4FIBA

Crystal structure of the ydhk protein from bacillus subtilis. northeast structural genomics consortium target sr518a.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
MKVGSQVIINTSHMKGMKGAEATVTGAYDTTAYVVSYTPTNGGQRVDHHKWVIQEEIKDAGDKTLQPGDQVILEASHMKGMKGATAEIDSAEKTTVYMVDYTSTTSGEKVKNHKWVTEDELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ydhK
publication title Crystal structure of the ydhK protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Structural genomics, unknown function
total genus 23
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07563 DUF1541 Protein of unknown function (DUF1541)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1130 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fibA01
3.10.330.60 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4fibA02
4FIBA 2KY9A
chains in the Genus database with same CATH superfamily
4EIKA 1JXMA 4M7DE 2H3JA 3I56Q 2FG0A 1ZQ1A 3MJXA 4X9DA 1I81A 3LH0A 1UHFA 4VUBA 2KBTA 3JCMJ 2PWYA 2QTXA 3JCMh 5LJ5h 2DAQA 1VQ4Q 2Q19X 3M55A 3JCMP 1NYGA 4J9DA 3FLGA 3JRZA 1VQ7A 2LW6A 1QMCA 1M3BA 2RH2A 1D0ZA 3OW2P 1RLPC 1LVKA 2DERA 1LJOA 2VXFA 3PVLA 3M54A 3SDZA 1AEYA 3OYIA 1OEBA 2Q1DX 4E7KA 4Y91A 4RTYA 2ATCB 3M56A 2CP6A 1C0MA 4KGXB 4QVDA 3UA7A 3EFRA 3RERA 3OYBA 2K57A 2FYKA 3OYJA 2CZ0B 2HEQA 5IHNA 3TQ7P 1S3SA 2AHJB 5LJ5d 4N4HA 3JCMd 3DB3A 2KRNA 5CKDA 2ZPGB 5FTMA 1NZ9A 1ZX6A 3QIIA 3V8KA 1KQ1A 1QCNA 4LNPA 5DLOA 2HL3A 3NFCA 4CC2A 4J8OA 2GQIA 2GF7A 4M7AB 1OYXA 3CXCS 5FRMA 5L8RE 2A37A 2RHIA 2EQKA 1B34A 8ATCB 2YT6A 4KGZB 3MHXA 4Z8AA 1K73C 2X3WD 1WFWA 3H0FA 1M9SA 2KXDA 4FYYB 1IHWA 2BKDN 2E12A 4C92E 4X9CA 4CC4B 4JJBA 3NTHA 4Z88A 3JCMc 4HCCA 5GAOr 2R5AA 3E9FA 1UB4A 2EKHA 2ZCFB 3HU3A 5GAMh 3G1JA 3CCLQ 1Q82C 3JCMb 1UGQB 3BDLA 2MF2A 3OA6A 3QJYA 2YUNA 1B7TA 2EYZA 2LX7A 2DIGA 3ME9A 3CQTA 3QG1A 1D1BA 3HU1A 2E5QA 2O88A 3A8HB 1M8MA 1QP2A 3MP1A 4KGVB 1UGSB 3A98A 3FDRA 3SWNB 2GTJA 3CCQQ 3GNGA 2PJHB 3L1AA 5KYYB 2D8HA 2J05A 1WZOA 1H3ZA 1D1AA 1ZSZB 1V1CA 1Q7YU 2LP5A 2PVGB 1GBQA 2A7YA 2J6KA 3NTKA 4C92D 1HK9A 3ASKA 5GAMd 3G71Q 4L59A 3CMEQ 3RDVA 4QKUA 2E10A 2EQUA 4XTYA 1JJ2S 3HL8A 2GFUA 4N0AC 5LJ3e 1G8XA 3FJPA 1SRMA 3EG0A 2V8JA 2CP0A 1UEBA 2W10A 4FYXB 4AT1B 1VQ8T 1I07A 1BI1A 2COYA 3QWZA 2EBPA 2F5TX 4J7IA 3G7ZA 3MP8A 2LX9A 4XTWA 3GBQA 4M78C 1UUEA 4MDWA 1X2QA 4BUGA 1QCFA 1RAGB 3PNWC 2OAWA 2DLPA 3OS0A 4CC3A 2DJZA 3DLMA 4OMQA 3MO8A 3CBPA 2B86A 2YUJA 4IUUA 2AKLA 4QQGA 3HKSA 2LCCA 3NHNA 1VQ6T 2F2WA 2LRQA 3LLRA 1H3HA 3SFMA 1G2BA 1R7RA 5GANe 3O5ZA 1SSFA 3UATA 2RHUA 4QQ6A 5GJWB 1M90R 2LVMA 4C0GA 2DXBA 5GAN2 3REBB 1GCQA 1YJWQ 5GAN7 2E5KA 2HSEB 4M7AF 2CH4W 1WLPB 2RJDA 4X34A 1YIJQ 3VYHB 2W0ZA 2NYSA 5D6WA 3CC2A 5LJ3j 2KR3A 1QW1A 5GAMg 4C8QB 2R58A 3OYNA 1Q7YC 4WTOB 3TSWA 2D9TA 1G83A 1N27A 1W1FA 1UE9A 4MMKA 4JUVA 2P0QA 1RLQC 5CKHA 1X43A 3FPRA 4OVAA 3HHTB 1IGUA 3E19A 4PJOE 2CKKA 3QHSA 1QWFA 4KO8A 3CCUQ 1I5OB 5GAOq 3FB9A 4JLGA 4HT8A 3QWYA 3IQLA 2O9SA 2O01E 2YSQA 5I2SA 1VQ8A 5J39A 2ZAEA 1WYXA 3LGAA 2L5QA 4LXCA 3VYGA 1BIAA 4C5IA 3CC7A 1V29B 1S72Q 1IHVA 2VVKA 2DBMA 5GANj 2C0TA 8AT1B 4M7DB 2KT1A 1JXOA 3UA6A 3OS5A 3OQ5A 1PHTA 1M2OA 1H641 1X6OA 3FC3A 3QZ5B 5LL6S 3QQ8A 2P4TA 4RMOA 3X26B 1Y07A 1VQLT 4MDXA 1VQKT 2MMPA 2FPDA 5FU6C 4M77A 1RAFB 1IXDA 1ABQA 1VQ6A 1ZA1B 2JTFA 2LNVA 2GTOA 3CCEQ 3EG9B 2FL7A 2BE9B 1U5SA 2L2PA 2KEAA 1M5Q1 3SB2A 1Z9QA 2EQJA 4BY6C 2DBKA 3VJPA 1WNLA 2CT4A 1VQ7Q 2H8HA 2LT4A 3QYGB 2FHDA 3OMGA 3L2RA 2DEQA 3OW2S 2X4YA 2HD0A 1O54A 2X4WA 4M78G 4YTLA 3CXCP 5B6CA 1MGQA 3LYIA 2YRDA 3ZJVA 3M0SA 1EFNA 1W2BP 1CKAA 5ECAA 4PKCC 1MNDA 1EX4A 1WLFA 4AQ7A 3H41A 3JAME 2V8IA 2DK3A 1HJDA 4PJJA 3VS3A 1YJ9T 3CPWA 2JT4A 1HSQA 1Q7YR 4AFQC 2ABLA 2WACA 3HFNA 4C5GA 1Z9ZA 3BW1A 2R5MA 5GAOn 1YI2Q 3RMSA 5GMKe 3EHQA 3TVTA 4C92B 2KYBA 2AT1B 1YNZA 3A1PA 4E7HA 2COWA 3LGFA 1VQMT 3T9NA 7AT1B 6AT1B 1I0CA 4ARIA 4DOVA 2EJGA 2V26A 4F16A 4F7UG 2KMTA 4MZMA 3CBOA 1VQLA 1VQKA 4OMLA 3S6WA 4JRQA 2L0AA 1YITA 1RAIB 5EPPA 3H6ZA 5FU7B 3MPUB 1I8FA 1I9GA 3OYDA 1UJ0A 2J6OA 4LDYA 3CCST 1VQNT 4EMGA 4OB2B 1VIEA 2E3HA 1ZBJA 4KH1B 3JB9J 1FYNA 1JJ2P 1OV3A 2XKOC 3C94A 4ELZC 1RADB 4JJCA 3VRYA 1RACB 5GMKi 4KDIA 1SF9A 2FPEA 2EPDA 1KIKA 3X24B 2B8AA 2COZA 1KQSP 2R57A 1PC0A 4AS1A 5IH2A 2EYXA 2Q1CX 3EG1A 4IUVA 2VXEA 2DXCA 1KC8C 5GMKj 3I55A 1S72T 4LDVA 2XMFA 2JOYA 1UGVA 2X3XD 3OYKA 5HKCA 1RI9A 3CMAA 1R8OB 2QQSA 4D8KA 4E2FB 1U3OA 1OPLA 1EZZB 2RMOA 2NWMA 3M0RA 4KBMB 2AZVA 2PZ1A 4LUDA 4AMCA 2X4XA 1WPYA 3QWXX 4E7IA 4R0KA 4RCCA 1VQMA 5KYXB 2JMCA 4FL6A 2L3PA 2G3RA 1PRLC 4HVWA 2FO0A 2OTLT 4HKEA 2DL3A 1IREB 3JCMW 2QA4T 3L2WA 1AWOA 2ZGWA 4KUDK 4FYWB 2EKOA 2F69A 2DIQA 3A8GB 1OU8A 4EPCA 3CCMA 2A36A 3HPWA 1M2VB 4N4GA 4DBQA 1NEGA 4EMKB 2AKKA 1PD1A 2YWWA 1NG2A 4M78D 4JRPA 4JLIA 1RI0A 3QDRB 2JMAA 4JZ4A 4OMPA 4XU3A 4ARCA 2KT8A 2K5IA 2DL8A 4BB7A 4XU2A 1N5ZA 2DFUA 1VQ5T 2LJ0A 1E7OA 2ENMA 4OGCA 5CK9A 2RQUA 1M4ZA 1VQPA 2NLUA 3OYLA 2ED0A 3SWNA 3RMQA 4RG2A 5GJVB 3OSVA 3KUFA 1NM7A 5KYYA 4ANJA 1N8RC 4PJOC 2V8KA 1VQOT 3C0CA 2P0KA 4PL6A 5IN1A 2J7IA 3G4ST 2ZPFB 3CCJT 1HD3A 1MMNA 1K73U 2DM1A 4HVUA 3KBGA 4K11A 3FIFA 1GL5A 2SEMA 3MEUA 2F1LA 4JDSA 4R55A 1M30A 2EGCA 1YN8A 1TWBA 5GAN4 4C8QD 1G3TA 1RABB 1VQ8Q 3U23A 3OYMA 2QASA 2BZXA 2C06A 1BBZA 3S3NA 1Q82U 2CZ6B 3LH5A 4MZTA 2OTLA 3PT9A 3QZ9B 1QVGP 5KE2A 1Y57A 2VV5A 2QA4A 2EQMA 4OMNA 1QDNA 2VKNA 4M78A 3AT1B 1KFZA 4RV0A 1QLYA 5D7UA 1IB8A 3ZBDA 2DO3A 3EGDA 1VQ6Q 4M77F 2FPFA 1MV0B 2RB6A 1TOVA 2CP7A 1I4K1 2RJFA 4V2SA 3M57A 2YLCA 1SHGA 4M7DD 4FYVB 3VS5A 3INZA 1VQ5A 3HU2A 2D0NA 4PLLA 1TTHB 2O31A 2M02A 1QCSA 2HSPA 2K79A 1H8KA 2K6DA 5GAN8 3VS1A 5KCOA 1KG1A 2VGMA 1OI1A 3CC4T 2JJ9A 2MIOA 5J3BA 2DJQA 3L42A 5CKEA 1VOMA 3JCMe 2O2OA 5LJ5e 1VQOA 4C8QA 1LCKA 3G4SA 3CCJA 1D0YA 1MMGA 1G3SA 3C4SA 3H9NA 3RIRA 3RKWA 1W2BS 4BACA 2IIMA 4ORZA 5FROA 2XD0A 1NYFA 4L5GA 1RAHB 3A8LB 4M75E 4BD3A 2RQWA 1GFCA 1J3TA 1PWTA 9ATCB 2JVVA 5FTLA 3OYGA 3FEOA 4XU0A 4RTWA 1AWXA 3JB9G 4E7LA 4BE2A 1M3CA 1K1ZA 1SKUB 5CVIA 5CO7A 1KK7A 3SHWA 1JQQA 4RTVA 3JB9I 1C6VX 2DZCA 3OBYA 1NLOC 4FSXA 1NE8A 1IO6A 2E4HA 3CBMA 4HCKA 1YHQA 2DL5A 1BK2A 4PJOG 5CD1A 4C0DC 3RKXA 5FRNA 4IKFA 3NGPA 4M7DA 4FW1A 1JB0E 4HA8A 4CRIA 1VQLQ 1VQKQ 1X69A 3CC2T 4FT4A 2KRSA 3NMZC 2L3SA 2YVLA 4IUQA 5LJ5j 1PD0A 2B25A 2ZPBB 3BE3A 2VUBA 4IIMA 4A4HA 1RAAB 4ZTJA 2JS2A 2GCXA 4LD9K 3FJ5A 2DRKA 4LDXA 3EG9A 2DILA 2JZ2A 4XTZA 3HSBA 2LJ3A 1KHCA 2OX7A 2EYWA 1PSEA 3CC4A 3MEVA 2DTOA 2RHXA 3SEMA 3R6OA 1TS9A 1M1FA 5GAMe 2KXCA 1VYTA 1KD1C 2EYYA 