4FIBA

Crystal structure of the ydhk protein from bacillus subtilis. northeast structural genomics consortium target sr518a.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
b'MKVGSQVIINTSHMKGMKGAEATVTGAYDTTAYVVSYTPTNGGQRVDHHKWVIQEEIKDAGDKTLQPGDQVILEASHMKGMKGATAEIDSAEKTTVYMVDYTSTTSGEKVKNHKWVTEDELLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized protein ydhK
publication title Crystal structure of the ydhK protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Structural genomics, unknown function
total genus 23
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07563 DUF1541 Protein of unknown function (DUF1541)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1130 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fibA01
3.10.330.60 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4fibA02
4FIBA 2KY9A
chains in the Genus database with same CATH superfamily
2KRSA 3GIBA 2L8DA 2QXFA 4A53A 1Q86C 1ZSZB 1B34A 2DMOA 1AWOA 4JDSA 1CSKA 1FMKA 3G6EA 2KE9A 1RADB 5J26A 1VQ7A 2VGMA 2EQUA 1AZGB 1VQ4T 3H0IA 3URGA 1VQ6Q 2EYYA 3QC8A 2F2VA 5DYIA 4EMGA 4M4ZA 4KRTA 1VQLT 2CUBA 3CCRT 3TSWA 5GAOq 2RJCA 4M7DF 1R0BG 3LH5A 3L2QA 1OPLA 1Q86R 2HSEB 3LGFA 2FEIA 1OU8A 2COYA 4X9CA 4OMPA 1PRLC 2CH4A 5DY9A 2CP2A 2RHYA 4F04B 2LRQA 2QASA 5A0GA 3OYYA 1TSFA 3A8GB 3CCQQ 2KI7A 3HU1A 4A4FA 4LNPA 4C92F 3EH2A 1WLPB 1KC8U 4C0GA 4LDWA 1GBQA 3FB9A 2HL5C 3OSSC 3L1AA 2DJQA 4C92G 3G4SA 2EKOA 2PJHB 3ZL7C 3G7ZA 4HCZA 2ECZA 4HCBA 3HRTA 1OQKA 1QCNA 1VQ6T 3HRUA 2NWMA 3G71T 1VIFA 4M7AA 2W0ZA 2MIOA 4M77A 2EKHA 4O6JA 5HCKA 3H8ZA 4IURA 2L0AA 1EIFA 4Q5WA 8ATCB 5FU6C 1WZOA 2LQ8A 2LJ0A 4MDXA 2RI5A 1OEBA 2CZ6B 2FPDA 1BK2A 1VQKQ 2GGRA 5KYUB 1M2VA 3HU2A 1GFDA 3L2ZA 2GNCA 1NPPA 3EG0A 4C8QA 3RDVA 2CS7A 2FZKB 5GMKl 2LT1A 1KIKA 2PWYA 2QGGA 1M5Q1 2LZ6B 2K7AA 3CCEQ 2RHZA 3UA7A 1K76A 3CCVQ 2LDMA 3RUXA 2JW4A 1ZBXA 4DBFA 1YJWQ 3TIWA 1U1TA 3I56Q 3OW2S 1Q7YU 1BB9A 2ZZDA 5IH2A 1YCSB 2KGTA 2C0OA 2XHCA 2E6ZA 3M56A 1JJ2S 2D9TA 3CCLA 5GANe 4MZPA 2BE9B 4RMOA 3SWNA 2K4YA 2KT8A 2EGEA 4JS5A 5GMKi 4QQGA 2K5LA 2DERA 2KRNA 