A 4QXCB 1UURA 1IAPA 2J62A 2LHRA 2BG9E 3AEBA 3KINB 3EUHA 1Z8UA 5AQQB 5E0OA 5L3EB 4P0AA 4QH5A 3EAMA 3RHWA 1SHZC 2WU5A 3I0OA 4DR1T 4IDOA 2UUBT 4DR7T 5LXTE 3CQXC 5AQUB 5HXCA 2D0TA 4X20E 2A3DA 2N1GA 2LOSA 2VKOA 2ZMAA 3EDUA 1G8XA 4UVCB 4ISSA 4EZHA 2LT3A 2VB6A 5EK4A 3Q5XA 2JMKA 4C91A 1IZNB 2V5DA 4TUYE 1WR6A 2XAFB 4YHJA 4I43B 5LBMA 3CX7B 4YT0A 2QYWA 1OXZA 3AEDA 2NW9A 3NRXA 2YU2A 4E7ZA 1E7PA 2WAUA 2FJDA 2VKDA 3OPCA 1Y01A 4L9IA 3KV6A 4Q25A 4OYKA 2ZM8A 2LHNA 3FZHB 2BG9A 1FIOA 4DO0A 3I9YA 4J2CA 1XDPA 5HEOA 4LF4T 3X1DA 5LB7B 1X79A 3HA4A 5JR9C 5AQRB 3O9XA 4AKGA 3V5UA 4DV4T 5J0ZA 4TWHA 1HCIA 4WBNE 5BR8T 3E22E 1E1HB 2BG9B 3DP7A 3IF8B 4UF0A 5DJQC 3ZJ2A 1LKXA 2WDRA 1ZOYA 2XM2A 3PU3A 4IE7A 2X67A 5C2TA 4JI4T 4IE0A 3SWHA 1HR0T 4ZI3D 3AXJB 4IHJE 4TX5A 1MMGA 2IIUA 3LFMA 4IREA 4X1KE 3D0TA 5ABHA 5GONE 5KMGP 1IJ6A 4X65T 2LSGA 2NTXA 1XMQT 1BR1A 5J1GA 2MBGA 1XDOA 2NW8A 1XMOT 2VKHA 5LBQB 3UFEA 3N2KE 2D2SA 5HXHA 5LMUT 1VCTA 3RYIE 4GKKT 2IAKA 1FMVA 5FXWA 4AI6A 2DWGA 1X9BA 2XAHB 3PUYF 4U74A 3RPUA 3UQ4A 4YTNA 5HCMA 4LF9T 2X0HA 3PE0A 2Y48B 2XAGB 4LF6T 3MKDA 2MOZA 5JH7E 2E9XB 3ZMTB 2XTLA 3PUWF 2EHOA 4EZ4A 1YW0A 3ZMSB 5AQSB 2V8SV 2VKJA 2JRKA 3AE7A 3EVYA 4CN1A 3ONLC 4PAGA 1LRZA 3RRCA 4JLEA 3I9WA 4JI2T 4H9RC 4WBOA 5DQVA 2UXDT 4I0UA 4HWDA 4TWDA 5KDMC 2CLYB 1T8BA 2WB5A 2ZLYA 1ZP0A 2V6YB 4B6XA 5LNKA 2WP9A 1N33T 4H63H 1VRBA 4LMJA 3RYCE 5IWAT 2PBIA 2V7LA 4QXHB 1M62A 4QH1A 4HGAA 1FEWA 3T1YT 4NXMT 4LFBT 1YKHB 3H3AA 5F5WA 3AE3A 1GQEA 1D0ZA 4PJNA 5DQWA 1T7SA 2YDRA 3AVSA 5F3JA 5JDNA 2F4VT 5FP3A 1EZ3A 2VVSA 4CXWA 3VR9A 5LYJE 1D1AA 3PUAA 4MHCA 4ZHQE 1SA0E 4NUUA 1N36T 2CEAA 4JV5T 3C50A 3UU3A 4P0BA 4IDQA 4K0UA 2W2UA 3Q5DA 3CQCB 5BMVE 5LMNT 3AEFA 4CZZB 1LVFA 4ILCA 3CVRA 2I6HA 3C4ZA 3O1JA 1JNZA 3HI2A 4OYJA 4GK0E 3RYHE 1MIVA 3AE9A 4L5GA 1KNZA 4IGUA 2C0SA 2BBJA 4Z90A 1W0AA 2XQYA 1MIYA 5L3DB 5CFBA 2CCQA 3N5LA 2BS2A 2JIWA 2H7VC 2XY8B 3UU6A 3ZMVB 3HR0A 4G2AA 4UELA 1O3XA 4BJMA 4YTPA 2V5CA 4PNIA 3SFDA 4DVDA 3F31A 4HFBA 4JI8T 3F2EA 2BZBA 2EHOD 4XBFB 2XQAA 3VKGA 3NZPA 4WNKA 1WRDA 1YD8G 3EDVA 4O4HE 3P4RA 3KV5A 3PUGA 3QB5K 4TNWA 3ZN0B 2CXDA 2LKGA 2X0YA 2E9XD 2VK9A 5M4YA 3L3PA 4YSXA 5L4HA 2X9HA 4NPPA 4EGWA 4KP3C 3LBXB 3BQLA 5JTGA 2K9AA 1IBLT 3L09A 1HNXT 3QOFA 1J5ET 5ADXL 3ZMZB 2BKOA 4JUYA 4TV8E 4A98A 3DJBA 2UXBT 1G73A 5TAOA 4EYUA 5FYMA 5JDHA 5AQOB 1WYCA 3C4WA 2Q9QC 3F57A 3FZLB 4LF8T 4ZI7E 4ZS3A 5LHIB 4B3TT 1MIWA 2WM9A 4YTMA 1R8IA 1KEYA 1BR4A 4HE8A 4IE5A 1YQ4A 2XM1A 2D5UA 2P9BA 4ILAA 1YXRA 5HAXA 3SRZA 1UCUA 5CB4E 1IBKT 4LFCT 3FXEB 3N2GE 5FY0A 3WAKA 1NWMX 2IC9A 2NR4A 3MA9A 3SOLA 4DV0T 3AAAB 1AJ3A 1OEDB 5JVDE 3AE5A 4H9OC 2XASB 2MAWA 1E2AA 1KF6A 1HX8A 2KWIB 2Y8DA 3K3NA 3K3OA 4O2AE 4O8SA 4P1NA 2DLRA 5HEHA 2I0MA 3RKOA 1S94A 3V5SA 4EEBA 4HWHA 3ABVA 4DV7T 3C51A 1J5WA 5AFUL 4MALA 1OEDE 1XNRT 1UX5A 2YK0A 2ODUA 4HFEA 2C5IT 3WI3A 5LHGB 3K8PC 5AQIB 2OA5A 2UUCT 3H37A 3MZKB 4ERRA 4CI2B 5L3GB 1KFYA 1H7CA 2H89A 2N2NA 4ISTA 5LP6E 4AQYT 4TN7B 4I55E 3HL6A 3AA7B 4JI7T 3GA8A 4U2YA 1V9DA 1MMAA 3HKCE 4QXBB 5JDFA 4LFAT 3L39A 3AEEA 3MJXA 3KV9A 2A2FX 2XPKA 4CI1B 2V6XA 3QNUA 4O4IE 4X66T 2C5KT 1NENA 2CXFA 3A8YC 3VR8A 2X68A 2KXPB 2E9XA 3UU5A 2IMLA 1T72A 3RIUA 2L9QA 1IJ5A 4DNDA 3QUJA 3TLVA 3R84B 2QA7A 3UUNA 3UULA 4JI1T 4C90A 3RQUA 4FI5A 4DBRA 2L8KA 2XZEA 3AB3B 3Q9DA 2XQ5A 1KNPA 3JAEA 3C64A 4TZ4C 1HFAA 3RH3A 4EV6A 1M7KA 5AQNB 3C98B 2QRXA 5LGTB 3CX8B 4GIWA 2WMNA 1OWAA 5H6QB 2ACXA 3KBTA 3J7Yq 5FL0A 5EK3A 4ZXLA 4YSYA 2MPKA 3CWZB 1HS7A 1IBMT 3LDQB 3FB2A 4I50E 4AXPA 4QX8B 5LJMA 5HEJA 2E5LT 1WR0A 4GYSA 2IW5B 5FY7A 2FUPA 3MXZA 3UUBA 4DV2T 2ZM2A 5LCYA 1FJGT 3TLTA 4DR3T 4DR4T 4ZI3C 1UUSA 3GN5A 4AIUA 4GOUA 5HYAA 3ONJA 2R6GF 2WZIA 4AQFC 3PJAA 3FBLA 4GK5E 2D9DA 3PUVF 4HTEA 3PJAJ 3RGLA 2BVLA 2XJ7A 4U3CA 2CHNA 3UU4A 3GMIA 5FXZA 3ZYMA 2LE8A 2JMHA 2W4XA 3TLSA 2HN2A 4BA9A 3PV0F 5ETWA 4H9NC 3SS1A 1D1BA 3TKLB 4YSZA 3ETVA 3H3MA 3ZCIA 4CI3B 3OYXA 5LGNB 1UGOA 2XQ3A 3LK42 3KFWX 4G63A 2NWBA 3OKQA 5LA6E 3VKHA 3LBXA 4ZI2C 3UU8A 