1ZSZC 3BFMA 1YWPA 2M0OA 2GFAA 1BCOA 4KRTA 2IG0A 1KQSS 2OTJT 2O9VA 1TUDA 4M78B 3GF5A 4QVZA 3CC7T 3VKIA 2NUZA 4E7SA 1ZC1A 4RTXA 1E32A 2FRWA 4BDZA 3M59A 3TCJA 2D6FA 2FZKB 5CCAA 1YJ9Q 1HXDA 2EYQA 2KYMA 3EGDB 3M53A 3D7SB 1AT1B 3LWIA 2WSEE 2DTHA 3P8DA 5FTJA 1TH7A 2DE0X 4IUTA 2QEXA 1AWWA 5IAYA 3OYAA 1K73R 2CS7A 2KQWA 1X6GA 5KE3A 1VQMQ 1WDXA 2GNCA 4ZGJB 2QTVA 2ED1A 4C92A 1VA7A 2ESWA 3EAEA 2K2MA 3MEAA 4DBRA 5FTNA 4LDUA 3X28B 2XICA 2FZGB 4RG8A 1Q82R 4F7UB 1HYOA 1T3SA 3CCSQ 1VQNQ 2E41A 5CIUA 4D8DA 1G5VA 5AYFA 2IPOB 5CKFA 3V7CA 2HQEA 5LJ3g 1W6XA 3PIOA 1WXBA 5HY6A 2BZ8A 2C0OA 4UC4A 1OZ3A 4FCYA 4KUIA 4RTTA 3OSSC 2CH4A 4F17A 5KCHA 4J9EA 3UWNA 4KODA 2LC4A 3EH1A 1IZ6A 3V8LA 3TIWA 2XG8D 2M9UA 3VS0A 3OY9A 2DA9A 2OAUA 3LGLA 3MP6A 4OMOA 2OTJA 2CSIA 1WHJA 2FB7A 3C12A 2CP3A 3L2ZA 5DM7R 3JB9H 3CCVT 5CKBA 2Y90A 3JB9D 1KQ2A 3I56A 4J9BA 1TU0B 1X75C 5A2QE 2XU8A 4ZN3A 2EJ9A 2CP5A 4DBHA 2HQHA 4FM4B 1CZ5A 5FU6B 1GCPA 2HNIA 4OMFB 1SRLA 4Y28E 4C0ZA 4PJOD 1XNIA 1YITT 5KYUB 1N9SA 1RUWA 5GANg 4N4IA 2EW3A 3NPFA 2OJ2A 1MHNA 4GBQA 5CQXA 3A8OB 3I5RA 5I11A 2Q1AX 3MKDA 4BY6B 3M0PA 4OP0A 4BI8B 1CZ4A 1NLPC 2OTLQ 4A54A 2K3YA 1R77A 1QVGS 2QA4Q 1B3QA 2QI2A 1R0CB 3OYYA 2DF6A 5KYXA 1QVFS 1DJ7B 2KK4A 4HXJA 1LNXA 5FWBA 5KYNA 4J7FA 2BUDA 4M78F 3VUBA 4GY5A 1NBEB 3PVQA 2WSFE 1PKSA 1T0JA 2YDLA 1BKBA 4QT7A 1FMWA 4LD6A 4F14A 3ZJUA 3UF4A 1WIEA 1OULA 2O4XB 2EAYA 2F2VA 1M2VA 1KC8U 2MOXA 5EC7A 2OI3A 4EMKA 1U1SA 2KE9A 3I55T 4XAXB 5IXBA 3E1SA 1K8AU 1WHLA 1JJ2A 1I5LA 1WXUA 1VQ5Q 1AZEA 4DQ2A 4OB3B 3CMAT 2RPNA 1Y71A 2K9GA 3I35A 2LQKA 1ZLMA 1ZSGA 4ATOA 2EWNA 2V1QA 4XK8E 4JPBW 3NTIA 3L2UA 1WJQA 2KI7A 3CCVA 4M7AE 2CREA 4C5HA 1VQOQ 4KULA 4PJOA 2KDSA 5J26A 4J6YA 4J9HA 1OQKA 1K0XA 4C8QF 5CAIA 2MM2A 3J80E 3G4SQ 1Q86C 3CCJQ 4JS4A 5GAN5 2EGEA 2XK0A 1G3WA 5KH6A 5I2MA 4M75C 2XI9A 2AIRB 3QC8A 2E6NA 3RKYA 2IVWA 3BY7A 1NJIC 5HCKA 1YJNT 3URGA 2RN8A 1LOJA 3PMIA 3UDCA 3CCMT 4ZTFA 2HKNA 1GCQC 2QDYB 3QQ7A 3L2VA 5IXFA 3CCQA 4IURA 5CCXA 3M9QA 4DOWA 4OMMA 1UECA 2CUDA 2A0FB 1UTIA 2JNGA 2LZ6B 3GIBA 4M7DF 4TVRA 1U1TA 3HP9A 3CPWP 2MM0A 1TG0A 4NL2A 1VQPT 2JV2A 2CT3A 4AFUC 1N8RU 2NUTB 3EH2A 1EIFA 5DY9A 2I2LA 4DEYA 4IUPA 3J7AF 1NPPA 1K8AC 2DZ9A 4QW2A 1RL2A 2HBWA 2DEUA 3HRSA 1FMVA 2HL5C 2HZYA 5HK3A 2YUPA 3CC4Q 4KT0E 3H0IA 3UPUA 1ABOA 1MMDA 2K3XA 1X01A 1UJYA 3REAB 2DMOA 1VUBA 3ZL7C 2NUPB 2JM8A 1ZUYA 2BIVA 2DXTA 1OX9A 4ZGEB 2HQXA 4WCIA 4M77C 1AOJA 1MMAA 3META 4A53A 1YJNA 3QSUA 1CKBA 1ZUKA 1WHGA 2RQRA 4NL3A 3RR6A 4PJMA 2X35A 1ZHIA 3PGGA 1WXTA 4R56A 2EJFA 1OX8A 2HDAA 4FT2A 4AG1C 1UDLA 3OB9A 1OPKA 4E7ZA 3ZJTA 4Y92A 5I22A 2DNUA 2E65A 1XTDA 2CZ1B 2JXBA 1D09B 5LJ3f 2K3BA 2EIFA 1MUZA 1M1KU 2L89A 3EGXB 2DVJA 2DTIA 3QBYA 4C92F 5C6SA 3G6ET 3OW2A 1KJWA 3CC2Q 2P4RA 4M75G 4PJOB 2FRYA 5C0MA 4WF2A 3O8VA 5GAOp 1X27A 3CD6T 1QQJA 2KNBB 3JSCA 2LQWA 1D3BB 3LHDA 2QGFB 2F2XA 1WA7A 1UGRB 4PJNA 3CPFA 5M9OA 1BB9A 3V7SA 4ZN1A 1M3AA 4A4FA 4N0AA 2M0YA 4O6JA 2LCLA 3V8JA 5GANf 4MZPA 3EGUA 2BTTA 3GLXA 2I0NA 4PFZA 1KC8R 2OTJQ 1JRIA 1TXQA 3M4YA 2XIDA 3CC7Q 3BQBA 3CCRT 1K8AR 2D8JA 5A0LA 4RCBA 2E6ZA 1QVFP 2RO0A 5EG2A 1VIFA 3WXMB 5A0DA 2K5FA 3WVEB 2XDBA 4F04B 3CCEA 1YHQT 3EG2A 4DEXA 3TREA 2E1HA 1IGQA 2KVQG 2JS0A 2QG9B 1M8VA 2X51A 1QKWA 4AFZC 1PRMC 2RD1A 4FU6A 2DL4A 2RF0A 4J6XA 2RA2A 3VS4A 4AFSC 1WJRA 3VRZA 1GBRA 3LW5E 5GLFA 1KHIA 1PCXA 2CZ7B 1JEGA 1O75A 2H3EB 5D6XA 3FPTA 1M1KC 1VYVA 3ER0A 1SG5A 3QKJA 5D6YA 2CSQA 1MNEA 3G6EA 1Q95G 3VV0A 2VGNA 2LDMA 2HBPA 4OF1A 3TSZA 1JBMA 1TUGB 1FX7A 2MYSA 2K4YA 1KD1U 1E6HA 1QKXA 4M77G 2EQIA 3HRUA 1WHMA 3M0UA 1D0XA 5I21A 2J06A 5KYWA 5IT9E 3JCMX 2QK0A 3CD6A 3A5ZB 2BE7D 3HTRA 4B6MA 1M27C 4F7UA 3EHRA 4AG2C 3M0TA 1BI2A 1JO8A 3PMTA 4PFPA 2MWOA 2JW4A 3JCMV 2YLBA 3GNFB 4RKUE 2EGAA 1YI2A 3JV3A 1B07A 3JB9F 1UGPB 2QQ9A 4KLNA 1YBYA 3DB4A 4JRIA 1Y96B 1K9MU 4M7AC 3C95A 1N8RR 1W4SA 2Q18X 2L3QA 1M90C 1GFDA 3CCRA 3CCVQ 3M4GA 2A08A 1YCSB 2QXFA 4A4KA 2QEXT 4C0DB 4PJOF 2RK1A 3OYEA 5LJ3h 4A4EA 2AZSA 2LTOA 2ROTA 3PE0A 2YRCA 1VQ9T 5GMKl 1BI0A 4II1A 2RI3A 3GP8A 2DD4A 4J9FA 5ERGB 2E3IA 2M1HA 4EDUA 1YITQ 2LT1A 4ZGDB 3FRNA 4PK4A 4LUEA 1PM3A 3OYCA 2K5LA 1XOVA 4M75D 5A0GA 5KYUA 5L23A 2L8DA 2D1XA 1PSFA 1SHFA 1YWOA 2G6FX 4JRKA 3P8BB 2LMJA 1IRXA 2RK2A 3DKMA 3OMCA 1UFFA 3SWNC 4OB0B 3JCMg 5LJ5g 3Q1JA 4X1VA 1FMKA 5C1BA 5LJ3d 2KRMA 3MB5A 2DYIA 1WX6A 3I9QA 5GANh 5DYGA 2CGHA 2HKQB 1M1KR 3RNJA 3CEYA 3CPWS 2XDDA 2P0PA 2PVDB 3I55Q 1A0NB 3I56T 3MEWA 4ELYC 2EFIA 2O4XA 3E9GA 4BE1A 4JS5A 3HRTA 3CMAQ 3TEEA 4M77E 3VUZA 2YUQA 3OS2A 3E2UA 4KH0B 1VQ4T 4J9IA 1K9MC 3QXEB 1GXIE 1U8RA 1JU5C 2M16A 1K76A 4JZ3A 1Q81U 4KDLA 5GANd 4E6RA 1VQ9A 4M75A 1FXXA 4O5VA 3ULRB 4C0FA 5KYWB 1CR5A 1YJNQ 5GAMj 2CUBA 2DX1A 2LCSA 3CCMQ 4E7JA 4FW2A 1WGSA 1FWZA 4HVVA 2K2VA 2JM9A 4M77D 2L3RA 2Z0WA 1OZ2A 4M7AG 1T3LA 2HAXA 2E70A 1VYUA 1H92A 3MCAB 3DLLA 2LNHB 3M0QA 2DYBA 1B34B 3JCMQ 3X25B 3QUIA 3PIPA 5GMKm 1Y7XA 4B9WA 4C8QC 3LWHA 3GPLA 3M5AA 2JN0A 1O9SA 4BE0A 1BU1A 4P5NA 1PNJA 1F1BB 1XJWB 4LE9A 1VQPQ 4HCBA 2DL7A 5IHIA 3FPUA 3EG3A 1WHHA 1WHKA 3J81E 3CXCA 4CC7A 2KY9A 2QAZA 4J83A 2M51A 4FSSA 4RTUA 5FTKA 2QGGA 2XDPA 2ZPHB 2KGTA 2VC8A 1Q86U 5CR2A 3TU4K 5GAN6 4FIBA 2YUOA 1W2BA 4PLIA 2NUTA 5C18A 3AHUA 1BI3A 1WQWA 3CCLT 1XQHA 2DPPB 1VQ4A 1KD1R 4L6V5 2PQWA 4OB1B 1M1GA 1K4US 1NJIU 5FWCA 4GLMA 1SEMA 2K7AA 3VU3C 4CQNA 1MV3A 1Q81C 2KAFA 2FVUA 4M7DC 2WSCE 2DVEA 2RQVA 3EFOA 5GAOl 4Z89A 3CCQT 2DRMA 2NUPA 4NOYA 4LDWA 4XU1A 2J6FA 4A63B 4PJLA 1PKTA 2FZCB 1K9MR 4CI0C 2BZYA 3F70A 3CF2A 2GGRA 3OYHA 2F5KA 2A3LA 5GMKh 3G71T 1E6GA 2VWFA 4PFOA 4D6WA 3CMET 2GBQA 2MI6A 4XTUA 2MWPA 2RM4A 3M58A 2DD5A 4GLKA 2DXUA 1WI7A 2CP2A 4JJDA 3KFVA 2P84A 2DKGA 2Y4XA 3G6EQ 1G3YA 1K0SA 5CCBA 2RNAA 3OYFA 4J6WA 3EGXA 2YRVA 4Q5WA 1CSKA 2ZZDA 1QCOA 2SRCA 3SD4A 1SSHA 4BI3A 3CD6Q 3QPHA 1AD5A 1KQSA 1BCMA 1T0HA 4M75B 2FEIA 4DBFA 1NPRA 3QO3A 2JTEA 4F7UF 2KSSA 2QYZA 4EMHA 4E47A 2Y4YA 5IHKA 3CCLA 4QVCA 3VS7A 5DLQE 2LJ1A 2YXYA 1D3BA 4XTXA 3VS2A 4PNOA 4QQDA 2YHTA 2ECZA 1TUCA 1AZGB 4J9GA 2CYZB 1D1CA 2AK5A 4C5EA 3V7RA 2ZPIB 1WJSA 3QJ6A 4C8QG 1I1JA 1YCYA 4C92C 2VB6A 1YJWT 2PVOB 3CCRQ 3RBBB 2RJCA 2XHCA 1YIJT 1V76A 3HFOA 1AWJA 4B9XA 2KROA 3JCMf 5LJ5f 1YHQQ 2PUKB 2ROLA 4M7AD 2QQBA 5GAN3 5FU7C 3LX7A 3QDFA 1UHCA 5CQYA 5AT1B 3G71A 2GQVA 3CMEA 2CDTA 5HK0A 1LPLA 1QP3A 3CCUT 3UT1A 1Q81R 2EVRA 1GRIA 1RAEB 2MPXC 1W70A 3X20B 3PTAA 4NS5A 5FW9A 5GAOm 4BI4A 3H8ZA 4M7DG 4OGEA 3QYHB 2ZPEB 2PUOB 1PG5B 4IIOA 1OOTA 1TSFA 1YP5A 1ARKA 3L2QA 2V1RA 1BYMA 2X4JA 1YJ9A 3EFOB 2C0IA 4LN2A 2HMAA 1P92A 1SPKA 3RESA 4M78E 4M77B 1S1NA 4Z02A 3OS1A 2X9HA 1X6BA 1ACMB 3BDUA 3R6NA 1AHJB 1BIBA 1ZBXA 2JUFA 2HCKA 4XTVA 1OU9A 3CCET 3OBWA 5DYIA 4A4GA 3GOXA 4M4ZA 4M7AA 1WQ7A 2RQTA 1YJWA 3P8HA 1KSWA 1YIJA 3N5BB 1Q86R 3THKA 2MK5A 1Y96A 1VQ7T 1K9AA 2QEXQ 3A8MB 1ZUUA 3I5SA 4ME7A 5GAMf 1UG1A 2PTKA 2MAMA 1QVGA 3CCSA 4HCZA 1YFNA 1VQNA 3VS6A 1AVZC 2RI2A 2QQAA 3RUXA 1NJIR 1VQ9Q 4RUGA 1QVFA 2LQNA 1ZA2B 3KXTA 4M75F 2RI5A 4ESRA 1R0BG 1U06A 4C8QE 3CCUA 4DA4A 3EFSA 4F7UE 2QDLA 2RJEA 2VASA 4EMKC 4JJNK 4RTZA 1X2KA 2PU9B 1QVPA 3H0HA 3ZEHA 3S3OA 2RHYA 3PFSA 3WVDB 3S3MA 2MCNA 2LQ8A 1QWEA 1Y0MA 2D0QB 3ZFJA 2JTMA 4XQ3A 4C92G 4HT9A 1C1AA 2VYTA 1S72A 4BDYA 1NEBA 1YI2T 1N9RA 2A28A 1N6AA 4ZNXA 3ZGZA 1ZSZA 2PNIA 5FLXE 4J5YA 2RHZA 2DETA 4MMLA 2E64A 1M90U 4J9CA 5EQJB 2QQRA