3QWYA 3OBYA 1SEMA 1PHTA 2DRKA 1RAIB 3PNWC 4VUBA 2KXCA 3QSUA 1NEGA 2DIQA 2LQKA 3C0CA 5GAN2 1JEGA 1ZUYA 2EYZA 3PIPA 3EG2A 5AYFA 1K73U 2JM9A 1D3BA 2RI2A 3E9FA 4K11A 5C18A 3Q1JA 5FWCA 3A8OB 1IZ6A 1Q95G 4BE2A 4PK4A 3BY7A 3I55A 3OYGA 1D1BA 2HKQB 2DO3A 2ATCB 1G3YA 4QKUA 3GOXA 1OZ2A 3CMET 1Q82C 3MKDA 1N5ZA 4MZMA 3G6EQ 5FU7C 2EJFA 3CCET 3FPRA 5KYYA 2CGHA 3A8LB 1YJWT 5FROA 2D1XA 1R0CB 1QCOA 1XOVA 1OZ3A 1BBZA 2RMOA 1IXDA 1B7TA 3JCMV 1U8RA 1QVFA 4M7AD 4PFZA 2AT1B 2R5MA 4M77D 1Q82R 4M7DA 3CCJT 1RABB 1PC0A 2Y90A 1BIBA 4XU1A 2Z0WA 3F70A 3OA6A 2A08A 5KYWB 4RCCA 2KYMA 3MB5A 1M27C 1R8OB 4V2SA 5CKFA 2PZ1A 4RCBA 2JTMA 2AKLA 2YVLA 4JUVA 2PU9B 3M5AA 4L5GA 2B8AA 4FSXA 4C92A 3I35A 1WHLA 1TUDA 4PJOG 3WVEB 1H8KA 5CCBA 3G4SQ 2RD1A 2XKOC 4BD3A 1QKWA 2O88A 3EG9A 4E7HA 4ARIA 1Q86U 1TH7A 1VQ5A 1IREB 2DPPB 2PNIA 4XK8E 3PVQA 5GANg 3M0TA 3SEMA 1QVGA 2LCSA 3DB4A 1H92A 3JCMP 4AG1C 3VS3A 2LC4A 4M75D 3FPUA 5FU6B 4EMHA 5I11A 1H3HA 4J83A 2QEXT 2X9HA 5J3BA 2FVUA 2QA4T 2E1HA 1JB0E 3J81E 1IB8A 5L23A 3P8DA 4AQ7A 2EVRA 1I4K1 2ZPEB 4ELZC 5FTNA 2B86A 1ZUKA 2KK4A 2CP0A 2F1LA 2VV5A 4GY5A 5CVIA 2RNAA 2XIDA 3QQ8A 3CD6A 4ESRA 4JRPA 3MP1A 1O54A 1T3LA 2QDYB 1EX4A 3G4ST 2NUTB 2MM0A 1VYTA 4BACA 4CQNA 2EWNA 3CCLQ 4OB0B 2DD4A 4A4HA 3QQ7A 2ZGWA 3CPWA 1OV3A 3NTKA 1AWJA 3BFMA 4C0ZA 3HPWA 1YHQA 1FMVA 3T9NA 3VS1A 2D0NA 1CKBA 1V1CA 4ZGDB 1ABOA 3OS5A 1M9SA 5M9OA 1AVZC 1YWOA 4J7FA 1ZQ1A 2MPXC 2RQRA 4IIMA 1VQNA 4OVAA 4XTWA 3OS1A 3FC3A 3LHDA 1VQ4A 3I55Q 4JLIA 4RUGA 2SEMA 1OI1A 3JCMQ 1VQLA 6AT1B 2XICA 1LOJA 3SB2A 3CCRA 1RI0A 1RAEB 3A8HB 2MWPA 5FU7B 2KR3A 2A28A 3SDZA 4C92D 3QUIA 3MHXA 4M78F 1GCQA 2HKNA 1I1JA 1NM7A 1YBYA 2M51A 5GMKj 3S3MA 4J8OA 1KHCA 5IXBA 4LN2A 1X2KA 3QO3A 4M78G 5IHNA 1B07A 3M0UA 2MOXA 3M55A 5GANd 4TVRA 2LP5A 2GCXA 3R6OA 1F1BB 2F2XA 2CZ7B 4JPBW 2YWWA 4PJOC 1PRMC 3I9QA 1ZLMA 4BDZA 1M1GA 1PSFA 2AK5A 3H9NA 4ZTJA 2X4WA 5I21A 1WX6A 2YXYA 4ZN3A 4BUGA 3U23A 2L89A 5GAN8 1KC8R 5GMKh 3QYGB 2KT1A 1U3OA 4FW1A 3I55T 3J80E 3S3NA 5C1BA 1X01A 1AT1B 2M0YA 4EMKA 3G71A 2QQSA 4II1A 3GP8A 1IHWA 1FXXA 4FT4A 1YP5A 1VQPA 3JAME 5FRMA 1SHFA 