4EXTA 3AAIA 3IEEA 3WAJA 3AE1A 4B3ST 2PG8A 4O4LE 4EIWA 4UF0B 1HNWT 3RIFA 2CHOA 1JNRA 5CA1E 1U5PA 1OEDA 2E5VA 2JQHA 5H6RB 2CPTA 3BQIA 4DBQA 1WFDA 3R6NA 4AKRB 4CN4A 5AQHB 3VRAA 4KHPT 2RP4A 2VQFT 3CMLA 2QGSA 3JADA 2YKSA 4X62T 2JPFA 2W0GA 4O4JE 3FXDB 1CHUA 3N2OA 2EHOC 2V6YA 1QUUA 3N9LA 2UUAT 4ADZA 1MNDA 5L4EA 4YHHT 3K1SA 3ZKRA 2J1DG 5HEGA 3J9X1 2BDEA 2CE7A 3LK2B 2PFVA 4KUMB 3U3IA 4GYRA 2CM0A 2FJEA 2JQKA 2ODVA 5HXRA 2YINA 2J4GA 2EHOB 4HN9A 4Z91A 2A72A 5AQGB 1L0VA 2V7KA 4IDPA 2IC6A 4HWFA 2H3RA 3P4PA 5JDGA 4ILUA 2CA5A 1HTJF 4XZCA 4TV9E 3KBUA 2C5JA 3N9OA 5FNVE 2AE9A 4IL9A 2NP9A 2VASA 2W62A 2X51A 4U2ZA 4OFZA 2WSSV 2JJ9A 4X64T 2KWHA 1ZEEA 3NZQA 3ZT5A 1HNZT 5C8YE 5JDLA 3MACA 2HPJA 3A5XA 2XHEB 5J2UE 4AISA 4ASKA 2XAQB 5AQLB 5HWYA 3RF1A 4DMWA 3ZT6A 3NKZA 5LGUB 3ONXA 3Q5EA 3ZYLA 3KV4A 2X66A 5AQFB 5LG3A 5FKYA 4PK4A 4LMLA 5EK2A 2HPLA 3UUXB 4OX9T 1I6ZA 3BQKA 3Q5WA 4TNVA 2H88A 3L8RA 2CXLA 5J2TE 2B1EA 5LG4A 1NEKA 2KINB 3PUQA 3RC3A 4WW0A 2RA1A 4HWIB 3FZFB 2K48A 3GN5B 3B57A 3PDYA 2W63A 5IYZE 3TLWA 3EI0A 2BKPA 2V26A 3ESLA 2LSJA 4X1YE 4ZZCA 2XQ7A 5FVLA 4CXYA 3AECA 3NBXX 3M3ZB 2K5BB 4PFPA 2SPCA 2XSBA 4NIQA 4A56A 1SUMB 1Y64B 2KMFA 2WDQA 3JC6D 2M6IA 4EYYR 3ZLIA 4YJ3E 3EHZA 3TLUA 4AKHA 1UX4A 4PK6A 5JDQA 4U7YA 3P4SA 4HFCA 2M67A 2OV9A 2D0UA 4IDNA 2N9DA 2LM2A 4EOZB 1D0YA 3I1AA 2XQ4A 4PK5A 4UV8B 3UT5E 4EEDA 1VCSA 4DV5T 4M1PA 2Q9QD 4H9SE 2CWYA 4UIGA 3N9QA 4QKNA 1MNEA 2DL1A 1LVKA 3PUXF 4PJLA 2NTYA 4YFSA 2V7MA 4JI3T 1XNQT 4DV3T 1KNRA 5ABGA 3W15B 1J1JA 2YU1A 3AE4A 3ZYKA 1YQ3A 2BG9C 2XSAA 4DV6T 3CX6B 3FZMB 3RI5A 2WDVA 2WS3A 5AQJB 1DU2A 1MMNA 5JR9A 3ZCJA 2BKNA 4HFIA 4U33A 4K0KT 3I0QA 3AE8A 4HFVA 2E8IA 4X5TA 4BAYB 4DR2T 2DCFA 2L3LA 4UVAB 3RIAA 4YJ2E 4UEMA 3AAEB 2WQYA 3OVUA 4U72A 2WWUA 1US7B 2W00A 4PJMA 3CKDA 3P8CD 2LJLA 3PUZF 3Q2MA 3O1IA 4HWCA 3RKGA 4ZEYA 2HHHT 3RLFF 3UFGA 3FBZA 4YLHA 1SE7A 3ZPOA 4Z8XA 2DI4A 4DR5T 4XAXB 4B3RT 5ABFB 5FXVA 3ANWB 2CBJA 5CJ5A 5FXXA 4KHZF 5EZYE 3OBVE 4IL4A 3UQ7A 2CWOA 4BJNA 4DR6T 5L3BB 3E0ZA 1UK5A 2K24A 4KBMB 3UTKA 5KX5E 2LRLA 3C4XA 3P7IA 2PTFA 4FJOA 2BS4A 4QH4A 5CGMA 4NXNT 2BVMA 3FZKB 5DABA 3AEGA 5C3JA 1S35A 2NW7A 4UXNB 2V7IA 1CUNA 5ABFA 4ZI2D 1VOMA 3JCFA 4O2BE 4DUZT 3BK9A 2K3WA 2V1DB 3P50A 2KZ7B 2QVAA 3O1HA 4B3MT 3JAFA 2LM9A 4U31A 3T8OA 3RC8A 4IE4A
chains in the Genus database with same CATH topology
2LOPA 2W61A 2Q9QA 1ZV4X 3IBPA 4QWNB 4E7SA 1FMWA 4UV9B 3LK3B 4QHOA 3OJAA 4EAHA 3NRYA 2LSKA 1ZKEA 1YKEB 3ZC0A 3ANWA 5JRCA 2MYSA 2VWAA 4DMVA 2G0UA 4F6RC 2PJQA 3DTOA 5JQGE 3N9MA 4UVBB 1BR2A 5IHYA 2DWKA 3ZC1A 3ZJ1A 1HF8A 2LSYA 4JEHB 2XAJB 3AA6B 3AA0B 3PTRB 3B13A 2JQQA 2X9WA 3IHRA 3VU7H 4CXXA 3KDSE 2X9XA 4AQGA 5LHHB 1WYBA 4AQFA 4NUVA 3KVBA 5JR9B 2ES0A 3FHNA 3O4XE 5JRCB 2YEVC 4MLKA 5HXSA 4ANJA 3CQGB 4AKLA 3PU8A 2X9YA 2DNXA 1HG2A 4H9QC 1QSDA 2V7JA 4CQIA 5A1LA 4H63V 2CMRA 2KT9A 5F8PA 2VL8A 2LEHA 4IIJE 2UXXB 3RRWA 4EB6E 4V1Av 1D1CA 2HH7A 1D0XA 3K3QC 4OK0A 5LYJE 1B7TA 4ZS2A 4I4TE 2NOXA 1U4QA 2DHRA 4IE6A 3U78A 4HEAA 4X1IE 3ZN1B 2KNDA 3AA1B 3PURA 3RX6A 2WMOA 2Y6XA 3M65A 5HWXA 3JC6C 5HXEA 1ZHCA 2I59A 4PW8A 2E9XC 1Z0PA 1HG5A 3S4UA 1NAFA 1KK7A 1BR0A 3QK6A 5L3FB 1WLXA 3MK7C 3RYFE 4PFOA 5JDMA 2X0LB 3OYZA 3PUSA 4ZOLE 3N9NA 2GK9A 4OHFA 5FY1A 5LJNA 5CA0E 4MFRA 3CPZA 2Q9QB 3UUMA 1T98A 3HKEE 2WBLA 4HKAA 3HKBE 3ZEFB 3AVRA 5L3CB 3VHLA 3HKDE 4P09A 2XUEA 3QC9A 4AKIA 4H9PC 3E08A 4QX7B 4N78D 3ZMUB 4PJJA 5L2LA 5JREA 2UXNB 2H7OA 5FMNA 3LG7A 3KVAA 4MBQA 3N9PA 2KLQA 2Z6EA 4O4LE 2CLYC 4JEUB 4KMCA 2LSIA 2ZM0A 2MTQA 3GWHA 3ZYMA 3LJCA 5LOVE 4IDZA 3ETUA 1MMDA 4L0RA 4QXCB 1IAPA 2LHRA 3KINB 3EUHA 5L3EB 4P0AA 5E0OA 1SHZC 3I0OA 5LXTE 3CQXC 5HXCA 2D0TA 4X20E 2A3DA 2N1GA 2LOSA 2VKOA 2ZMAA 3EDUA 1G8XA 4UVCB 4ISSA 4EZHA 2LT3A 2VB6A 5EK4A 3Q5XA 2JMKA 4C91A 1IZNB 4TUYE 1WR6A 2XAFB 4YHJA 4I43B 5LBMA 3CX7B 1OXZA 2NW9A 3NRXA 2YU2A 4E7ZA 2WAUA 2VKDA 4L9IA 3KV6A 4OYKA 2ZM8A 2LHNA 4DO0A 1FIOA 3I9YA 4J2CA 1X79A 3HA4A 5JR9C 3O9XA 4AKGA 3V5UA 4WBNE 1HCIA 3E22E 1E1HB 3DP7A 3IF8B 