chains in the Genus database with same CATH topology
4JRKA 4FM4B 4M7DE 2H3JA 3P8BB 2RK2A 3DKMA 3OMCA 1CZ5A 1ZQ1A 5FU6B 3SWNC 2HNIA 4OB0B 4OMFB 3JCMg 5LJ5g 3Q1JA 3X24B 4Y28E 4X9DA 1I81A 2B8AA 4C0ZA 5C1BA 4PJOD 1XNIA 3LH0A 2R57A 4VUBA 3JCMJ 5LJ3d 2PWYA 4AS1A 2QTXA 1YITT 3JCMh 1N9SA 2DAQA 5LJ5h 5GANg 3MB5A 4N4IA 2Q1CX 4IUVA 2Q19X 3M55A 2VXEA 3JCMP 2DXCA 1KC8C 1MHNA 5CQXA 5GANh 5GMKj 3I55A 1S72T 3A8OB 2CGHA 5DYGA 4LDVA 2Q1AX 3FLGA 2JOYA 4BY6B 3JRZA 4OP0A 1VQ7A 4BI8B 1CZ4A 2LW6A 3CEYA 3CPWS 3OYKA 4A54A 2RH2A 5HKCA 2XDDA 2K3YA 3CMAA 2P0PA 2PVDB 1QVGS 1LJOA 1R8OB 2QI2A 2QQSA 3I56T 3MEWA 2VXFA 3OYYA 3M54A 2EFIA 1DJ7B 3SDZA 4ELYC 2KK4A 1PSFA 2O4XA 3E9GA 4BE1A 1QVFS 1LNXA 4J7FA 3OYIA 4JS5A 2BUDA 3HRTA 4M78F 3TEEA 4M77E 3VUBA 2Q1DX 4KBMB 3VUZA 4E7KA 3OS2A 4GY5A 4Y91A 2X4XA 1WPYA 1VQ4T 3M56A 2WSFE 1K9MC 4QVDA 4E7IA 1BKBA 3QXEB 4LD6A 3EFRA 3RERA 3ZJUA 3OYBA 1GXIE 4RCCA 2K57A 1VQMA 1U8RA 2FYKA 2M16A 2O4XB 4FL6A 2EAYA 3OYJA 2G3RA 1KC8U 2CZ0B 1S3SA 2OTLT 4HKEA 1IREB 2AHJB 5LJ5d 4N4HA 3JCMd 3DB3A 4EMKA 3JCMW 1U1SA 1Q81U 3I55T 5CKDA 2ZPGB 4XAXB 3L2WA 2ZGWA 2QA4T 5FTMA 1NZ9A 3E1SA 4KUDK 4KDLA 3QIIA 5GANd 1K8AU 3V8KA 1JJ2A 1I5LA 1KQ1A 4DQ2A 1VQ9A 4OB3B 4M75A 3CMAT 1FXXA 4O5VA 5DLOA 2EKOA 2F69A 2DIQA 1Y71A 3A8GB 4C0FA 4EPCA 3CCMA 2LQKA 1CR5A 3NFCA 3HPWA 4ATOA 4J8OA 2EWNA 2GF7A 4N4GA 1OYXA 4M7AB 5GAMj 4XK8E 3CXCS 3NTIA 5L8RE 4EMKB 3L2UA 2RHIA 5FRMA 2EQKA 1B34A 1WJQA 3CCVA 4M7AE 4M78D 4JRPA 4E7JA 1WGSA 3MHXA 4C5HA 4KULA 1K73C 4PJOA 1FWZA 2KDSA 4J6YA 5J26A 4JLIA 1RI0A 2K2VA 3QDRB 4C8QF 5CAIA 2MM2A 3J80E 4M77D 1Q86C 2L3RA 1M9SA 4JS4A 4XU3A 2BKDN 1OZ2A 4ARCA 2E12A 4C92E 2K5IA 5GAN5 4BB7A 2E70A 1G3WA 2XK0A 4X9CA 4XU2A 5KH6A 2HAXA 3NTHA 4M75C 2XI9A 3MCAB 5I2MA 3JCMc 3DLLA 1VQ5T 4HCCA 5GAOr 2R5AA 3E9FA 3QC8A 2E6NA 1UB4A 1B34B 3JCMQ 3RKYA 3X25B 2IVWA 2ZCFB 3BY7A 3QUIA 3PIPA 3HU3A 5GAMh 4OGCA 1NJIC 5GMKm 5CK9A 1Y7XA 1YJNT 1M4ZA 4B9WA 4C8QC 4M7AG 3URGA 3LWHA 3JCMb 1Q82C 1VQPA 1UGQB 3BDLA 3M5AA 2NLUA 3GPLA 2JN0A 2MF2A 3QJYA 3OYLA 3OA6A 3SWNA 3RMQA 4RG2A 1LOJA 3PMIA 1O9SA 3OSVA 3KUFA 3UDCA 4P5NA 3CCMT 2DIGA 4BE0A 4PJOC 1N8RC 3ME9A 4ZTFA 3QG1A 2QDYB 3HU1A 2V8KA 1VQOT 3QQ7A 4HCBA 2E5QA 2P0KA 4PL6A 3L2VA 3FPUA 3A8HB 5IN1A 3J81E 3CXCA 3G4ST 2KY9A 2ZPFB 3CCJT 4J83A 3CCQA 1K73U 1QP2A 3KBGA 5FTKA 4IURA 2XDPA 3MP1A 2ZPHB 5CCXA 2VC8A 3M9QA 1Q86U 5CR2A 4DOWA 3TU4K 1UGSB 5GAN6 3FIFA 4FIBA 3FDRA 3MEUA 4JDSA 3SWNB 4R55A 1W2BA 4PLIA 5C18A 3AHUA 3GNGA 1BI3A 2PJHB 1WQWA 2JNGA 3L1AA 5GAN4 4C8QD 3CCLT 1XQHA 1G3TA 1H3ZA 2DPPB 1VQ4A 4L6V5 3GIBA 2PQWA 1Q7YU 4M7DF 4OB1B 1M1GA 3OYMA 1NJIU 2PVGB 2A7YA 3NTKA 2C06A 3S3NA 1Q82U 4TVRA 4C92D 2CZ6B 1U1TA 3HP9A 2MM0A 1HK9A 3ASKA 4NL2A 5GAMd 4MZTA 1VQPT 2OTLA 2JV2A 3PT9A 4L59A 3QZ9B 3VU3C 4CQNA 1N8RU 5KE2A 2VV5A 2E10A 2QA4A 1EIFA 2EQUA 4XTYA 5DY9A 1Q81C 1JJ2S 2EQMA 2KAFA 2FVUA 4M7DC 2I2LA 1QDNA 3HL8A 4IUPA 3J7AF 2GFUA 2WSCE 1NPPA 4M78A 2DZ9A 4N0AC 5LJ3e 1K8AC 3FJPA 2DVEA 4QW2A 5GAOl 4RV0A 3CCQT 1RL2A 3HRSA 2V8JA 1UEBA 4NOYA 5HK3A 4KT0E 4LDWA 4XU1A 3UPUA 1VQ8T 3ZBDA 1BI1A 2K3XA 1X01A 4CI0C 2DO3A 3F70A 3CF2A 3QWZA 3OYHA 2F5TX 4J7IA 1VUBA 3G7ZA 4M77F 2F5KA 2A3LA 2RB6A 3MP8A 5GMKh 3G71T 3CMET 4D6WA 1I4K1 2RJFA 4V2SA 3M57A 2YLCA 2LX9A 4M7DD 2MI6A 4XTWA 3INZA 4XTUA 2MWPA 4M78C 2RM4A 1VQ5A 2BIVA 2DXTA 4MDWA 3HU2A 3M58A 2DD5A 4GLKA 4PLLA 4ZGEB 2HQXA 2DXUA 1QCSA 4BUGA 4M77C 5GAN8 3PNWC 3OS0A 5KCOA 3META 1KG1A 4A53A 1YJNA 2VGMA 3QSUA 1OI1A 3CC4T 2DJZA 2DKGA 3DLMA 5J3BA 3MO8A 2Y4XA 3CBPA 3L42A 4NL3A 2YUJA 1G3YA 5CKEA 4IUUA 4QQGA 3OYFA 5CCBA 2X35A 1ZHIA 5LJ5e 4J6WA 3PGGA 3JCMe 3HKSA 2LCCA 2YRVA 4R56A 1VQ6T 2EJFA 2LRQA 3LLRA 1VQOA 3SFMA 4Q5WA 4FT2A 4C8QA 1R7RA 5GANe 2ZZDA 3OB9A 3ZJTA 3G4SA 3CCJA 1SSFA 3SD4A 2E65A 2RHUA 1G3SA 1XTDA 2CZ1B 3C4SA 2LVMA 4QQ6A 4BI3A 3QPHA 3RIRA 5LJ3f 3RKWA 4C0GA 2DXBA 5GAN2 1KQSA 1W2BS 4BACA 5FROA 4M75B 5GAN7 2XD0A 2EIFA 4M7AF 1NPRA 1M1KU 2L89A 3QO3A 4L5GA 2RJDA 4X34A 4F7UF 3VYHB 3A8LB 5D6WA 4M75E 4BD3A 2KSSA 4EMHA 5LJ3j 4E47A 2Y4YA 3CC2A 3CCLA 2DTIA 3QBYA 1QW1A 5GAMg 4QVCA 4C8QB 2JVVA 2R58A 5FTLA 3OYNA 5DLQE 3OYGA 4C92F 5C6SA 3G6ET 3FEOA 1Q7YC 1D3BA 4XTXA 4XU0A 4PNOA 2D9TA 3OW2A 3JB9G 4E7LA 4QQDA 4BE2A 4M75G 1N27A 4PJOB 2YHTA 4MMKA 4JUVA 2CYZB 2P0QA 5C0MA 5CKHA 3FPRA 4OVAA 4WF2A 3HHTB 4C5EA 5CVIA 3V7RA 3O8VA 5GAOp 2ZPIB 3E19A 5CO7A 1WJSA 4PJOE 2CKKA 3QHSA 3QJ6A 4KO8A 3JB9I 4C8QG 3CD6T 5GAOq 1YCYA 2DZCA 4C92C 3FB9A 1YJWT 4JLGA 3OBYA 2PVOB 4FSXA 3JSCA 1NE8A 1D3BB 3CBMA 2RJCA 2XHCA 1YIJT 1YHQA 4PJOG 3LHDA 5CD1A 4HT8A 3HFOA 4C0DC 2O01E 5I2SA 1UGRB 3RKXA 4B9XA 3CPFA 4IKFA 5FRNA 1VQ8A 5M9OA 4M7DA 1JB0E 4HA8A 5J39A 3V7SA 4ZN1A 3JCMf 4N0AA 4A4FA 4CRIA 5LJ5f 2PUKB 4O6JA 4M7AD 3CC2T 3LGAA 2L5QA 2QQBA 4FT4A 5GAN3 5FU7C 2LCLA 3LX7A 3V8JA 3VYGA 5GANf 2YVLA 5CQYA 1BIAA 4MZPA 3G71A 2GQVA 4IUQA 4C5IA 3CMEA 5LJ5j 3GLXA 3CC7A 2B25A 2ZPBB 1V29B 5HK0A 2VUBA 1QP3A 3CCUT 3UT1A 4A4HA 1JRIA 5GANj 3M4YA 4M7DB 4ZTJA 2XIDA 3OS5A 2GCXA 4LD9K 3OQ5A 3BQBA 3CCRT 5A0LA 4RCBA 4LDXA 1H641 2E6ZA 4XTZA 1X6OA 2JZ2A 2RO0A 5EG2A 3QZ5B 3FC3A 5LL6S 3CC4A 1KHCA 1VIFA 2P4TA 1PSEA 3WXMB 3X20B 5A0DA 3PTAA 4RMOA 2K5FA 3WVEB 3MEVA 2DTOA 2RHXA 4NS5A 5GAOm 4BI4A 3H8ZA 3X26B 1Y07A 2XDBA 1VQLT 3R6OA 3CCEA 1YHQT 2MMPA 1VQKT 1M1FA 5GAMe 4MDXA 4M7DG 5FU6C 1KD1C 4M77A 4OGEA 3BFMA 1VQ6A 2E64A 2JTFA 3QYHB 2E1HA 3TREA 2LNVA 2M0OA 2KVQG 2ZPEB 2PUOB 2GFAA 1M8VA 2RD1A 2IG0A 1KQSS 4FU6A 2OTJT 4J6XA 2FL7A 2RA2A 3L2QA 1WJRA 4M78B 3GF5A 4QVZA 1BYMA 3LW5E 5GLFA 1KHIA 2X4JA 1YJ9A 3CC7T 3VKIA 2CZ7B 1ZC1A 1M5Q1 3SB2A 3RESA 1P92A 1O75A 1E32A 5D6XA 3FPTA 2EQJA 4M78E 3M59A 4BY6C 3TCJA 4BDZA 4M77B 1WNLA 3VJPA 1M1KC 2D6FA 3ER0A 3QQ8A 3QKJA 4Z02A 3OS1A 