1VIEA 2DEUA 4AFUC 3ZJVA 5CCAA 1MMGA 3OYEA 3PGGA 2XI9A 3D7SB 1VQ5Q 1Q82U 4EIKA 2QK0A 2VXEA 3MEUA 1IO6A 2JN0A 4BE0A 1UGVA 2I2LA 1E7OA 3OYMA 4FYXB 4RTZA 2RQWA 2K57A 4R55A 3L2UA 2WACA 1ARKA 3M57A 2NLUA 4CC7A 1R77A 1FMWA 1UEBA 4J9FA 4N4IA 1G83A 3PVLA 3UATA 2A37A 1FYNA 2AZSA 4IUTA 1PD0A 4F7UB 1WYXA 1SHGA 5CKEA 1KQSS 2XG8D 3CCMQ 4A4KA 4QVDA 3OQ5A 3TEEA 5GMKm 4DOWA 1IGUA 3CBMA 1QKXA 4PJMA 4QVZA 4Y28E 4PJNA 2D8JA 4FU6A 3BE3A 1NBEB 3CCST 1RLQC 2O4XA 3LGLA 1V76A 4D8KA 2H8HA 3GNGA 1VOMA 1VQ5T 1KD1U 2FHDA 3LLRA 3VUZA 4OMOA 2IG0A 1YJ9A 2ZPHB 3RKXA 2ZPGB 1N9SA 3REAB 1YHQQ 1T3SA 4A54A 2JM8A 2MAMA 4KBMB 1UG1A 3CMEA 4EPCA 1PNJA 4C8QG 1D09B 3JSCA 2IIMA 1XQHA 2VGNA 1VQNQ 2ED1A 3CXCS 2COWA 2LTOA 1LNXA 2OX7A 1YJWA 3QDRB 1S72A 1QCSA 4KDIA 4PNOA 2LNVA 4OMFB 3CCRQ 1TWBA 1OU9A 3OMCA 3OW2A 4PJOD 3CCMT 1TOVA 1LVKA 2Q1CX 3HU3A 4M78A 3CCJA 1N6AA 4QW2A 5EQJB 4JS4A 1XJWB 1E32A 1IGQA 1XNIA 3MPUB 3QG1A 2NUPB 5EPPA 1UDLA 3IQLA 1Y96B 3FDRA 1X6BA 4MMLA 1QP3A 2OI3A 1NYFA 2DLPA 1YI2Q 4PJOB 2HAXA 2A7YA 1YHQT 3OYFA 4CI0C 4J5YA 1JRIA 1RL2A 1YFNA 2KSSA 3OSVA 2L3SA 3JCMJ 1HYOA 1SSFA 3CCUA 2HQXA 3RMQA 2M1HA 4DBRA 3NPFA 4RG8A 2V8IA 1K0XA 1ZC1A 1VQNT 2EGAA 4X34A 4ZTFA 5AT1B 3G71Q 4PL6A 2K3XA 4AMCA 3A8MB 3M59A 3SD4A 5CKDA 1VQPQ 4LUDA 4FM4B 1UGRB 2LVMA 4QQDA 2CSIA 2QEXA 4M77E 3FPTA 2C0TA 3KXTA 4M7DG 2HZYA 2XU8A 1WDXA 2JTEA 4KULA 1TG0A 2V1RA 1JQQA 1G8XA 2QA4A 3GBQA 1RUWA 4DA4A 2OAWA 3QWZA 3VS7A 1D0XA 1VYUA 1W2BA 4N0AA 3VU3C 1X75C 2GFAA 2VUBA 3OW2P 4RTWA 1YI2T 5IAYA 2FZGB 5GAMj 4E7JA 3GPLA 3C4SA 5CD1A 4M7AC 1RACB 3NMZC 1JJ2P 4M77C 1OX8A 4FW2A 2DBMA 3DLMA 2RI3A 2LNHB 3PIOA 1UJ0A 1UGSB 3EGXB 4C5GA 2DZ9A 4F14A 2D6FA 4KH0B 1KHIA 2EAYA 5FRNA 1GBRA 2OTJA 1VYVA 1VQ8Q 1W4SA 3CBOA 4E7SA 1D0ZA 2V26A 2BUDA 1VQPT 1MV3A 1YN8A 2ZPIB 1QP2A 2BKDN 2KQWA 4C8QC 2CP5A 4M75E 2Q1DX 4M78D 5GAMh 4GLKA 2XDDA 1PWTA 5GAN5 3TREA 2GFUA 1ABQA 1YJ9Q 1NJIC 1BIAA 4FYVB 4NOYA 1UHCA 2O2OA 1GCPA 3SWNC 3H0FA 1GXIE 3CMEQ 1YITT 1YIJA 2JV2A 4HA8A 3RR6A 2NYSA 4M75C 4PLIA 5KE2A 4XTXA 2VVKA 1UTIA 4KUIA 2DTHA 5FTKA 3OYAA 2GQIA 1S72Q 2CREA 2VWFA 1NJIR 