4UF0A 5DJQC 3ZJ2A 1LKXA 3PU3A 4IE7A 2X67A 4IE0A 3SWHA 4ZI3D 4IHJE 4TX5A 1MMGA 3LFMA 4X1KE 3D0TA 5GONE 5KMGP 1IJ6A 2LSGA 2NTXA 1BR1A 5J1GA 2MBGA 2NW8A 2VKHA 5LBQB 3UFEA 3N2KE 2D2SA 5HXHA 3RYIE 2IAKA 1FMVA 5FXWA 4AI6A 2DWGA 4U74A 2XAHB 3RPUA 3PE0A 2Y48B 2XAGB 3MKDA 2MOZA 5JH7E 2E9XB 3ZMTB 2XTLA 4EZ4A 2EHOA 1YW0A 3ZMSB 2VKJA 2JRKA 3EVYA 4PAGA 1LRZA 3RRCA 4JLEA 3I9WA 4H9RC 4WBOA 5DQVA 5KDMC 2CLYB 4B6XA 5LNKA 2ZLYA 4H63H 1VRBA 3RYCE 2PBIA 2V7LA 4QXHB 4HGAA 1FEWA 1YKHB 3H3AA 3J9X1 4PJNA 1D0ZA 5DQWA 5F3JA 5JDNA 3AVSA 5FP3A 1EZ3A 4CXWA 1D1AA 3PUAA 4MHCA 4ZHQE 1SA0E 4NUUA 2CEAA 3C50A 4P0BA 4K0UA 5BMVE 3CQCB 4CZZB 1LVFA 3CVRA 3C4ZA 3O1JA 3HI2A 3RYHE 4OYJA 4GK0E 1MIVA 4L5GA 1KNZA 4IGUA 2C0SA 2XQYA 1MIYA 5L3DB 2CCQA 3N5LA 3ZMVB 2H7VC 4BJMA 3HR0A 4G2AA 4UELA 1O3XA 4PNIA 4DVDA 3F31A 3F2EA 2BZBA 2EHOD 4XBFB 3VKGA 3NZPA 4WNKA 1WRDA 1YD8G 3EDVA 4O4HE 3PUGA 3KV5A 3ZN0B 2CXDA 5M4YA 2E9XD 2VK9A 3L3PA 2X9HA 4KP3C 3LBXB 3BQLA 2K9AA 3L09A 5ADXL 3ZMZB 4JUYA 4TV8E 3DJBA 1G73A 5TAOA 4EYUA 5FYMA 5JDHA 1WYCA 3C4WA 2Q9QC 3F57A 4ZI7E 4ZS3A 5LHIB 1MIWA 2WM9A 1BR4A 4HE8A 4IE5A 2D5UA 2P9BA 5HAXA 3SRZA 1UCUA 5CB4E 3FXEB 3N2GE 5FY0A 3WAKA 1NWMX 2IC9A 3MA9A 3SOLA 1AJ3A 3AAAB 5JVDE 4H9OC 2XASB 2Y8DA 2KWIB 3K3NA 1HX8A 3K3OA 4O2AE 4O8SA 3RKOA 2DLRA 3V5SA 1S94A 3C51A 5AFUL 4MALA 1UX5A 2YK0A 2ODUA 2C5IT 3WI3A 5LHGB 3K8PC 2OA5A 3H37A 3MZKB 4ERRA 4CI2B 5L3GB 4ISTA 1H7CA 2N2NA 5LP6E 4TN7B 4I55E 3HL6A 3AA7B 3GA8A 5JDFA 1V9DA 1MMAA 3HKCE 4QXBB 3MJXA 3KV9A 2A2FX 4CI1B 4O4IE 2C5KT 2CXFA 2X68A 2KXPB 2E9XA 2L9QA 1IJ5A 4DNDA 3QUJA 3R84B 2QA7A 3UUNA 3UULA 4C90A 4DBRA 4FI5A 2L8KA 3AB3B 3Q9DA 3RH3A 3C64A 4TZ4C 1HFAA 3C98B 5LGTB 3CX8B 4GIWA 2WMNA 1OWAA 5H6QB 2ACXA 3KBTA 3J7Yq 5EK3A 3CWZB 1HS7A 3FB2A 4I50E 4AXPA 4QX8B 5LJMA 4GYSA 2IW5B 5FY7A 3MXZA 2ZM2A 5LCYA 4ZI3C 3GN5A 5HYAA 4GOUA 4AQFC 3FBLA 4GK5E 4HTEA 2BVLA 3GMIA 5FXZA 2LE8A 2JMHA 4BA9A 5ETWA 4H9NC 3SS1A 1D1BA 3TKLB 3ETVA 3ZCIA 4CI3B 3OYXA 5LGNB 3LK42 3KFWX 4G63A 2NWBA 3OKQA 5LA6E 3VKHA 3LBXA 4ZI2C 3WAJA 4EXTA 3AAIA 3IEEA 2PG8A 4EIWA 4UF0B 5CA1E 1U5PA 5H6RB 3BQIA 4DBQA 3R6NA 4AKRB 2RP4A 3CMLA 2QGSA 2W0GA 2JPFA 4O4JE 3FXDB 3N2OA 2EHOC 1QUUA 3N9LA 4ADZA 1MNDA 4BJNA 2J1DG 3U3IA 2BDEA 2CE7A 3LK2B 2PFVA 4KUMB 4GYRA 2CM0A 2ODVA 5HXRA 2YINA 2EHOB 4HN9A 2A72A 2V7KA 2IC6A 2H3RA 5JDGA 4ILUA 2CA5A 1HTJF 4XZCA 4TV9E 3KBUA 2C5JA 3N9OA 5FNVE 2NP9A 2VASA 2W62A 2X51A 4OFZA 2WSSV 2JJ9A 2KWHA 1ZEEA 3NZQA 5C8YE 5JDLA 3MACA 2HPJA 3A5XA 2XHEB 5J2UE 4ASKA 2XAQB 4DMWA 5HWYA 5LGUB 3ONXA 3ZYLA 3KV4A 2X66A 4PK4A 5EK2A 2HPLA 3UUXB 3BQKA 3Q5WA 5J2TE 2CXLA 2B1EA 5LG4A 2KINB 3PUQA 3RC3A 4WW0A 2RA1A 2K48A 3GN5B 3B57A 3PDYA 2W63A 5IYZE 2V26A 3ESLA 2LSJA 4X1YE 4CXYA 3NBXX 2K5BB 4PFPA 2SPCA 4A56A 2KMFA 1Y64B 3JC6D 4EYYR 3ZLIA 4YJ3E 4AKHA 1UX4A 4PK6A 5JDQA 2M67A 2D0UA 2N9DA 4EOZB 1D0YA 3I1AA 3UT5E 4PK5A 4UV8B 4M1PA 2Q9QD 4H9SE 2CWYA 4UIGA 3N9QA 4QKNA 1MNEA 1LVKA 4PJLA 2NTYA 4YFSA 2V7MA 3W15B 2YU1A 3ZYKA 3CX6B 1MMNA 5JR9A 3ZCJA 3I0QA 4HFVA 2E8IA 4BAYB 2DCFA 2L3LA 4UVAB 4YJ2E 4UEMA 3AAEB 4U72A 2WWUA 1US7B 2W00A 4PJMA 3CKDA 3P8CD 2LJLA 3Q2MA 3O1IA 3FBZA 4YLHA 3ZPOA 4Z8XA 2DI4A 4XAXB 5FXVA 3ANWB 5FXXA 5EZYE 3OBVE 2CWOA 5L3BB 3E0ZA 2K24A 4KBMB 3UTKA 5KX5E 3C4XA 3P7IA 4FJOA 2BVMA 5DABA 1S35A 2NW7A 4UXNB 2V7IA 1CUNA 4ZI2D 1VOMA 4O2BE 3BK9A 2V1DB 2KZ7B 3O1HA 2LM9A 3T8OA 3RC8A 4IE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X9X A;  2XTL A;  3FXD B;  2KWI B;  3CKD A;  1LVF A;  3L3P A;  3CVR A;  4FI5 A;  1LRZ A;  4B6X A;  2C5I T;  1IJ6 A;  1Z0P A;  3TKL B;  3S4U A;  2X9Y A;  4CQI A;  2IC9 A;  1QSD A;  1H7C A;  1ZKE A;  2MBG A;  2IC6 A;  3P7I A;  3QK6 A;  2G0U A;  2CA5 A;  3N5L A;  2K48 A;  4DND A;  2C5J A;  4J2C A;  2C5K T;  4L0R A;  3MXZ A;  2KWH A;  4EYY R;  3FXE B;  2X9W A;  1IJ5 A;  3QUJ A; 
#chains in the Genus database with same CATH topology