5D6YA 5CCAA 2LT4A 3QYGB 1HXDA 2FHDA 2EYQA 3OMGA 3VV0A 2VGNA 2DEQA 3BDUA 2LDMA 3L2RA 3G6EA 2X4YA 2HBPA 2HD0A 3OW2S 4OF1A 1O54A 2X4WA 1BIBA 1AHJB 4M78G 1ZBXA 2JUFA 3M53A 4YTLA 1JBMA 4XTVA 1FX7A 5B6CA 1MGQA 3LYIA 2K4YA 1KD1U 3CCET 3OBWA 3LWIA 4M77G 2WSEE 3HRUA 3ZJVA 5I21A 2DTHA 3P8DA 5IT9E 5DYIA 3JCMX 5FTJA 1TH7A 4IUTA 3A5ZB 4A4GA 3CD6A 3GOXA 2QEXA 5IAYA 4M7AA 1WQ7A 1YJWA 3P8HA 4PKCC 3OYAA 2CS7A 2KQWA 4F7UA 5KE3A 1WLFA 1YIJA 3N5BB 4AQ7A 1BI2A 4ZGJB 1Y96A 3JAME 1VQ7T 2V8IA 3PMTA 2DK3A 3A8MB 4C92A 1YJ9T 4ME7A 5GAMf 3CPWA 1M90U 2MAMA 3EAEA 2MWOA 3JCMV 1QVGA 3CCSA 4HCZA 2YLBA 3MEAA 3GNFB 4RKUE 5FTNA 4LDUA 3X28B 2XICA 1YI2A 2RI2A 1VQNA 2QQAA 3RUXA 1QVFA 4RG8A 3KXTA 3JB9F 2WACA 1UGPB 2QQ9A 3HFNA 2RI5A 4M75F 4C5GA 4F7UB 4KLNA 1YBYA 3DB4A 3BW1A 4JRIA 4C8QE 2R5MA 3CCUA 1Y96B 5GAOn 4DA4A 3EFSA 3RMSA 2E41A 5GMKe 1K9MU 4M7AC 3C95A 4F7UE 5CIUA 1W4SA 2RJEA 4EMKC 2Q18X 4C92B 4JJNK 1G5VA 2PU9B 1M90C 5AYFA 3CCRA 3HSBA 4E7HA 3M4GA 3LGFA 1VQMT 3T9NA 5CKFA 3V7CA 2HQEA 5LJ3g 2QXFA 4ARIA 1QVPA 4A4KA 3PIOA 3ZEHA 4DOVA 2EJGA 5HY6A 2QEXT 4UC4A 3S3OA 1OZ3A 2RHYA 4PJOF 4KUIA 3PFSA 2RK1A 4C0DB 4F7UG 2KMTA 4MZMA 3WVDB 3S3MA 2LQ8A 3OYEA 3CBOA 3OSSC 5LJ3h 1VQLA 1VQKA 4A4EA 5KCHA 3S6WA 4JRQA 4KODA 3UWNA 2D0QB 2LC4A 2JTMA 3ZFJA 2LTOA 1IZ6A 4XQ3A 4C92G 1YITA 4HT9A 3V8LA 5EPPA 3H6ZA 5FU7B 3TIWA 1I8FA 2XG8D 5GMKl 1VQ9T 1I9GA 2M9UA 1BI0A 3OYDA 4II1A 2RI3A 3OY9A 2VYTA 3GP8A 2DD4A 5ERGB 4LDYA 3CCST 2OAUA 3LGLA 3MP6A 4BDYA 1S72A 2M1HA 4EDUA 2OTJA 2LT1A 1N9RA 4ZGDB 1YI2T 3FRNA 4OB2B 4EMGA 1N6AA 1VQNT 3ZGZA 1VIEA 2FB7A 5FLXE 4J5YA 3OYCA 3JB9J 3C12A 3L2ZA 5DM7R 3JB9H 2RHZA 2K5LA 1XOVA 3CCVT 5CKBA 2Y90A 3JB9D 1KQ2A 3I56A 2XKOC 3C94A 1X75C 4M75D 4MMLA 4ELZC 2XU8A 5A0GA 4ZN3A 2EJ9A 5A2QE 2L8DA 5GMKi 4KDIA 5EQJB 2QQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIB A;  2KY9 A; 
#chains in the Genus database with same CATH topology
 4EIK A;  1JXM A;  4M7D E;  2H3J A;  3I56 Q;  2FG0 A;  1ZQ1 A;  3MJX A;  4X9D A;  1I81 A;  3LH0 A;  1UHF A;  4VUB A;  2KBT A;  3JCM J;  2PWY A;  2QTX A;  3JCM h;  5LJ5 h;  2DAQ A;  1VQ4 Q;  2Q19 X;  3M55 A;  3JCM P;  1NYG A;  4J9D A;  3FLG A;  3JRZ A;  1VQ7 A;  2LW6 A;  1QMC A;  1M3B A;  2RH2 A;  1D0Z A;  3OW2 P;  1RLP C;  1LVK A;  2DER A;  1LJO A;  2VXF A;  3PVL A;  3M54 A;  3SDZ A;  1AEY A;  3OYI A;  1OEB A;  2Q1D X;  4E7K A;  4Y91 A;  4RTY A;  2ATC B;  3M56 A;  2CP6 A;  1C0M A;  4KGX B;  4QVD A;  3UA7 A;  3EFR A;  3RER A;  3OYB A;  2K57 A;  2FYK A;  3OYJ A;  2CZ0 B;  2HEQ A;  5IHN A;  3TQ7 P;  1S3S A;  2AHJ B;  5LJ5 d;  4N4H A;  3JCM d;  3DB3 A;  2KRN A;  5CKD A;  2ZPG B;  5FTM A;  1NZ9 A;  1ZX6 A;  3QII A;  3V8K A;  1KQ1 A;  1QCN A;  4LNP A;  5DLO A;  2HL3 A;  3NFC A;  4CC2 A;  4J8O A;  2GQI A;  2GF7 A;  4M7A B;  1OYX A;  3CXC S;  5FRM A;  5L8R E;  2A37 A;  2RHI A;  2EQK A;  1B34 A;  8ATC B;  2YT6 A;  4KGZ B;  3MHX A;  4Z8A A;  1K73 C;  2X3W D;  1WFW A;  3H0F A;  1M9S A;  2KXD A;  4FYY B;  1IHW A;  2BKD N;  2E12 A;  4C92 E;  4X9C A;  4CC4 B;  4JJB A;  3NTH A;  4Z88 A;  3JCM c;  4HCC A;  5GAO r;  2R5A A;  3E9F A;  1UB4 A;  2EKH A;  2ZCF B;  3HU3 A;  5GAM h;  3G1J A;  3CCL Q;  1Q82 C;  3JCM b;  1UGQ B;  3BDL A;  2MF2 A;  3OA6 A;  3QJY A;  2YUN A;  1B7T A;  2EYZ A;  2LX7 A;  2DIG A;  3ME9 A;  3CQT A;  3QG1 A;  1D1B A;  3HU1 A;  2E5Q A;  2O88 A;  3A8H B;  1M8M A;  1QP2 A;  3MP1 A;  4KGV B;  1UGS B;  3A98 A;  3FDR A;  3SWN B;  2GTJ A;  3CCQ Q;  3GNG A;  2PJH B;  3L1A A;  5KYY B;  2D8H A;  2J05 A;  1WZO A;  1H3Z A;  1D1A A;  1ZSZ B;  1V1C A;  1Q7Y U;  2LP5 A;  2PVG B;  1GBQ A;  2A7Y A;  2J6K A;  3NTK A;  4C92 D;  1HK9 A;  3ASK A;  5GAM d;  3G71 Q;  4L59 A;  3CME Q;  3RDV A;  4QKU A;  2E10 A;  2EQU A;  4XTY A;  1JJ2 S;  3HL8 A;  2GFU A;  4N0A C;  5LJ3 e;  1G8X A;  3FJP A;  1SRM A;  3EG0 A;  2V8J A;  2CP0 A;  1UEB A;  2W10 A;  4FYX B;  4AT1 B;  1VQ8 T;  1I07 A;  1BI1 A;  2COY A;  3QWZ A;  2EBP A;  2F5T X;  4J7I A;  3G7Z A;  3MP8 A;  2LX9 A;  4XTW A;  3GBQ A;  4M78 C;  1UUE A;  4MDW A;  1X2Q A;  4BUG A;  1QCF A;  1RAG B;  3PNW C;  2OAW A;  2DLP A;  3OS0 A;  4CC3 A;  2DJZ A;  3DLM A;  4OMQ A;  3MO8 A;  3CBP A;  2B86 A;  2YUJ A;  4IUU A;  2AKL A;  4QQG A;  3HKS A;  2LCC A;  3NHN A;  1VQ6 T;  2F2W A;  2LRQ A;  3LLR A;  1H3H A;  3SFM A;  1G2B A;  1R7R A;  5GAN e;  3O5Z A;  1SSF A;  3UAT A;  2RHU A;  4QQ6 A;  5GJW B;  1M90 R;  2LVM A;  4C0G A;  2DXB A;  5GAN 2;  3REB B;  1GCQ A;  1YJW Q;  5GAN 7;  2E5K A;  2HSE B;  4M7A F;  2CH4 W;  1WLP B;  2RJD A;  4X34 A;  1YIJ Q;  3VYH B;  2W0Z A;  2NYS A;  5D6W A;  3CC2 A;  5LJ3 j;  2KR3 A;  1QW1 A;  5GAM g;  4C8Q B;  2R58 A;  3OYN A;  1Q7Y C;  4WTO B;  3TSW A;  2D9T A;  1G83 A;  1N27 A;  1W1F A;  1UE9 A;  4MMK A;  4JUV A;  2P0Q A;  1RLQ C;  5CKH A;  1X43 A;  3FPR A;  4OVA A;  3HHT B;  1IGU A;  3E19 A;  4PJO E;  2CKK A;  3QHS A;  1QWF A;  4KO8 A;  3CCU Q;  1I5O B;  5GAO q;  3FB9 A;  4JLG A;  4HT8 A;  3QWY A;  3IQL A;  2O9S A;  2O01 E;  2YSQ A;  5I2S A;  1VQ8 A;  5J39 A;  2ZAE A;  1WYX A;  3LGA A;  2L5Q A;  4LXC A;  3VYG A;  1BIA A;  4C5I A;  3CC7 A;  1V29 B;  1S72 Q;  1IHV A;  2VVK A;  2DBM A;  5GAN j;  2C0T A;  8AT1 B;  4M7D B;  2KT1 A;  1JXO A;  3UA6 A;  3OS5 A;  3OQ5 A;  1PHT A;  1M2O A;  1H64 1;  1X6O A;  3FC3 A;  3QZ5 B;  5LL6 S;  3QQ8 A;  2P4T A;  4RMO A;  3X26 B;  1Y07 A;  1VQL T;  4MDX A;  1VQK T;  2MMP A;  2FPD A;  5FU6 C;  4M77 A;  1RAF B;  1IXD A;  1ABQ A;  1VQ6 A;  1ZA1 B;  2JTF A;  2LNV A;  2GTO A;  3CCE Q;  3EG9 B;  2FL7 A;  2BE9 B;  1U5S A;  2L2P A;  2KEA A;  1M5Q 1;  3SB2 A;  1Z9Q A;  2EQJ A;  4BY6 C;  2DBK A;  3VJP A;  1WNL A;  2CT4 A;  1VQ7 Q;  2H8H A;  2LT4 A;  3QYG B;  2FHD A;  3OMG A;  3L2R A;  2DEQ A;  3OW2 S;  2X4Y A;  2HD0 A;  1O54 A;  2X4W A;  4M78 G;  4YTL A;  3CXC P;  5B6C A;  1MGQ A;  3LYI A;  2YRD A;  3ZJV A;  3M0S A;  1EFN A;  1W2B P;  1CKA A;  5ECA A;  4PKC C;  1MND A;  1EX4 A;  1WLF A;  4AQ7 A;  3H41 A;  3JAM E;  2V8I A;  2DK3 A;  1HJD A;  4PJJ A;  3VS3 A;  1YJ9 T;  3CPW A;  2JT4 A;  1HSQ A;  1Q7Y R;  4AFQ C;  2ABL A;  2WAC A;  3HFN A;  4C5G A;  1Z9Z A;  3BW1 A;  2R5M A;  5GAO n;  1YI2 Q;  3RMS A;  5GMK e;  3EHQ A;  3TVT A;  4C92 B;  2KYB A;  2AT1 B;  1YNZ A;  3A1P A;  4E7H A;  2COW A;  3LGF A;  1VQM T;  3T9N A;  7AT1 B;  6AT1 B;  1I0C A;  4ARI A;  4DOV A;  2EJG A;  2V26 A;  4F16 A;  4F7U G;  2KMT A;  4MZM A;  3CBO A;  1VQL A;  1VQK A;  4OML A;  3S6W A;  4JRQ A;  2L0A A;  1YIT A;  