 4COF A;  2A9U A;  3CIR A;  2LOP A;  4KX6 A;  2W61 A;  2Q9Q A;  1ZV4 X;  3P4Q A;  3IBP A;  2XQ8 A;  5KXJ A;  2WWV A;  4DID B;  2ZM6 T;  4QWN B;  1WCR A;  1FMW A;  2FBW A;  4E7S A;  4UV9 B;  4DUY T;  3LK3 B;  4QHO A;  3OJA A;  4EAH A;  3NRY A;  2LSK A;  5ABE A;  2XQ9 A;  1ZKE A;  3T1H T;  1YKE B;  3ZC0 A;  3ANW A;  5JRC A;  3A7M A;  2J47 A;  2MYS A;  2VWA A;  4DMV A;  2G0U A;  2CBI A;  2PJQ A;  3CK6 A;  4F6R C;  3DTO A;  5JQG E;  2WY2 A;  3N9M A;  4A5X A;  4JI0 T;  4UVB B;  1BR2 A;  5IHY A;  2UXC T;  2DWK A;  3ZC1 A;  3ZJ1 A;  5FL1 A;  1HF8 A;  2LSY A;  4JEH B;  2XAJ B;  3AA6 B;  3AA0 B;  5AQT B;  3PTR B;  4WZX A;  3B13 A;  2VUR A;  2JQQ A;  2X9W A;  3IHR A;  1W0B A;  3VU7 H;  4ZZB A;  2KSR A;  3KDS E;  2X9X A;  4AQG A;  4CXX A;  5LHH B;  1WYB A;  4TWF A;  5L47 A;  4AQF A;  4NUV A;  3KVB A;  4U7I A;  4ILB A;  5JR9 B;  2ES0 A;  3FHN A;  4JI6 T;  3O4X E;  5JRC B;  3NWI A;  2YEV C;  4MLK A;  5HXS A;  4ANJ A;  3CQG B;  2BS3 A;  4AKL A;  3PU8 A;  4YY3 T;  4HFH A;  4CN6 A;  2X9Y A;  2DNX A;  1HG2 A;  4H9Q C;  1QSD A;  2V7J A;  3RIU C;  2VVN A;  4CQI A;  5A1L A;  4H63 V;  1HX1 B;  2CMR A;  2KT9 A;  2RPA A;  5F8P A;  2HN1 A;  2VL8 A;  2LEH A;  4IIJ E;  2IUB A;  1I94 T;  4GKJ T;  2UU9 T;  2UXX B;  5FVK A;  3RRW A;  2LKH A;  2W67 A;  1D1C A;  4V1A v;  4EB6 E;  2HH7 A;  1D0X A;  3AEA A;  3K3Q C;  4KI0 F;  4OK0 A;  2FJB A;  2WU2 A;  1B7T A;  4ZS2 A;  3RYF E;  4I4T E;  3ZT7 A;  2NOX A;  2W66 A;  5AQP B;  1U4Q A;  2DHR A;  4IE6 A;  3U78 A;  4HEA A;  4X1I E;  2LLY A;  4UR9 A;  3AE6 A;  4LF5 T;  2AXD S;  3IA3 A;  2KND A;  3G06 A;  3AA1 B;  3PUR A;  3ZN1 B;  4F8H A;  4WYV A;  3RX6 A;  2WMO A;  3EAB A;  2Y6X A;  3M65 A;  2CRB A;  3JC6 C;  5HWX A;  2OLT A;  5HXE A;  4JYA T;  1ZHC A;  2I59 A;  1W9R A;  4PW8 A;  2E9X C;  5AQM B;  1N34 T;  1Z0P A;  1HG5 A;  2YDS A;  3S4U A;  1NAF A;  5HCJ A;  4HFD A;  3ZST A;  3P4W A;  1KK7 A;  3NVO A;  1BR0 A;  3QK6 A;  5L3F B;  3ZSS A;  1WLX A;  3MK7 C;  2IDO B;  2WCA A;  4PFO A;  2X0L B;  1W09 A;  2XQ6 A;  3OYZ A;  3PUS A;  2ACZ A;  3QB5 A;  5JDM A;  4ZOL E;  2WZH A;  2JQ9 A;  3N9N A;  2GK9 A;  4OHF A;  5FY1 A;  3RQW A;  4A97 A;  5CA0 E;  5LJN A;  4MFR A;  2YOE A;  3CPZ A;  2M6B A;  2Q9Q B;  3UUM A;  4JI5 T;  2IHR 1;  1T98 A;  3HKE E;  4YXD A;  2WBL A;  2YDQ A;  5AQK B;  5IUX A;  4HKA A;  3OTO T;  2FJA A;  2LRK A;  3HKB E;  3AE2 A;  1N32 T;  3SFE A;  3ZEF B;  3AVR A;  5L3C B;  3VHL A;  3VRB A;  3HKD E;  4JBW F;  4P09 A;  2E2A A;  2XUE A;  3QC9 A;  4AKI A;  1OED C;  3LSV A;  5AQV B;  1QLB A;  2VQE T;  3AXJ A;  3B5M A;  4H9P C;  2BBH A;  3E08 A;  4N78 D;  4QX7 B;  2VL0 A;  3ZMU B;  4PJJ A;  5L2L A;  5JRE A;  2UXN B;  2H7O A;  5FMN A;  1XWM A;  3LG7 A;  4IT4 A;  3KVA A;  4LMK A;  3N9P A;  2KLQ A;  2Z6E A;  4MBQ A;  2CLY C;  4JEU B;  4KMC A;  2LSI A;  2ZM0 A;  2MTQ A;  2YN6 A;  3GWH A;  3LJC A;  4DV1 T;  5LOV E;  4IDZ A;  3ETU A;  1MMD A;  1XZY A;  4L0R A;  5HEU A;  4LF7 T;  2B76 A;  4QXC B;  1UUR A;  1IAP A;  2J62 A;  2LHR A;  2BG9 E;  3AEB A;  3KIN B;  3EUH A;  1Z8U A;  5AQQ B;  5E0O A;  5L3E B;  4P0A A;  4QH5 A;  3EAM A;  3RHW A;  1SHZ C;  2WU5 A;  3I0O A;  4DR1 T;  4IDO A;  2UUB T;  4DR7 T;  5LXT E;  3CQX C;  5AQU B;  5HXC A;  2D0T A;  4X20 E;  2A3D A;  2N1G A;  2LOS A;  2VKO A;  2ZMA A;  3EDU A;  1G8X A;  4UVC B;  4ISS A;  4EZH A;  2LT3 A;  2VB6 A;  5EK4 A;  3Q5X A;  2JMK A;  4C91 A;  1IZN B;  2V5D A;  4TUY E;  1WR6 A;  2XAF B;  4YHJ A;  4I43 B;  5LBM A;  3CX7 B;  4YT0 A;  2QYW A;  1OXZ A;  3AED A;  2NW9 A;  3NRX A;  2YU2 A;  4E7Z A;  1E7P A;  2WAU A;  2FJD A;  2VKD A;  3OPC A;  1Y01 A;  4L9I A;  3KV6 A;  4Q25 A;  4OYK A;  2ZM8 A;  2LHN A;  3FZH B;  2BG9 A;  1FIO A;  4DO0 A;  3I9Y A;  4J2C A;  1XDP A;  5HEO A;  4LF4 T;  3X1D A;  5LB7 B;  1X79 A;  3HA4 A;  5JR9 C;  5AQR B;  3O9X A;  4AKG A;  3V5U A;  4DV4 T;  5J0Z A;  4TWH A;  1HCI A;  4WBN E;  5BR8 T;  3E22 E;  1E1H B;  2BG9 B;  3DP7 A;  3IF8 B;  4UF0 A;  5DJQ C;  3ZJ2 A;  1LKX A;  2WDR A;  1ZOY A;  2XM2 A;  3PU3 A;  4IE7 A;  2X67 A;  5C2T A;  