1RAI B;  5EPP A;  3H6Z A;  5FU7 B;  3MPU B;  1I8F A;  1I9G A;  3OYD A;  1UJ0 A;  2J6O A;  4LDY A;  3CCS T;  1VQN T;  4EMG A;  4OB2 B;  1VIE A;  2E3H A;  1ZBJ A;  4KH1 B;  3JB9 J;  1FYN A;  1JJ2 P;  1OV3 A;  2XKO C;  3C94 A;  4ELZ C;  1RAD B;  4JJC A;  3VRY A;  1RAC B;  5GMK i;  4KDI A;  1SF9 A;  2FPE A;  2EPD A;  1KIK A;  3X24 B;  2B8A A;  2COZ A;  1KQS P;  2R57 A;  1PC0 A;  4AS1 A;  5IH2 A;  2EYX A;  2Q1C X;  3EG1 A;  4IUV A;  2VXE A;  2DXC A;  1KC8 C;  5GMK j;  3I55 A;  1S72 T;  4LDV A;  2XMF A;  2JOY A;  1UGV A;  2X3X D;  3OYK A;  5HKC A;  1RI9 A;  3CMA A;  1R8O B;  2QQS A;  4D8K A;  4E2F B;  1U3O A;  1OPL A;  1EZZ B;  2RMO A;  2NWM A;  3M0R A;  4KBM B;  2AZV A;  2PZ1 A;  4LUD A;  4AMC A;  2X4X A;  1WPY A;  3QWX X;  4E7I A;  4R0K A;  4RCC A;  1VQM A;  5KYX B;  2JMC A;  4FL6 A;  2L3P A;  2G3R A;  1PRL C;  4HVW A;  2FO0 A;  2OTL T;  4HKE A;  2DL3 A;  1IRE B;  3JCM W;  2QA4 T;  3L2W A;  1AWO A;  2ZGW A;  4KUD K;  4FYW B;  2EKO A;  2F69 A;  2DIQ A;  3A8G B;  1OU8 A;  4EPC A;  3CCM A;  2A36 A;  3HPW A;  1M2V B;  4N4G A;  4DBQ A;  1NEG A;  4EMK B;  2AKK A;  1PD1 A;  2YWW A;  1NG2 A;  4M78 D;  4JRP A;  4JLI A;  1RI0 A;  3QDR B;  2JMA A;  4JZ4 A;  4OMP A;  4XU3 A;  4ARC A;  2KT8 A;  2K5I A;  2DL8 A;  4BB7 A;  4XU2 A;  1N5Z A;  2DFU A;  1VQ5 T;  2LJ0 A;  1E7O A;  2ENM A;  4OGC A;  5CK9 A;  2RQU A;  1M4Z A;  1VQP A;  2NLU A;  3OYL A;  2ED0 A;  3SWN A;  3RMQ A;  4RG2 A;  5GJV B;  3OSV A;  3KUF A;  1NM7 A;  5KYY A;  4ANJ A;  1N8R C;  4PJO C;  2V8K A;  1VQO T;  3C0C A;  2P0K A;  4PL6 A;  5IN1 A;  2J7I A;  3G4S T;  2ZPF B;  3CCJ T;  1HD3 A;  1MMN A;  1K73 U;  2DM1 A;  4HVU A;  3KBG A;  4K11 A;  3FIF A;  1GL5 A;  2SEM A;  3MEU A;  2F1L A;  4JDS A;  4R55 A;  1M30 A;  2EGC A;  1YN8 A;  1TWB A;  5GAN 4;  4C8Q D;  1G3T A;  1RAB B;  1VQ8 Q;  3U23 A;  3OYM A;  2QAS A;  2BZX A;  2C06 A;  1BBZ A;  3S3N A;  1Q82 U;  2CZ6 B;  3LH5 A;  4MZT A;  2OTL A;  3PT9 A;  3QZ9 B;  1QVG P;  5KE2 A;  1Y57 A;  2VV5 A;  2QA4 A;  2EQM A;  4OMN A;  1QDN A;  2VKN A;  4M78 A;  3AT1 B;  1KFZ A;  4RV0 A;  1QLY A;  5D7U A;  1IB8 A;  3ZBD A;  2DO3 A;  3EGD A;  1VQ6 Q;  4M77 F;  2FPF A;  1MV0 B;  2RB6 A;  1TOV A;  2CP7 A;  1I4K 1;  2RJF A;  4V2S A;  3M57 A;  2YLC A;  1SHG A;  4M7D D;  4FYV B;  3VS5 A;  3INZ A;  1VQ5 A;  3HU2 A;  2D0N A;  4PLL A;  1TTH B;  2O31 A;  2M02 A;  1QCS A;  2HSP A;  2K79 A;  1H8K A;  2K6D A;  5GAN 8;  3VS1 A;  5KCO A;  1KG1 A;  2VGM A;  1OI1 A;  3CC4 T;  2JJ9 A;  2MIO A;  5J3B A;  2DJQ A;  3L42 A;  5CKE A;  1VOM A;  3JCM e;  2O2O A;  5LJ5 e;  1VQO A;  4C8Q A;  1LCK A;  3G4S A;  3CCJ A;  1D0Y A;  1MMG A;  1G3S A;  3C4S A;  3H9N A;  3RIR A;  3RKW A;  1W2B S;  4BAC A;  2IIM A;  4ORZ A;  5FRO A;  2XD0 A;  1NYF A;  4L5G A;  1RAH B;  3A8L B;  4M75 E;  4BD3 A;  2RQW A;  1GFC A;  1J3T A;  1PWT A;  9ATC B;  2JVV A;  5FTL A;  3OYG A;  3FEO A;  4XU0 A;  4RTW A;  1AWX A;  3JB9 G;  4E7L A;  4BE2 A;  1M3C A;  1K1Z A;  1SKU B;  5CVI A;  5CO7 A;  1KK7 A;  3SHW A;  1JQQ A;  4RTV A;  3JB9 I;  1C6V X;  2DZC A;  3OBY A;  1NLO C;  4FSX A;  1NE8 A;  1IO6 A;  2E4H A;  3CBM A;  4HCK A;  1YHQ A;  2DL5 A;  1BK2 A;  4PJO G;  5CD1 A;  4C0D C;  3RKX A;  5FRN A;  4IKF A;  3NGP A;  4M7D A;  4FW1 A;  1JB0 E;  4HA8 A;  4CRI A;  1VQL Q;  1VQK Q;  1X69 A;  3CC2 T;  4FT4 A;  2KRS A;  3NMZ C;  2L3S A;  2YVL A;  4IUQ A;  5LJ5 j;  1PD0 A;  2B25 A;  2ZPB B;  3BE3 A;  2VUB A;  4IIM A;  4A4H A;  1RAA B;  4ZTJ A;  2JS2 A;  2GCX A;  4LD9 K;  3FJ5 A;  2DRK A;  4LDX A;  3EG9 A;  2DIL A;  2JZ2 A;  4XTZ A;  3HSB A;  2LJ3 A;  1KHC A;  2OX7 A;  2EYW A;  1PSE A;  3CC4 A;  3MEV A;  2DTO A;  2RHX A;  3SEM A;  3R6O A;  1TS9 A;  1M1F A;  5GAM e;  2KXC A;  1VYT A;  1KD1 C;  2EYY A;  1ZSZ C;  3BFM A;  1YWP A;  2M0O A;  2GFA A;  1BCO A;  4KRT A;  2IG0 A;  1KQS S;  2OTJ T;  2O9V A;  1TUD A;  4M78 B;  3GF5 A;  4QVZ A;  3CC7 T;  3VKI A;  2NUZ A;  4E7S A;  1ZC1 A;  4RTX A;  1E32 A;  2FRW A;  4BDZ A;  3M59 A;  3TCJ A;  2D6F A;  2FZK B;  5CCA A;  1YJ9 Q;  1HXD A;  2EYQ A;  2KYM A;  3EGD B;  3M53 A;  3D7S B;  1AT1 B;  3LWI A;  2WSE E;  2DTH A;  3P8D A;  5FTJ A;  1TH7 A;  2DE0 X;  4IUT A;  2QEX A;  1AWW A;  5IAY A;  3OYA A;  1K73 R;  2CS7 A;  2KQW A;  1X6G A;  5KE3 A;  1VQM Q;  1WDX A;  2GNC A;  4ZGJ B;  2QTV A;  2ED1 A;  4C92 A;  1VA7 A;  2ESW A;  3EAE A;  2K2M A;  3MEA A;  4DBR A;  5FTN A;  4LDU A;  3X28 B;  2XIC A;  2FZG B;  4RG8 A;  1Q82 R;  4F7U B;  1HYO A;  1T3S A;  3CCS Q;  1VQN Q;  2E41 A;  5CIU A;  4D8D A;  1G5V A;  5AYF A;  2IPO B;  5CKF A;  3V7C A;  2HQE A;  5LJ3 g;  1W6X A;  3PIO A;  1WXB A;  5HY6 A;  2BZ8 A;  2C0O A;  4UC4 A;  1OZ3 A;  4FCY A;  4KUI A;  4RTT A;  3OSS C;  2CH4 A;  4F17 A;  5KCH A;  4J9E A;  3UWN A;  4KOD A;  2LC4 A;  3EH1 A;  1IZ6 A;  3V8L A;  3TIW A;  2XG8 D;  2M9U A;  3VS0 A;  3OY9 A;  2DA9 A;  2OAU A;  3LGL A;  3MP6 A;  4OMO A;  2OTJ A;  2CSI A;  1WHJ A;  2FB7 A;  3C12 A;  2CP3 A;  3L2Z A;  5DM7 R;  3JB9 H;  3CCV T;  5CKB A;  2Y90 A;  3JB9 D;  1KQ2 A;  3I56 A;  4J9B A;  1TU0 B;  1X75 C;  5A2Q E;  2XU8 A;  4ZN3 A;  2EJ9 A;  2CP5 A;  4DBH A;  2HQH A;  4FM4 B;  1CZ5 A;  5FU6 B;  1GCP A;  2HNI A;  4OMF B;  1SRL A;  4Y28 E;  4C0Z A;  4PJO D;  1XNI A;  1YIT T;  5KYU B;  1N9S A;  1RUW A;  5GAN g;  4N4I A;  2EW3 A;  3NPF A;  2OJ2 A;  1MHN A;  4GBQ A;  5CQX A;  3A8O B;  3I5R A;  5I11 A;  2Q1A X;  3MKD A;  4BY6 B;  3M0P A;  4OP0 A;  4BI8 B;  1CZ4 A;  1NLP C;  2OTL Q;  4A54 A;  2K3Y A;  1R77 A;  1QVG S;  2QA4 Q;  1B3Q A;  2QI2 A;  1R0C B;  3OYY A;  2DF6 A;  5KYX A;  1QVF S;  1DJ7 B;  2KK4 A;  4HXJ A;  1LNX A;  5FWB A;  5KYN A;  4J7F A;  2BUD A;  4M78 F;  3VUB A;  4GY5 A;  1NBE B;  3PVQ A;  2WSF E;  1PKS A;  1T0J A;  2YDL A;  1BKB A;  4QT7 A;  1FMW A;  4LD6 A;  4F14 A;  3ZJU A;  3UF4 A;  1WIE A;  1OUL A;  2O4X B;  2EAY A;  2F2V A;  1M2V A;  1KC8 U;  2MOX A;  5EC7 A;  2OI3 A;  4EMK A;  1U1S A;  2KE9 A;  3I55 T;  4XAX B;  5IXB A;  3E1S A;  1K8A U;  1WHL A;  1JJ2 A;  1I5L A;  1WXU A;  1VQ5 Q;  1AZE A;  4DQ2 A;  4OB3 B;  3CMA T;  2RPN A;  1Y71 A;  2K9G A;  3I35 A;  2LQK A;  1ZLM A;  1ZSG A;  4ATO A;  2EWN A;  2V1Q A;  4XK8 E;  4JPB W;  3NTI A;  3L2U A;  1WJQ A;  2KI7 A;  3CCV A;  4M7A E;  2CRE A;  4C5H A;  1VQO Q;  4KUL A;  4PJO A;  2KDS A;  5J26 A;  4J6Y A;  4J9H A;  1OQK A;  1K0X A;  4C8Q F;  5CAI A;  2MM2 A;  3J80 E;  3G4S Q;  1Q86 C;  3CCJ Q;  4JS4 A;  5GAN 5;  2EGE A;  2XK0 A;  1G3W A;  5KH6 