4JI4 T;  4IE0 A;  3SWH A;  1HR0 T;  4ZI3 D;  3AXJ B;  4IHJ E;  4TX5 A;  1MMG A;  2IIU A;  3LFM A;  4IRE A;  4X1K E;  3D0T A;  5ABH A;  5GON E;  5KMG P;  1IJ6 A;  4X65 T;  2LSG A;  2NTX A;  1XMQ T;  1BR1 A;  5J1G A;  2MBG A;  1XDO A;  2NW8 A;  1XMO T;  2VKH A;  5LBQ B;  3UFE A;  3N2K E;  2D2S A;  5HXH A;  5LMU T;  1VCT A;  3RYI E;  4GKK T;  2IAK A;  1FMV A;  5FXW A;  4AI6 A;  2DWG A;  1X9B A;  2XAH B;  3PUY F;  4U74 A;  3RPU A;  3UQ4 A;  4YTN A;  5HCM A;  4LF9 T;  2X0H A;  3PE0 A;  2Y48 B;  2XAG B;  4LF6 T;  3MKD A;  2MOZ A;  5JH7 E;  2E9X B;  3ZMT B;  2XTL A;  3PUW F;  2EHO A;  4EZ4 A;  1YW0 A;  3ZMS B;  5AQS B;  2V8S V;  2VKJ A;  2JRK A;  3AE7 A;  3EVY A;  4CN1 A;  3ONL C;  4PAG A;  1LRZ A;  3RRC A;  4JLE A;  3I9W A;  4JI2 T;  4H9R C;  4WBO A;  5DQV A;  2UXD T;  4I0U A;  4HWD A;  4TWD A;  5KDM C;  2CLY B;  1T8B A;  2WB5 A;  2ZLY A;  1ZP0 A;  2V6Y B;  4B6X A;  5LNK A;  2WP9 A;  1N33 T;  4H63 H;  1VRB A;  4LMJ A;  3RYC E;  5IWA T;  2PBI A;  2V7L A;  4QXH B;  1M62 A;  4QH1 A;  4HGA A;  1FEW A;  3T1Y T;  4NXM T;  4LFB T;  1YKH B;  3H3A A;  5F5W A;  3AE3 A;  1GQE A;  1D0Z A;  4PJN A;  5DQW A;  1T7S A;  2YDR A;  3AVS A;  5F3J A;  5JDN A;  2F4V T;  5FP3 A;  1EZ3 A;  2VVS A;  4CXW A;  3VR9 A;  5LYJ E;  1D1A A;  3PUA A;  4MHC A;  4ZHQ E;  1SA0 E;  4NUU A;  1N36 T;  2CEA A;  4JV5 T;  3C50 A;  3UU3 A;  4P0B A;  4IDQ A;  4K0U A;  2W2U A;  3Q5D A;  3CQC B;  5BMV E;  5LMN T;  3AEF A;  4CZZ B;  1LVF A;  4ILC A;  3CVR A;  2I6H A;  3C4Z A;  3O1J A;  1JNZ A;  3HI2 A;  4OYJ A;  4GK0 E;  3RYH E;  1MIV A;  3AE9 A;  4L5G A;  1KNZ A;  4IGU A;  2C0S A;  2BBJ A;  4Z90 A;  1W0A A;  2XQY A;  1MIY A;  5L3D B;  5CFB A;  2CCQ A;  3N5L A;  2BS2 A;  2JIW A;  2H7V C;  2XY8 B;  3UU6 A;  3ZMV B;  3HR0 A;  4G2A A;  4UEL A;  1O3X A;  4BJM A;  4YTP A;  2V5C A;  4PNI A;  3SFD A;  4DVD A;  3F31 A;  4HFB A;  4JI8 T;  3F2E A;  2BZB A;  2EHO D;  4XBF B;  2XQA A;  3VKG A;  3NZP A;  4WNK A;  1WRD A;  1YD8 G;  3EDV A;  4O4H E;  3P4R A;  3KV5 A;  3PUG A;  3QB5 K;  4TNW A;  3ZN0 B;  2CXD A;  2LKG A;  2X0Y A;  2E9X D;  2VK9 A;  5M4Y A;  3L3P A;  4YSX A;  5L4H A;  2X9H A;  4NPP A;  4EGW A;  4KP3 C;  3LBX B;  3BQL A;  5JTG A;  2K9A A;  1IBL T;  3L09 A;  1HNX T;  3QOF A;  1J5E T;  5ADX L;  3ZMZ B;  2BKO A;  4JUY A;  4TV8 E;  4A98 A;  3DJB A;  2UXB T;  1G73 A;  5TAO A;  4EYU A;  5FYM A;  5JDH A;  5AQO B;  1WYC A;  3C4W A;  2Q9Q C;  3F57 A;  3FZL B;  4LF8 T;  4ZI7 E;  4ZS3 A;  5LHI B;  4B3T T;  1MIW A;  2WM9 A;  4YTM A;  1R8I A;  1KEY A;  1BR4 A;  4HE8 A;  4IE5 A;  1YQ4 A;  2XM1 A;  2D5U A;  2P9B A;  4ILA A;  1YXR A;  5HAX A;  3SRZ A;  1UCU A;  5CB4 E;  1IBK T;  4LFC T;  3FXE B;  3N2G E;  5FY0 A;  3WAK A;  1NWM X;  2IC9 A;  2NR4 A;  3MA9 A;  3SOL A;  4DV0 T;  3AAA B;  1AJ3 A;  1OED B;  5JVD E;  3AE5 A;  4H9O C;  2XAS B;  2MAW A;  1E2A A;  1KF6 A;  1HX8 A;  2KWI B;  2Y8D A;  3K3N A;  3K3O A;  4O2A E;  4O8S A;  4P1N A;  2DLR A;  5HEH A;  2I0M A;  3RKO A;  1S94 A;  3V5S A;  4EEB A;  4HWH A;  3ABV A;  4DV7 T;  3C51 A;  1J5W A;  5AFU L;  4MAL A;  1OED E;  1XNR T;  1UX5 A;  2YK0 A;  2ODU A;  4HFE A;  2C5I T;  3WI3 A;  5LHG B;  3K8P C;  5AQI B;  2OA5 A;  2UUC T;  3H37 A;  3MZK B;  4ERR A;  4CI2 B;  5L3G B;  1KFY A;  1H7C A;  2H89 A;  2N2N A;  4IST A;  5LP6 E;  4AQY T;  4TN7 B;  4I55 E;  3HL6 A;  3AA7 B;  4JI7 T;  3GA8 A;  4U2Y A;  1V9D A;  1MMA A;  3HKC E;  4QXB B;  5JDF A;  4LFA T;  3L39 A;  3AEE A;  3MJX A;  3KV9 A;  2A2F X;  2XPK A;  4CI1 B;  2V6X A;  3QNU A;  4O4I E;  4X66 T;  2C5K T;  1NEN A;  2CXF A;  3A8Y C;  3VR8 A;  2X68 A;  2KXP B;  2E9X A;  3UU5 A;  2IML A;  1T72 A;  3RIU A;  2L9Q A;  1IJ5 A;  4DND A;  3QUJ A;  3TLV A;  3R84 B;  2QA7 A;  3UUN A;  3UUL A;  4JI1 T;  4C90 A;  3RQU A;  4FI5 A;  4DBR A;  2L8K A;  2XZE A;  3AB3 B;  3Q9D A;  2XQ5 A;  1KNP A;  3JAE A;  3C64 A;  4TZ4 C;  1HFA A;  3RH3 A;  4EV6 A;  1M7K A;  5AQN B;  3C98 B;  2QRX A;  5LGT B;  3CX8 B;  