A;  5I2M A;  4M75 C;  2XI9 A;  2AIR B;  3QC8 A;  2E6N A;  3RKY A;  2IVW A;  3BY7 A;  1NJI C;  5HCK A;  1YJN T;  3URG A;  2RN8 A;  1LOJ A;  3PMI A;  3UDC A;  3CCM T;  4ZTF A;  2HKN A;  1GCQ C;  2QDY B;  3QQ7 A;  3L2V A;  5IXF A;  3CCQ A;  4IUR A;  5CCX A;  3M9Q A;  4DOW A;  4OMM A;  1UEC A;  2CUD A;  2A0F B;  1UTI A;  2JNG A;  2LZ6 B;  3GIB A;  4M7D F;  4TVR A;  1U1T A;  3HP9 A;  3CPW P;  2MM0 A;  1TG0 A;  4NL2 A;  1VQP T;  2JV2 A;  2CT3 A;  4AFU C;  1N8R U;  2NUT B;  3EH2 A;  1EIF A;  5DY9 A;  2I2L A;  4DEY A;  4IUP A;  3J7A F;  1NPP A;  1K8A C;  2DZ9 A;  4QW2 A;  1RL2 A;  2HBW A;  2DEU A;  3HRS A;  1FMV A;  2HL5 C;  2HZY A;  5HK3 A;  2YUP A;  3CC4 Q;  4KT0 E;  3H0I A;  3UPU A;  1ABO A;  1MMD A;  2K3X A;  1X01 A;  1UJY A;  3REA B;  2DMO A;  1VUB A;  3ZL7 C;  2NUP B;  2JM8 A;  1ZUY A;  2BIV A;  2DXT A;  1OX9 A;  4ZGE B;  2HQX A;  4WCI A;  4M77 C;  1AOJ A;  1MMA A;  3MET A;  4A53 A;  1YJN A;  3QSU A;  1CKB A;  1ZUK A;  1WHG A;  2RQR A;  4NL3 A;  3RR6 A;  4PJM A;  2X35 A;  1ZHI A;  3PGG A;  1WXT A;  4R56 A;  2EJF A;  1OX8 A;  2HDA A;  4FT2 A;  4AG1 C;  1UDL A;  3OB9 A;  1OPK A;  4E7Z A;  3ZJT A;  4Y92 A;  5I22 A;  2DNU A;  2E65 A;  1XTD A;  2CZ1 B;  2JXB A;  1D09 B;  5LJ3 f;  2K3B A;  2EIF A;  1MUZ A;  1M1K U;  2L89 A;  3EGX B;  2DVJ A;  2DTI A;  3QBY A;  4C92 F;  5C6S A;  3G6E T;  3OW2 A;  1KJW A;  3CC2 Q;  2P4R A;  4M75 G;  4PJO B;  2FRY A;  5C0M A;  4WF2 A;  3O8V A;  5GAO p;  1X27 A;  3CD6 T;  1QQJ A;  2KNB B;  3JSC A;  2LQW A;  1D3B B;  3LHD A;  2QGF B;  2F2X A;  1WA7 A;  1UGR B;  4PJN A;  3CPF A;  5M9O A;  1BB9 A;  3V7S A;  4ZN1 A;  1M3A A;  4A4F A;  4N0A A;  2M0Y A;  4O6J A;  2LCL A;  3V8J A;  5GAN f;  4MZP A;  3EGU A;  2BTT A;  3GLX A;  2I0N A;  4PFZ A;  1KC8 R;  2OTJ Q;  1JRI A;  1TXQ A;  3M4Y A;  2XID A;  3CC7 Q;  3BQB A;  3CCR T;  1K8A R;  2D8J A;  5A0L A;  4RCB A;  2E6Z A;  1QVF P;  2RO0 A;  5EG2 A;  1VIF A;  3WXM B;  5A0D A;  2K5F A;  3WVE B;  2XDB A;  4F04 B;  3CCE A;  1YHQ T;  3EG2 A;  4DEX A;  3TRE A;  2E1H A;  1IGQ A;  2KVQ G;  2JS0 A;  2QG9 B;  1M8V A;  2X51 A;  1QKW A;  4AFZ C;  1PRM C;  2RD1 A;  4FU6 A;  2DL4 A;  2RF0 A;  4J6X A;  2RA2 A;  3VS4 A;  4AFS C;  1WJR A;  3VRZ A;  1GBR A;  3LW5 E;  5GLF A;  1KHI A;  1PCX A;  2CZ7 B;  1JEG A;  1O75 A;  2H3E B;  5D6X A;  3FPT A;  1M1K C;  1VYV A;  3ER0 A;  1SG5 A;  3QKJ A;  5D6Y A;  2CSQ A;  1MNE A;  3G6E A;  1Q95 G;  3VV0 A;  2VGN A;  2LDM A;  2HBP A;  4OF1 A;  3TSZ A;  1JBM A;  1TUG B;  1FX7 A;  2MYS A;  2K4Y A;  1KD1 U;  1E6H A;  1QKX A;  4M77 G;  2EQI A;  3HRU A;  1WHM A;  3M0U A;  1D0X A;  5I21 A;  2J06 A;  5KYW A;  5IT9 E;  3JCM X;  2QK0 A;  3CD6 A;  3A5Z B;  2BE7 D;  3HTR A;  4B6M A;  1M27 C;  4F7U A;  3EHR A;  4AG2 C;  3M0T A;  1BI2 A;  1JO8 A;  3PMT A;  4PFP A;  2MWO A;  2JW4 A;  3JCM V;  2YLB A;  3GNF B;  4RKU E;  2EGA A;  1YI2 A;  3JV3 A;  1B07 A;  3JB9 F;  1UGP B;  2QQ9 A;  4KLN A;  1YBY A;  3DB4 A;  4JRI A;  1Y96 B;  1K9M U;  4M7A C;  3C95 A;  1N8R R;  1W4S A;  2Q18 X;  2L3Q A;  1M90 C;  1GFD A;  3CCR A;  3CCV Q;  3M4G A;  2A08 A;  1YCS B;  2QXF A;  4A4K A;  2QEX T;  4C0D B;  4PJO F;  2RK1 A;  3OYE A;  5LJ3 h;  4A4E A;  2AZS A;  2LTO A;  2ROT A;  3PE0 A;  2YRC A;  1VQ9 T;  5GMK l;  1BI0 A;  4II1 A;  2RI3 A;  3GP8 A;  2DD4 A;  4J9F A;  5ERG B;  2E3I A;  2M1H A;  4EDU A;  1YIT Q;  2LT1 A;  4ZGD B;  3FRN A;  4PK4 A;  4LUE A;  1PM3 A;  3OYC A;  2K5L A;  1XOV A;  4M75 D;  5A0G A;  5KYU A;  5L23 A;  2L8D A;  2D1X A;  1PSF A;  1SHF A;  1YWO A;  2G6F X;  4JRK A;  3P8B B;  2LMJ A;  1IRX A;  2RK2 A;  3DKM A;  3OMC A;  1UFF A;  3SWN C;  4OB0 B;  3JCM g;  5LJ5 g;  3Q1J A;  4X1V A;  1FMK A;  5C1B A;  5LJ3 d;  2KRM A;  3MB5 A;  2DYI A;  1WX6 A;  3I9Q A;  5GAN h;  5DYG A;  2CGH A;  2HKQ B;  1M1K R;  3RNJ A;  3CEY A;  3CPW S;  2XDD A;  2P0P A;  2PVD B;  3I55 Q;  1A0N B;  3I56 T;  3MEW A;  4ELY C;  2EFI A;  2O4X A;  3E9G A;  4BE1 A;  4JS5 A;  3HRT A;  3CMA Q;  3TEE A;  4M77 E;  3VUZ A;  2YUQ A;  3OS2 A;  3E2U A;  4KH0 B;  1VQ4 T;  4J9I A;  1K9M C;  3QXE B;  1GXI E;  1U8R A;  1JU5 C;  2M16 A;  1K76 A;  4JZ3 A;  1Q81 U;  4KDL A;  5GAN d;  4E6R A;  1VQ9 A;  4M75 A;  1FXX A;  4O5V A;  3ULR B;  4C0F A;  5KYW B;  1CR5 A;  1YJN Q;  5GAM j;  2CUB A;  2DX1 A;  2LCS A;  3CCM Q;  4E7J A;  4FW2 A;  1WGS A;  1FWZ A;  4HVV A;  2K2V A;  2JM9 A;  4M77 D;  2L3R A;  2Z0W A;  1OZ2 A;  4M7A G;  1T3L A;  2HAX A;  2E70 A;  1VYU A;  1H92 A;  3MCA B;  3DLL A;  2LNH B;  3M0Q A;  2DYB A;  1B34 B;  3JCM Q;  3X25 B;  3QUI A;  3PIP A;  5GMK m;  1Y7X A;  4B9W A;  4C8Q C;  3LWH A;  3GPL A;  3M5A A;  2JN0 A;  1O9S A;  4BE0 A;  1BU1 A;  4P5N A;  1PNJ A;  1F1B B;  1XJW B;  4LE9 A;  1VQP Q;  4HCB A;  2DL7 A;  5IHI A;  3FPU A;  3EG3 A;  1WHH A;  1WHK A;  3J81 E;  3CXC A;  4CC7 A;  2KY9 A;  2QAZ A;  4J83 A;  2M51 A;  4FSS A;  4RTU A;  5FTK A;  2QGG A;  2XDP A;  2ZPH B;  2KGT A;  2VC8 A;  1Q86 U;  5CR2 A;  3TU4 K;  5GAN 6;  4FIB A;  2YUO A;  1W2B A;  4PLI A;  2NUT A;  5C18 A;  3AHU A;  1BI3 A;  1WQW A;  3CCL T;  1XQH A;  2DPP B;  1VQ4 A;  1KD1 R;  4L6V 5;  2PQW A;  4OB1 B;  1M1G A;  1K4U S;  1NJI U;  5FWC A;  4GLM A;  1SEM A;  2K7A A;  3VU3 C;  4CQN A;  1MV3 A;  1Q81 C;  2KAF A;  2FVU A;  4M7D C;  2WSC E;  2DVE A;  2RQV A;  3EFO A;  5GAO l;  4Z89 A;  3CCQ T;  2DRM A;  2NUP A;  4NOY A;  4LDW A;  4XU1 A;  2J6F A;  4A63 B;  4PJL A;  1PKT A;  2FZC B;  1K9M R;  4CI0 C;  2BZY A;  3F70 A;  3CF2 A;  2GGR A;  3OYH A;  2F5K A;  2A3L A;  5GMK h;  3G71 T;  1E6G A;  2VWF A;  4PFO A;  4D6W A;  3CME T;  2GBQ A;  2MI6 A;  4XTU A;  2MWP A;  2RM4 A;  3M58 A;  2DD5 A;  4GLK A;  2DXU A;  1WI7 A;  2CP2 A;  4JJD A;  3KFV A;  2P84 A;  2DKG A;  2Y4X A;  3G6E Q;  1G3Y A;  1K0S A;  5CCB A;  2RNA A;  3OYF A;  4J6W A;  3EGX A;  2YRV A;  4Q5W A;  1CSK A;  2ZZD A;  1QCO A;  2SRC A;  3SD4 A;  1SSH A;  4BI3 A;  3CD6 Q;  3QPH A;  1AD5 A;  1KQS A;  1BCM A;  1T0H A;  4M75 B;  2FEI A;  4DBF A;  1NPR A;  3QO3 A;  2JTE A;  4F7U F;  2KSS A;  2QYZ A;  4EMH A;  4E47 A;  2Y4Y A;  5IHK A;  3CCL A;  4QVC A;  3VS7 A;  5DLQ E;  2LJ1 A;  2YXY A;  1D3B A;  4XTX A;  3VS2 A;  4PNO A;  4QQD A;  2YHT A;  2ECZ A;  1TUC A;  1AZG B;  4J9G A;  2CYZ B;  1D1C A;  2AK5 A;  4C5E A;  3V7R A;  2ZPI B;  1WJS A;  3QJ6 A;  4C8Q G;  1I1J A;  1YCY A;  4C92 C;  2VB6 A;  1YJW T;  2PVO B;  3CCR Q;  3RBB B;  2RJC A;  2XHC A;  1YIJ T;  1V76 A;  3HFO A;  1AWJ A;  4B9X A;  2KRO A;  3JCM f;  5LJ5 f;  1YHQ Q;  2PUK B;  2ROL A;  4M7A D;  2QQB A;  5GAN 3;  5FU7 C;  3LX7 A;  3QDF A;  1UHC A;  5CQY A;  5AT1 B;  3G71 A;  2GQV A;  3CME A;  2CDT A;  5HK0 A;  1LPL A;  1QP3 A;  3CCU T;  3UT1 A;  1Q81 R;  2EVR A;  1GRI A;  1RAE B;  2MPX C;  1W70 A;  3X20 B;  3PTA A;  4NS5 A;  5FW9 A;  5GAO m;  4BI4 A;  3H8Z A;  4M7D G;  4OGE A;  3QYH B;  2ZPE B;  2PUO B;  1PG5 B;  4IIO A;  1OOT A;  1TSF A;  1YP5 A;  1ARK A;  3L2Q A;  2V1R A;  1BYM A;  2X4J A;  1YJ9 A;  3EFO B;  2C0I A;  4LN2 A;  2HMA A;  1P92 A;  1SPK A;  3RES A;  4M78 E;  4M77 B;  1S1N A;  4Z02 A;  3OS1 A;  2X9H A;  1X6B A;  1ACM B;  3BDU A;  3R6N A;  1AHJ B;  1BIB A;  1ZBX A;  2JUF A;  2HCK A;  4XTV A;  1OU9 A;  3CCE T;  3OBW A;  5DYI A;  4A4G A;  3GOX A;  4M4Z A;  4M7A A;  1WQ7 A;  2RQT A;  1YJW A;  3P8H A;  1KSW A;  1YIJ A;  3N5B B;  1Q86 R;  3THK A;  2MK5 A;  1Y96 A;  1VQ7 T;  1K9A A;  2QEX Q;  3A8M B;  1ZUU A;  3I5S A;  4ME7 A;  5GAM f;  1UG1 A;  2PTK A;  2MAM A;  1QVG A;  3CCS A;  4HCZ A;  1YFN A;  1VQN A;  3VS6 A;  1AVZ C;  2RI2 A;  2QQA A;  3RUX A;  1NJI R;  1VQ9 Q;  4RUG A;  1QVF A;  2LQN A;  1ZA2 B;  3KXT A;  4M75 F;  2RI5 A;  4ESR A;  1R0B G;  1U06 A;  4C8Q E;  3CCU A;  4DA4 A;  3EFS A;  4F7U E;  2QDL A;  2RJE A;  2VAS A;  4EMK C;  4JJN K;  4RTZ A;  1X2K A;  2PU9 B;  1QVP A;  3H0H A;  3ZEH A;  3S3O A;  2RHY A;  3PFS A;  3WVD B;  3S3M A;  2MCN A;  2LQ8 A;  1QWE A;  1Y0M A;  2D0Q B;  3ZFJ A;  2JTM A;  4XQ3 A;  4C92 G;  4HT9 A;  1C1A A;  2VYT A;  1S72 A;  4BDY A;  1NEB A;  1YI2 T;  1N9R A;  2A28 A;  1N6A A;  4ZNX A;  3ZGZ A;  1ZSZ A;  2PNI A;  5FLX E;  4J5Y A;  2RHZ A;  2DET A;  4MML A;  2E64 A;  1M90 U;  4J9C A;  5EQJ B;  2QQR A; 
#chains in the Genus database with same CATH homology
 4JRK A;  4FM4 B;  4M7D E;  2H3J A;  3P8B B;  2RK2 A;  3DKM A;  3OMC A;  1CZ5 A;  1ZQ1 A;  5FU6 B;  3SWN C;  2HNI A;  4OB0 B;  4OMF B;  3JCM g;  5LJ5 g;  3Q1J A;  3X24 B;  4Y28 E;  4X9D A;  1I81 A;  2B8A A;  4C0Z A;  5C1B A;  4PJO D;  1XNI A;  3LH0 A;  2R57 A;  4VUB A;  3JCM J;  5LJ3 d;  2PWY A;  4AS1 A;  2QTX A;  1YIT T;  3JCM h;  1N9S A;  2DAQ A;  5LJ5 h;  5GAN g;  3MB5 A;  4N4I A;  2Q1C X;  4IUV A;  2Q19 X;  3M55 A;  2VXE A;  3JCM P;  2DXC A;  1KC8 C;  1MHN A;  5CQX A;  5GAN h;  5GMK j;  3I55 A;  1S72 T;  3A8O B;  2CGH A;  5DYG A;  4LDV A;  2Q1A X;  3FLG A;  2JOY A;  4BY6 B;  3JRZ A;  4OP0 A;  1VQ7 A;  4BI8 B;  1CZ4 A;  2LW6 A;  3CEY A;  3CPW S;  3OYK A;  4A54 A;  2RH2 A;  5HKC A;  2XDD A;  2K3Y A;  3CMA A;  2P0P A;  2PVD B;  1QVG S;  1LJO A;  1R8O B;  2QI2 A;  2QQS A;  3I56 T;  3MEW A;  2VXF A;  3OYY A;  3M54 A;  2EFI A;  1DJ7 B;  3SDZ A;  4ELY C;  2KK4 A;  1PSF A;  2O4X A;  3E9G A;  4BE1 A;  1QVF S;  1LNX A;  4J7F A;  3OYI A;  4JS5 A;  2BUD A;  3HRT A;  4M78 F;  3TEE A;  4M77 E;  3VUB A;  2Q1D X;  4KBM B;  3VUZ A;  4E7K A;  3OS2 A;  4GY5 A;  4Y91 A;  2X4X A;  1WPY A;  1VQ4 T;  3M56 A;  2WSF E;  1K9M C;  4QVD A;  4E7I A;  1BKB A;  3QXE B;  4LD6 A;  3EFR A;  3RER A;  3ZJU A;  3OYB A;  1GXI E;  4RCC A;  2K57 A;  1VQM A;  1U8R A;  2FYK A;  2M16 A;  2O4X B;  4FL6 A;  2EAY A;  3OYJ A;  2G3R A;  1KC8 U;  2CZ0 B;  1S3S A;  2OTL T;  4HKE A;  1IRE B;  2AHJ B;  5LJ5 d;  4N4H A;  3JCM d;  3DB3 A;  4EMK A;  3JCM W;  1U1S A;  1Q81 U;  3I55 T;  5CKD A;  2ZPG B;  4XAX B;  3L2W A;  2ZGW A;  2QA4 T;  5FTM A;  1NZ9 A;  3E1S A;  4KUD K;  4KDL A;  3QII A;  5GAN d;  1K8A U;  3V8K A;  1JJ2 A;  1I5L A;  1KQ1 A;  4DQ2 A;  1VQ9 A;  4OB3 B;  4M75 A;  3CMA T;  1FXX A;  4O5V A;  5DLO A;  2EKO A;  2F69 A;  2DIQ A;  1Y71 A;  3A8G B;  4C0F A;  4EPC A;  3CCM A;  2LQK A;  1CR5 A;  3NFC A;  3HPW A;  4ATO A;  4J8O A;  2EWN A;  2GF7 A;  4N4G A;  1OYX A;  4M7A B;  5GAM j;  4XK8 E;  3CXC S;  3NTI A;  5L8R E;  4EMK B;  3L2U A;  2RHI A;  5FRM A;  2EQK A;  1B34 A;  1WJQ A;  3CCV A;  4M7A E;  4M78 D;  4JRP A;  4E7J A;  1WGS A;  3MHX A;  4C5H A;  4KUL A;  1K73 C;  4PJO A;  1FWZ A;  2KDS A;  4J6Y A;  5J26 A;  4JLI A;  1RI0 A;  2K2V A;  3QDR B;  4C8Q F;  5CAI A;  2MM2 A;  3J80 E;  4M77 D;  1Q86 C;  2L3R A;  1M9S A;  4JS4 A;  4XU3 A;  2BKD N;  1OZ2 A;  4ARC A;  2E12 A;  4C92 E;  2K5I A;  5GAN 5;  4BB7 A;  2E70 A;  1G3W A;  2XK0 A;  4X9C A;  4XU2 A;  5KH6 A;  2HAX A;  3NTH A;  4M75 C;  2XI9 A;  3MCA B;  5I2M A;  3JCM c;  3DLL A;  1VQ5 T;  4HCC A;  5GAO r;  2R5A A;  3E9F A;  3QC8 A;  2E6N A;  1UB4 A;  1B34 B;  3JCM Q;  3RKY A;  3X25 B;  2IVW A;  2ZCF B;  3BY7 A;  3QUI A;  3PIP A;  3HU3 A;  5GAM h;  4OGC A;  1NJI C;  5GMK m;  5CK9 A;  1Y7X A;  1YJN T;  1M4Z A;  4B9W A;  4C8Q C;  4M7A G;  3URG A;  3LWH A;  3JCM b;  1Q82 C;  1VQP A;  1UGQ B;  3BDL A;  3M5A A;  2NLU A;  3GPL A;  2JN0 A;  2MF2 A;  3QJY A;  3OYL A;  3OA6 A;  3SWN A;  3RMQ A;  4RG2 A;  1LOJ A;  3PMI A;  1O9S A;  3OSV A;  3KUF A;  3UDC A;  4P5N A;  3CCM T;  2DIG A;  4BE0 A;  4PJO C;  1N8R C;  3ME9 A;  4ZTF A;  3QG1 A;  2QDY B;  3HU1 A;  2V8K A;  1VQO T;  3QQ7 A;  4HCB A;  2E5Q A;  2P0K A;  4PL6 A;  3L2V A;  3FPU A;  3A8H B;  5IN1 A;  3J81 E;  3CXC A;  3G4S T;  2KY9 A;  2ZPF B;  3CCJ T;  4J83 A;  3CCQ A;  1K73 U;  1QP2 A;  3KBG A;  5FTK A;  4IUR A;  2XDP A;  3MP1 A;  2ZPH B;  5CCX A;  2VC8 A;  3M9Q A;  1Q86 U;  5CR2 A;  4DOW A;  3TU4 K;  1UGS B;  5GAN 6;  3FIF A;  4FIB A;  3FDR A;  3MEU A;  4JDS A;  3SWN B;  4R55 A;  1W2B A;  4PLI A;  5C18 A;  3AHU A;  3GNG A;  1BI3 A;  2PJH B;  1WQW A;  2JNG A;  3L1A A;  5GAN 4;  4C8Q D;  3CCL T;  1XQH A;  1G3T A;  1H3Z A;  2DPP B;  1VQ4 A;  4L6V 5;  3GIB A;  2PQW A;  1Q7Y U;  4M7D F;  4OB1 B;  1M1G A;  3OYM A;  1NJI U;  2PVG B;  2A7Y A;  3NTK A;  2C06 A;  3S3N A;  1Q82 U;  4TVR A;  4C92 D;  2CZ6 B;  1U1T A;  3HP9 A;  2MM0 A;  1HK9 A;  3ASK A;  4NL2 A;  5GAM d;  4MZT A;  1VQP T;  2OTL A;  2JV2 A;  3PT9 A;  4L59 A;  3QZ9 B;  3VU3 C;  4CQN A;  1N8R U;  5KE2 A;  2VV5 A;  2E10 A;  2QA4 A;  1EIF A;  2EQU A;  4XTY A;  5DY9 A;  1Q81 C;  1JJ2 S;  2EQM A;  2KAF A;  2FVU A;  4M7D C;  2I2L A;  1QDN A;  3HL8 A;  4IUP A;  3J7A F;  2GFU A;  2WSC E;  1NPP A;  4M78 A;  2DZ9 A;  4N0A C;  5LJ3 e;  1K8A C;  3FJP A;  2DVE A;  4QW2 A;  5GAO l;  4RV0 A;  3CCQ T;  1RL2 A;  3HRS A;  2V8J A;  1UEB A;  4NOY A;  5HK3 A;  4KT0 E;  4LDW A;  4XU1 A;  3UPU A;  1VQ8 T;  3ZBD A;  1BI1 A;  2K3X A;  1X01 A;  4CI0 C;  2DO3 A;  3F70 A;  3CF2 A;  3QWZ A;  3OYH A;  2F5T X;  4J7I A;  1VUB A;  3G7Z A;  4M77 F;  2F5K A;  2A3L A;  2RB6 A;  3MP8 A;  5GMK h;  3G71 