4GIW A;  2WMN A;  1OWA A;  5H6Q B;  2ACX A;  3KBT A;  3J7Y q;  5FL0 A;  5EK3 A;  4ZXL A;  4YSY A;  2MPK A;  3CWZ B;  1HS7 A;  1IBM T;  3LDQ B;  3FB2 A;  4I50 E;  4AXP A;  4QX8 B;  5LJM A;  5HEJ A;  2E5L T;  1WR0 A;  4GYS A;  2IW5 B;  5FY7 A;  2FUP A;  3MXZ A;  3UUB A;  4DV2 T;  2ZM2 A;  5LCY A;  1FJG T;  3TLT A;  4DR3 T;  4DR4 T;  4ZI3 C;  1UUS A;  3GN5 A;  4AIU A;  4GOU A;  5HYA A;  3ONJ A;  2R6G F;  2WZI A;  4AQF C;  3PJA A;  3FBL A;  4GK5 E;  2D9D A;  3PUV F;  4HTE A;  3PJA J;  3RGL A;  2BVL A;  2XJ7 A;  4U3C A;  2CHN A;  3UU4 A;  3GMI A;  5FXZ A;  3ZYM A;  2LE8 A;  2JMH A;  2W4X A;  3TLS A;  2HN2 A;  4BA9 A;  3PV0 F;  5ETW A;  4H9N C;  3SS1 A;  1D1B A;  3TKL B;  4YSZ A;  3ETV A;  3H3M A;  3ZCI A;  4CI3 B;  3OYX A;  5LGN B;  1UGO A;  2XQ3 A;  3LK4 2;  3KFW X;  4G63 A;  2NWB A;  3OKQ A;  5LA6 E;  3VKH A;  3LBX A;  4ZI2 C;  3UU8 A;  4EXT A;  3AAI A;  3IEE A;  3WAJ A;  3AE1 A;  4B3S T;  2PG8 A;  4O4L E;  4EIW A;  4UF0 B;  1HNW T;  3RIF A;  2CHO A;  1JNR A;  5CA1 E;  1U5P A;  1OED A;  2E5V A;  2JQH A;  5H6R B;  2CPT A;  3BQI A;  4DBQ A;  1WFD A;  3R6N A;  4AKR B;  4CN4 A;  5AQH B;  3VRA A;  4KHP T;  2RP4 A;  2VQF T;  3CML A;  2QGS A;  3JAD A;  2YKS A;  4X62 T;  2JPF A;  2W0G A;  4O4J E;  3FXD B;  1CHU A;  3N2O A;  2EHO C;  2V6Y A;  1QUU A;  3N9L A;  2UUA T;  4ADZ A;  1MND A;  5L4E A;  4YHH T;  3K1S A;  3ZKR A;  2J1D G;  5HEG A;  3J9X 1;  2BDE A;  2CE7 A;  3LK2 B;  2PFV A;  4KUM B;  3U3I A;  4GYR A;  2CM0 A;  2FJE A;  2JQK A;  2ODV A;  5HXR A;  2YIN A;  2J4G A;  2EHO B;  4HN9 A;  4Z91 A;  2A72 A;  5AQG B;  1L0V A;  2V7K A;  4IDP A;  2IC6 A;  4HWF A;  2H3R A;  3P4P A;  5JDG A;  4ILU A;  2CA5 A;  1HTJ F;  4XZC A;  4TV9 E;  3KBU A;  2C5J A;  3N9O A;  5FNV E;  2AE9 A;  4IL9 A;  2NP9 A;  2VAS A;  2W62 A;  2X51 A;  4U2Z A;  4OFZ A;  2WSS V;  2JJ9 A;  4X64 T;  2KWH A;  1ZEE A;  3NZQ A;  3ZT5 A;  1HNZ T;  5C8Y E;  5JDL A;  3MAC A;  2HPJ A;  3A5X A;  2XHE B;  5J2U E;  4AIS A;  4ASK A;  2XAQ B;  5AQL B;  5HWY A;  3RF1 A;  4DMW A;  3ZT6 A;  3NKZ A;  5LGU B;  3ONX A;  3Q5E A;  3ZYL A;  3KV4 A;  2X66 A;  5AQF B;  5LG3 A;  5FKY A;  4PK4 A;  4LML A;  5EK2 A;  2HPL A;  3UUX B;  4OX9 T;  1I6Z A;  3BQK A;  3Q5W A;  4TNV A;  2H88 A;  3L8R A;  2CXL A;  5J2T E;  2B1E A;  5LG4 A;  1NEK A;  2KIN B;  3PUQ A;  3RC3 A;  4WW0 A;  2RA1 A;  4HWI B;  3FZF B;  2K48 A;  3GN5 B;  3B57 A;  3PDY A;  2W63 A;  5IYZ E;  3TLW A;  3EI0 A;  2BKP A;  2V26 A;  3ESL A;  2LSJ A;  4X1Y E;  4ZZC A;  2XQ7 A;  5FVL A;  4CXY A;  3AEC A;  3NBX X;  3M3Z B;  2K5B B;  4PFP A;  2SPC A;  2XSB A;  4NIQ A;  4A56 A;  1SUM B;  1Y64 B;  2KMF A;  2WDQ A;  3JC6 D;  2M6I A;  4EYY R;  3ZLI A;  4YJ3 E;  3EHZ A;  3TLU A;  4AKH A;  1UX4 A;  4PK6 A;  5JDQ A;  4U7Y A;  3P4S A;  4HFC A;  2M67 A;  2OV9 A;  2D0U A;  4IDN A;  2N9D A;  2LM2 A;  4EOZ B;  1D0Y A;  3I1A A;  2XQ4 A;  4PK5 A;  4UV8 B;  3UT5 E;  4EED A;  1VCS A;  4DV5 T;  4M1P A;  2Q9Q D;  4H9S E;  2CWY A;  4UIG A;  3N9Q A;  4QKN A;  1MNE A;  2DL1 A;  1LVK A;  3PUX F;  4PJL A;  2NTY A;  4YFS A;  2V7M A;  4JI3 T;  1XNQ T;  4DV3 T;  1KNR A;  5ABG A;  3W15 B;  1J1J A;  2YU1 A;  3AE4 A;  3ZYK A;  1YQ3 A;  2BG9 C;  2XSA A;  4DV6 T;  3CX6 B;  3FZM B;  3RI5 A;  2WDV A;  2WS3 A;  5AQJ B;  1DU2 A;  1MMN A;  5JR9 A;  3ZCJ A;  2BKN A;  4HFI A;  4U33 A;  4K0K T;  3I0Q A;  3AE8 A;  4HFV A;  2E8I A;  4X5T A;  4BAY B;  4DR2 T;  2DCF A;  2L3L A;  4UVA B;  3RIA A;  4YJ2 E;  4UEM A;  3AAE B;  2WQY A;  3OVU A;  4U72 A;  2WWU A;  1US7 B;  2W00 A;  4PJM A;  3CKD A;  3P8C D;  2LJL A;  3PUZ F;  3Q2M A;  3O1I A;  4HWC A;  3RKG A;  4ZEY A;  2HHH T;  3RLF F;  3UFG A;  3FBZ A;  4YLH A;  1SE7 A;  3ZPO A;  4Z8X A;  2DI4 A;  4DR5 T;  4XAX B;  4B3R T;  5ABF B;  5FXV A;  3ANW B;  2CBJ A;  5CJ5 A;  5FXX A;  4KHZ F;  5EZY E;  3OBV E;  4IL4 A;  3UQ7 A;  2CWO A;  4BJN A;  4DR6 T;  5L3B B;  3E0Z A;  1UK5 A;  2K24 A;  4KBM B;  3UTK A;  5KX5 E;  2LRL A;  3C4X A;  3P7I A;  2PTF A;  4FJO A;  2BS4 A;  4QH4 A;  5CGM A;  4NXN T;  2BVM A;  3FZK B;  5DAB A;  3AEG A;  5C3J A;  1S35 A;  2NW7 A;  4UXN B;  2V7I A;  1CUN A;  5ABF A;  4ZI2 D;  1VOM A;  3JCF A;  4O2B E;  4DUZ T;  3BK9 A;  2K3W A;  2V1D B;  3P50 A;  2KZ7 B;  2QVA A;  3O1H A;  4B3M T;  3JAF A;  2LM9 A;  4U31 A;  3T8O A;  3RC8 A;  4IE4 A; 