T;  3CME T;  4D6W A;  1I4K 1;  2RJF A;  4V2S A;  3M57 A;  2YLC A;  2LX9 A;  4M7D D;  2MI6 A;  4XTW A;  3INZ A;  4XTU A;  2MWP A;  4M78 C;  2RM4 A;  1VQ5 A;  2BIV A;  2DXT A;  4MDW A;  3HU2 A;  3M58 A;  2DD5 A;  4GLK A;  4PLL A;  4ZGE B;  2HQX A;  2DXU A;  1QCS A;  4BUG A;  4M77 C;  5GAN 8;  3PNW C;  3OS0 A;  5KCO A;  3MET A;  1KG1 A;  4A53 A;  1YJN A;  2VGM A;  3QSU A;  1OI1 A;  3CC4 T;  2DJZ A;  2DKG A;  3DLM A;  5J3B A;  3MO8 A;  2Y4X A;  3CBP A;  3L42 A;  4NL3 A;  2YUJ A;  1G3Y A;  5CKE A;  4IUU A;  4QQG A;  3OYF A;  5CCB A;  2X35 A;  1ZHI A;  5LJ5 e;  4J6W A;  3PGG A;  3JCM e;  3HKS A;  2LCC A;  2YRV A;  4R56 A;  1VQ6 T;  2EJF A;  2LRQ A;  3LLR A;  1VQO A;  3SFM A;  4Q5W A;  4FT2 A;  4C8Q A;  1R7R A;  5GAN e;  2ZZD A;  3OB9 A;  3ZJT A;  3G4S A;  3CCJ A;  1SSF A;  3SD4 A;  2E65 A;  2RHU A;  1G3S A;  1XTD A;  2CZ1 B;  3C4S A;  2LVM A;  4QQ6 A;  4BI3 A;  3QPH A;  3RIR A;  5LJ3 f;  3RKW A;  4C0G A;  2DXB A;  5GAN 2;  1KQS A;  1W2B S;  4BAC A;  5FRO A;  4M75 B;  5GAN 7;  2XD0 A;  2EIF A;  4M7A F;  1NPR A;  1M1K U;  2L89 A;  3QO3 A;  4L5G A;  2RJD A;  4X34 A;  4F7U F;  3VYH B;  3A8L B;  5D6W A;  4M75 E;  4BD3 A;  2KSS A;  4EMH A;  5LJ3 j;  4E47 A;  2Y4Y A;  3CC2 A;  3CCL A;  2DTI A;  3QBY A;  1QW1 A;  5GAM g;  4QVC A;  4C8Q B;  2JVV A;  2R58 A;  5FTL A;  3OYN A;  5DLQ E;  3OYG A;  4C92 F;  5C6S A;  3G6E T;  3FEO A;  1Q7Y C;  1D3B A;  4XTX A;  4XU0 A;  4PNO A;  2D9T A;  3OW2 A;  3JB9 G;  4E7L A;  4QQD A;  4BE2 A;  4M75 G;  1N27 A;  4PJO B;  2YHT A;  4MMK A;  4JUV A;  2CYZ B;  2P0Q A;  5C0M A;  5CKH A;  3FPR A;  4OVA A;  4WF2 A;  3HHT B;  4C5E A;  5CVI A;  3V7R A;  3O8V A;  5GAO p;  2ZPI B;  3E19 A;  5CO7 A;  1WJS A;  4PJO E;  2CKK A;  3QHS A;  3QJ6 A;  4KO8 A;  3JB9 I;  4C8Q G;  3CD6 T;  5GAO q;  1YCY A;  2DZC A;  4C92 C;  3FB9 A;  1YJW T;  4JLG A;  3OBY A;  2PVO B;  4FSX A;  3JSC A;  1NE8 A;  1D3B B;  3CBM A;  2RJC A;  2XHC A;  1YIJ T;  1YHQ A;  4PJO G;  3LHD A;  5CD1 A;  4HT8 A;  3HFO A;  4C0D C;  2O01 E;  5I2S A;  1UGR B;  3RKX A;  4B9X A;  3CPF A;  4IKF A;  5FRN A;  1VQ8 A;  5M9O A;  4M7D A;  1JB0 E;  4HA8 A;  5J39 A;  3V7S A;  4ZN1 A;  3JCM f;  4N0A A;  4A4F A;  4CRI A;  5LJ5 f;  2PUK B;  4O6J A;  4M7A D;  3CC2 T;  3LGA A;  2L5Q A;  2QQB A;  4FT4 A;  5GAN 3;  5FU7 C;  2LCL A;  3LX7 A;  3V8J A;  3VYG A;  5GAN f;  2YVL A;  5CQY A;  1BIA A;  4MZP A;  3G71 A;  2GQV A;  4IUQ A;  4C5I A;  3CME A;  5LJ5 j;  3GLX A;  3CC7 A;  2B25 A;  2ZPB B;  1V29 B;  5HK0 A;  2VUB A;  1QP3 A;  3CCU T;  3UT1 A;  4A4H A;  1JRI A;  5GAN j;  3M4Y A;  4M7D B;  4ZTJ A;  2XID A;  3OS5 A;  2GCX A;  4LD9 K;  3OQ5 A;  3BQB A;  3CCR T;  5A0L A;  4RCB A;  4LDX A;  1H64 1;  2E6Z A;  4XTZ A;  1X6O A;  2JZ2 A;  2RO0 A;  5EG2 A;  3QZ5 B;  3FC3 A;  5LL6 S;  3CC4 A;  1KHC A;  1VIF A;  2P4T A;  1PSE A;  3WXM B;  3X20 B;  5A0D A;  3PTA A;  4RMO A;  2K5F A;  3WVE B;  3MEV A;  2DTO A;  2RHX A;  4NS5 A;  5GAO m;  4BI4 A;  3H8Z A;  3X26 B;  1Y07 A;  2XDB A;  1VQL T;  3R6O A;  3CCE A;  1YHQ T;  2MMP A;  1VQK T;  1M1F A;  5GAM e;  4MDX A;  4M7D G;  5FU6 C;  1KD1 C;  4M77 A;  4OGE A;  3BFM A;  1VQ6 A;  2E64 A;  2JTF A;  3QYH B;  2E1H A;  3TRE A;  2LNV A;  2M0O A;  2KVQ G;  2ZPE B;  2PUO B;  2GFA A;  1M8V A;  2RD1 A;  2IG0 A;  1KQS S;  4FU6 A;  2OTJ T;  4J6X A;  2FL7 A;  2RA2 A;  3L2Q A;  1WJR A;  4M78 B;  3GF5 A;  4QVZ A;  1BYM A;  3LW5 E;  5GLF A;  1KHI A;  2X4J A;  1YJ9 A;  3CC7 T;  3VKI A;  2CZ7 B;  1ZC1 A;  1M5Q 1;  3SB2 A;  3RES A;  1P92 A;  1O75 A;  1E32 A;  5D6X A;  3FPT A;  2EQJ A;  4M78 E;  3M59 A;  4BY6 C;  3TCJ A;  4BDZ A;  4M77 B;  1WNL A;  3VJP A;  1M1K C;  2D6F A;  3ER0 A;  3QQ8 A;  3QKJ A;  4Z02 A;  3OS1 A;  5D6Y A;  5CCA A;  2LT4 A;  3QYG B;  1HXD A;  2FHD A;  2EYQ A;  3OMG A;  3VV0 A;  2VGN A;  2DEQ A;  3BDU A;  2LDM A;  3L2R A;  3G6E A;  2X4Y A;  2HBP A;  2HD0 A;  3OW2 S;  4OF1 A;  1O54 A;  2X4W A;  1BIB A;  1AHJ B;  4M78 G;  1ZBX A;  2JUF A;  3M53 A;  4YTL A;  1JBM A;  4XTV A;  1FX7 A;  5B6C A;  1MGQ A;  3LYI A;  2K4Y A;  1KD1 U;  3CCE T;  3OBW A;  3LWI A;  4M77 G;  2WSE E;  3HRU A;  3ZJV A;  5I21 A;  2DTH A;  3P8D A;  5IT9 E;  5DYI A;  3JCM X;  5FTJ A;  1TH7 A;  4IUT A;  3A5Z B;  4A4G A;  3CD6 A;  3GOX A;  2QEX A;  5IAY A;  4M7A A;  1WQ7 A;  1YJW A;  3P8H A;  4PKC C;  3OYA A;  2CS7 A;  2KQW A;  4F7U A;  5KE3 A;  1WLF A;  1YIJ A;  3N5B B;  4AQ7 A;  1BI2 A;  4ZGJ B;  1Y96 A;  3JAM E;  1VQ7 T;  2V8I A;  3PMT A;  2DK3 A;  3A8M B;  4C92 A;  1YJ9 T;  4ME7 A;  5GAM f;  3CPW A;  1M90 U;  2MAM A;  3EAE A;  2MWO A;  3JCM V;  1QVG A;  3CCS A;  4HCZ A;  2YLB A;  3MEA A;  3GNF B;  4RKU E;  5FTN A;  4LDU A;  3X28 B;  2XIC A;  1YI2 A;  2RI2 A;  1VQN A;  2QQA A;  3RUX A;  1QVF A;  4RG8 A;  3KXT A;  3JB9 F;  2WAC A;  1UGP B;  2QQ9 A;  3HFN A;  2RI5 A;  4M75 F;  4C5G A;  4F7U B;  4KLN A;  1YBY A;  3DB4 A;  3BW1 A;  4JRI A;  4C8Q E;  2R5M A;  3CCU A;  1Y96 B;  5GAO n;  4DA4 A;  3EFS A;  3RMS A;  2E41 A;  5GMK e;  1K9M U;  4M7A C;  3C95 A;  4F7U E;  5CIU A;  1W4S A;  2RJE A;  4EMK C;  2Q18 X;  4C92 B;  4JJN K;  1G5V A;  2PU9 B;  1M90 C;  5AYF A;  3CCR A;  3HSB A;  4E7H A;  3M4G A;  3LGF A;  1VQM T;  3T9N A;  5CKF A;  3V7C A;  2HQE A;  5LJ3 g;  2QXF A;  4ARI A;  1QVP A;  4A4K A;  3PIO A;  3ZEH A;  4DOV A;  2EJG A;  5HY6 A;  2QEX T;  4UC4 A;  3S3O A;  1OZ3 A;  2RHY A;  4PJO F;  4KUI A;  3PFS A;  2RK1 A;  4C0D B;  4F7U G;  2KMT A;  4MZM A;  3WVD B;  3S3M A;  2LQ8 A;  3OYE A;  3CBO A;  3OSS C;  5LJ3 h;  1VQL A;  1VQK A;  4A4E A;  5KCH A;  3S6W A;  4JRQ A;  4KOD A;  3UWN A;  2D0Q B;  2LC4 A;  2JTM A;  3ZFJ A;  2LTO A;  1IZ6 A;  4XQ3 A;  4C92 G;  1YIT A;  4HT9 A;  3V8L A;  5EPP A;  3H6Z A;  5FU7 B;  3TIW A;  1I8F A;  2XG8 D;  5GMK l;  1VQ9 T;  1I9G A;  2M9U A;  1BI0 A;  3OYD A;  4II1 A;  2RI3 A;  3OY9 A;  2VYT A;  3GP8 A;  2DD4 A;  5ERG B;  4LDY A;  3CCS T;  2OAU A;  3LGL A;  3MP6 A;  4BDY A;  1S72 A;  2M1H A;  4EDU A;  2OTJ A;  2LT1 A;  1N9R A;  4ZGD B;  1YI2 T;  3FRN A;  4OB2 B;  4EMG A;  1N6A A;  1VQN T;  3ZGZ A;  1VIE A;  2FB7 A;  5FLX E;  4J5Y A;  3OYC A;  3JB9 J;  3C12 A;  3L2Z A;  5DM7 R;  3JB9 H;  2RHZ A;  2K5L A;  1XOV A;  3CCV T;  5CKB A;  2Y90 A;  3JB9 D;  1KQ2 A;  3I56 A;  2XKO C;  3C94 A;  1X75 C;  4M75 D;  4MML A;  4ELZ C;  2XU8 A;  5A0G A;  4ZN3 A;  2EJ9 A;  5A2Q E;  2L8D A;  5GMK i;  4KDI A;  5EQJ B;  2QQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...