#chains in the Genus database with same CATH homology
 2LOP A;  2W61 A;  2Q9Q A;  1ZV4 X;  3IBP A;  4QWN B;  4E7S A;  1FMW A;  4UV9 B;  3LK3 B;  4QHO A;  3OJA A;  4EAH A;  3NRY A;  2LSK A;  1ZKE A;  1YKE B;  3ZC0 A;  3ANW A;  5JRC A;  2MYS A;  2VWA A;  4DMV A;  2G0U A;  4F6R C;  2PJQ A;  3DTO A;  5JQG E;  3N9M A;  4UVB B;  1BR2 A;  5IHY A;  2DWK A;  3ZC1 A;  3ZJ1 A;  1HF8 A;  2LSY A;  4JEH B;  2XAJ B;  3AA6 B;  3AA0 B;  3PTR B;  3B13 A;  2JQQ A;  2X9W A;  3IHR A;  3VU7 H;  4CXX A;  3KDS E;  2X9X A;  4AQG A;  5LHH B;  1WYB A;  4AQF A;  4NUV A;  3KVB A;  5JR9 B;  2ES0 A;  3FHN A;  3O4X E;  5JRC B;  2YEV C;  4MLK A;  5HXS A;  4ANJ A;  3CQG B;  4AKL A;  3PU8 A;  2X9Y A;  2DNX A;  1HG2 A;  4H9Q C;  1QSD A;  2V7J A;  4CQI A;  5A1L A;  4H63 V;  2CMR A;  2KT9 A;  5F8P A;  2VL8 A;  2LEH A;  4IIJ E;  2UXX B;  3RRW A;  4EB6 E;  4V1A v;  1D1C A;  2HH7 A;  1D0X A;  3K3Q C;  4OK0 A;  5LYJ E;  1B7T A;  4ZS2 A;  4I4T E;  2NOX A;  1U4Q A;  2DHR A;  4IE6 A;  3U78 A;  4HEA A;  4X1I E;  3ZN1 B;  2KND A;  3AA1 B;  3PUR A;  3RX6 A;  2WMO A;  2Y6X A;  3M65 A;  5HWX A;  3JC6 C;  5HXE A;  1ZHC A;  2I59 A;  4PW8 A;  2E9X C;  1Z0P A;  1HG5 A;  3S4U A;  1NAF A;  1KK7 A;  1BR0 A;  3QK6 A;  5L3F B;  1WLX A;  3MK7 C;  3RYF E;  4PFO A;  5JDM A;  2X0L B;  3OYZ A;  3PUS A;  4ZOL E;  3N9N A;  2GK9 A;  4OHF A;  5FY1 A;  5LJN A;  5CA0 E;  4MFR A;  3CPZ A;  2Q9Q B;  3UUM A;  1T98 A;  3HKE E;  2WBL A;  4HKA A;  3HKB E;  3ZEF B;  3AVR A;  5L3C B;  3VHL A;  3HKD E;  4P09 A;  2XUE A;  3QC9 A;  4AKI A;  4H9P C;  3E08 A;  4QX7 B;  4N78 D;  3ZMU B;  4PJJ A;  5L2L A;  5JRE A;  2UXN B;  2H7O A;  5FMN A;  3LG7 A;  3KVA A;  4MBQ A;  3N9P A;  2KLQ A;  2Z6E A;  4O4L E;  2CLY C;  4JEU B;  4KMC A;  2LSI A;  2ZM0 A;  2MTQ A;  3GWH A;  3ZYM A;  3LJC A;  5LOV E;  4IDZ A;  3ETU A;  1MMD A;  4L0R A;  4QXC B;  1IAP A;  2LHR A;  3KIN B;  3EUH A;  5L3E B;  4P0A A;  5E0O A;  1SHZ C;  3I0O A;  5LXT E;  3CQX C;  5HXC A;  2D0T A;  4X20 E;  2A3D A;  2N1G A;  2LOS A;  2VKO A;  2ZMA A;  3EDU A;  1G8X A;  4UVC B;  4ISS A;  4EZH A;  2LT3 A;  2VB6 A;  5EK4 A;  3Q5X A;  2JMK A;  4C91 A;  1IZN B;  4TUY E;  1WR6 A;  2XAF B;  4YHJ A;  4I43 B;  5LBM A;  3CX7 B;  1OXZ A;  2NW9 A;  3NRX A;  2YU2 A;  4E7Z A;  2WAU A;  2VKD A;  4L9I A;  3KV6 A;  4OYK A;  2ZM8 A;  2LHN A;  4DO0 A;  1FIO A;  3I9Y A;  4J2C A;  1X79 A;  3HA4 A;  5JR9 C;  3O9X A;  4AKG A;  3V5U A;  4WBN E;  1HCI A;  3E22 E;  1E1H B;  3DP7 A;  3IF8 B;  4UF0 A;  5DJQ C;  3ZJ2 A;  1LKX A;  3PU3 A;  4IE7 A;  2X67 A;  4IE0 A;  3SWH A;  4ZI3 D;  4IHJ E;  4TX5 A;  1MMG A;  3LFM A;  4X1K E;  3D0T A;  5GON E;  5KMG P;  1IJ6 A;  2LSG A;  2NTX A;  1BR1 A;  5J1G A;  2MBG A;  2NW8 A;  2VKH A;  5LBQ B;  3UFE A;  3N2K E;  2D2S A;  5HXH A;  3RYI E;  2IAK A;  1FMV A;  5FXW A;  4AI6 A;  2DWG A;  4U74 A;  2XAH B;  3RPU A;  3PE0 A;  2Y48 B;  2XAG B;  3MKD A;  2MOZ A;  5JH7 E;  2E9X B;  3ZMT B;  2XTL A;  4EZ4 A;  2EHO A;  1YW0 A;  3ZMS B;  2VKJ A;  2JRK A;  3EVY A;  4PAG A;  1LRZ A;  3RRC A;  4JLE A;  3I9W A;  4H9R C;  4WBO A;  5DQV A;  5KDM C;  2CLY B;  4B6X A;  5LNK A;  2ZLY A;  4H63 H;  1VRB A;  3RYC E;  2PBI A;  2V7L A;  4QXH B;  4HGA A;  1FEW A;  1YKH B;  3H3A A;  3J9X 1;  4PJN A;  1D0Z A;  5DQW A;  5F3J A;  5JDN A;  3AVS A;  5FP3 A;  1EZ3 A;  4CXW A;  1D1A A;  3PUA A;  4MHC A;  4ZHQ E;  1SA0 E;  4NUU A;  2CEA A;  3C50 A;  4P0B A;  4K0U A;  5BMV E;  3CQC B;  4CZZ B;  1LVF A;  3CVR A;  3C4Z A;  3O1J A;  3HI2 A;  3RYH E;  4OYJ A;  4GK0 E;  1MIV A;  4L5G A;  1KNZ A;  4IGU A;  2C0S A;  2XQY A;  1MIY A;  5L3D B;  2CCQ A;  3N5L A;  3ZMV B;  2H7V C;  4BJM A;  3HR0 A;  4G2A A;  4UEL A;  1O3X A;  4PNI A;  4DVD A;  3F31 A;  3F2E A;  2BZB A;  2EHO D;  4XBF B;  3VKG A;  3NZP A;  4WNK A;  1WRD A;  1YD8 G;  3EDV A;  4O4H E;  3PUG A;  3KV5 A;  3ZN0 B;  2CXD A;  5M4Y A;  2E9X D;  2VK9 A;  3L3P A;  2X9H A;  4KP3 C;  3LBX B;  3BQL A;  2K9A A;  3L09 A;  5ADX L;  3ZMZ B;  4JUY A;  4TV8 E;  3DJB A;  1G73 A;  5TAO A;  4EYU A;  5FYM A;  5JDH A;  1WYC A;  3C4W A;  2Q9Q C;  3F57 A;  4ZI7 E;  4ZS3 A;  5LHI B;  1MIW A;  2WM9 A;  1BR4 A;  4HE8 A;  4IE5 A;  2D5U A;  2P9B A;  5HAX A;  3SRZ A;  1UCU A;  5CB4 E;  3FXE B;  3N2G E;  5FY0 A;  3WAK A;  1NWM X;  2IC9 A;  3MA9 A;  3SOL A;  1AJ3 A;  3AAA B;  5JVD E;  4H9O C;  2XAS B;  2Y8D A;  2KWI B;  3K3N A;  1HX8 A;  3K3O A;  4O2A E;  4O8S A;  3RKO A;  2DLR A;  3V5S A;  1S94 A;  3C51 A;  5AFU L;  4MAL A;  1UX5 A;  2YK0 A;  2ODU A;  2C5I T;  3WI3 A;  5LHG B;  3K8P C;  2OA5 A;  3H37 A;  3MZK B;  4ERR A;  4CI2 B;  5L3G B;  4IST A;  1H7C A;  2N2N A;  5LP6 E;  4TN7 B;  4I55 E;  3HL6 A;  3AA7 B;  3GA8 A;  5JDF A;  1V9D A;  1MMA A;  3HKC E;  4QXB B;  3MJX A;  3KV9 A;  2A2F X;  4CI1 B;  4O4I E;  2C5K T;  2CXF A;  2X68 A;  2KXP B;  2E9X A;  2L9Q A;  1IJ5 A;  4DND A;  3QUJ A;  3R84 B;  2QA7 A;  3UUN A;  3UUL A;  4C90 A;  4DBR A;  4FI5 A;  2L8K A;  3AB3 B;  3Q9D A;  3RH3 A;  3C64 A;  4TZ4 C;  1HFA A;  3C98 B;  5LGT B;  3CX8 B;  4GIW A;  2WMN A;  1OWA A;  5H6Q B;  2ACX A;  3KBT A;  3J7Y q;  5EK3 A;  3CWZ B;  1HS7 A;  3FB2 A;  4I50 E;  4AXP A;  4QX8 B;  5LJM A;  4GYS A;  2IW5 B;  5FY7 A;  3MXZ A;  2ZM2 A;  5LCY A;  4ZI3 C;  3GN5 A;  5HYA A;  4GOU A;  4AQF C;  3FBL A;  4GK5 E;  4HTE A;  2BVL A;  3GMI A;  5FXZ A;  2LE8 A;  2JMH A;  4BA9 A;  5ETW A;  4H9N C;  3SS1 A;  1D1B A;  3TKL B;  3ETV A;  3ZCI A;  4CI3 B;  3OYX A;  5LGN B;  3LK4 2;  3KFW X;  4G63 A;  2NWB A;  3OKQ A;  5LA6 E;  3VKH A;  3LBX A;  4ZI2 C;  3WAJ A;  4EXT A;  3AAI A;  3IEE A;  2PG8 A;  4EIW A;  4UF0 B;  5CA1 E;  1U5P A;  5H6R B;  3BQI A;  4DBQ A;  3R6N A;  4AKR B;  2RP4 A;  3CML A;  2QGS A;  2W0G A;  2JPF A;  4O4J E;  3FXD B;  3N2O A;  2EHO C;  1QUU A;  3N9L A;  4ADZ A;  1MND A;  4BJN A;  2J1D G;  3U3I A;  2BDE A;  2CE7 A;  3LK2 B;  2PFV A;  4KUM B;  4GYR A;  2CM0 A;  2ODV A;  5HXR A;  2YIN A;  2EHO B;  4HN9 A;  2A72 A;  2V7K A;  2IC6 A;  2H3R A;  5JDG A;  4ILU A;  2CA5 A;  1HTJ F;  4XZC A;  4TV9 E;  3KBU A;  2C5J A;  3N9O A;  5FNV E;  2NP9 A;  2VAS A;  2W62 A;  2X51 A;  4OFZ A;  2WSS V;  2JJ9 A;  2KWH A;  1ZEE A;  3NZQ A;  5C8Y E;  5JDL A;  3MAC A;  2HPJ A;  3A5X A;  2XHE B;  5J2U E;  4ASK A;  2XAQ B;  4DMW A;  5HWY A;  5LGU B;  3ONX A;  3ZYL A;  3KV4 A;  2X66 A;  4PK4 A;  5EK2 A;  2HPL A;  3UUX B;  3BQK A;  3Q5W A;  5J2T E;  2CXL A;  2B1E A;  5LG4 A;  2KIN B;  3PUQ A;  3RC3 A;  4WW0 A;  2RA1 A;  2K48 A;  3GN5 B;  3B57 A;  3PDY A;  2W63 A;  5IYZ E;  2V26 A;  3ESL A;  2LSJ A;  4X1Y E;  4CXY A;  3NBX X;  2K5B B;  4PFP A;  2SPC A;  4A56 A;  2KMF A;  1Y64 B;  3JC6 D;  4EYY R;  3ZLI A;  4YJ3 E;  4AKH A;  1UX4 A;  4PK6 A;  5JDQ A;  2M67 A;  2D0U A;  2N9D A;  4EOZ B;  1D0Y A;  3I1A A;  3UT5 E;  4PK5 A;  4UV8 B;  4M1P A;  2Q9Q D;  4H9S E;  2CWY A;  4UIG A;  3N9Q A;  4QKN A;  1MNE A;  1LVK A;  4PJL A;  2NTY A;  4YFS A;  2V7M A;  3W15 B;  2YU1 A;  3ZYK A;  3CX6 B;  1MMN A;  5JR9 A;  3ZCJ A;  3I0Q A;  4HFV A;  2E8I A;  4BAY B;  2DCF A;  2L3L A;  4UVA B;  4YJ2 E;  4UEM A;  3AAE B;  4U72 A;  2WWU A;  1US7 B;  2W00 A;  4PJM A;  3CKD A;  3P8C D;  2LJL A;  3Q2M A;  3O1I A;  3FBZ A;  4YLH A;  3ZPO A;  4Z8X A;  2DI4 A;  4XAX B;  5FXV A;  3ANW B;  5FXX A;  5EZY E;  3OBV E;  2CWO A;  5L3B B;  3E0Z A;  2K24 A;  4KBM B;  3UTK A;  5KX5 E;  3C4X A;  3P7I A;  4FJO A;  2BVM A;  5DAB A;  1S35 A;  2NW7 A;  4UXN B;  2V7I A;  1CUN A;  4ZI2 D;  1VOM A;  4O2B E;  3BK9 A;  2V1D B;  2KZ7 B;  3O1H A;  2LM9 A;  3T8O A;  3RC8 A;  4IE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...