1MNDA 1WFWA 2E65A 1W2BP 3BDUA 1VQ8T 2RQTA 2FL7A 5GAN6 1VQOT 4OB3B 2R57A 1B34B 3CCJQ 2J05A 3DB3A 5LJ5j 4OB2B 3V8LA 2RK1A 4OMNA 1KJWA 4XTVA 1BYMA 2ZAEA 2HBWA 3CC4T 1Z9QA 2JJ9A 2X35A 1GFCA 1NE8A 2ABLA 2GTOA 1YJ9T 2DL5A 2SRCA 1LJOA 4E7ZA 4N4HA 5KCOA 4RTXA 2BE7D 3UT1A 4J6WA 1WPYA 4C0DC 3CCUQ 3EHQA 3QKJA 2NUTA 4M7DC 3X20B 1WJQA 2AKKA 4QVCA 4C92E 4LE9A 1SPKA 3QIIA 4FCYA 3CQTA 2BZ8A 5I2MA 1M8VA 2E5QA 2EBPA 1S72T 3VRZA 3A98A 5LJ5h 2LW6A 4OMMA 2I0NA 3MEVA 1WXUA 4KGXB 1WGSA 2RK2A 5DYGA 2L3RA 2RF0A 1YWPA 4JRQA 2QEXQ 3OBWA 2FPEA 2RM4A 1HK9A 4WTOB 4MMKA 4C92C 4XU3A 1PD1A 1SRLA 2QA4Q 2K3YA 4AG2C 4J6XA 2L2PA 2Q1AX 2QDLA 4BI4A 3VYHB 2EW3A 1QCFA 3OYLA 1SG5A 2KXDA 2EQMA 4M7AB 4C0FA 4CC3A 4M77B 2D0QB 1PSEA 4IIOA 3HKSA 4C8QD 2MF2A 1U06A 3LGAA 4E7LA 1KD1C 3CCUT 2V8KA 4RKUE 1M1KC 3LWHA 2K9GA 5C0MA 2KEAA 3VS2A 4J9IA 3M0QA 2K2VA 3CCSA 1WIEA 3LH0A 4J9HA 2E64A 3EG3A 2WSFE 1KK7A 1SRMA 1JXOA 1BU1A 3EH1A 4JRIA 1M90C 1M2VB 2OTJQ 1AWWA 4DBQA 3CEYA 2R5AA 4XQ3A 4C8QB 3NFCA 4XU0A 4F7UE 2K5FA 1KD1R 5IHKA 1UJYA 1M1KR 4WCIA 2VC8A 3QDFA 1KQ1A 3G1JA 2YRCA 5GAOl 2E12A 2V8JA 1BI2A 4E7KA 1UUEA 4YTLA 3VRYA 1U1SA 1M90R 1RAHB 3FJPA 5CAIA 2FYKA 5FTMA 1MMAA 3CMAT 2PVGB 1TXQA 3QBYA 3SWNB 4JJBA 2FG0A 2LX9A 5FWBA 1KQ2A 1YIJQ 4M75B 3CCMA 3PTAA 2BIVA 4ARCA 3O8VA 4KT0E 2RQVA 3X25B 3OYHA 2DILA 1WXBA 4QT7A 2JZ2A 4FSSA 3RKWA 1D3BB 3A5ZB 2KNBB 3FRNA 4IKFA 2IVWA 2OTLT 3HSBA 4OGEA 2OTJT 1TTHB 4E47A 3BW1A 5DM7R 2JS2A 4Z8AA 1WHHA 1WHMA 2DTIA 4M7DD 4RV0A 4C5HA 3VS0A 3THKA 4ORZA 2H3JA 4RTUA 1VUBA 5J39A 2XK0A 5GAN3 5KYYB 4LDXA 5ERGB 2HSPA 2LQNA 1GCQC 4N4GA 2DF6A 2PUOB 2RB6A 4ZGEB 5B6CA 2BTTA 1H3ZA 2J6FA 1KFZA 2DTOA 1I81A 4OP0A 4NS5A 2DX1A 3CXCA 4C0DB 3AT1B 1QWEA 1YIJT 3OYIA 4JZ4A 4M7DB 4J9CA 1X6OA 1NJIU 4FYYB 2YT6A 1I07A 4PJOE 3JCMf 2YSQA 2A3LA 2HNIA 5D7UA 4B6MA 3UF4A 2DL3A 4A4EA 1PKSA 2RJDA 3QJ6A 4HKEA 4OMLA 1MV0B 2OAUA 2DYBA 1W70A 1M3BA 1I5OB 3SFMA 1YI2A 4HT9A 4PFOA 3FJ5A 1T0HA 1Y07A 4EMKC 3MP8A 5LJ3f 4C92B 5FTJA 4BY6C 4PJJA 4JRKA 4AT1B 1QVFS 1KQSP 4ZNXA 3L42A 4Y92A 3VJPA 2EPDA 5D6YA 1QVPA 3EGDA 3C12A 3QWXX 2KRMA 3BQBA 2LCCA 1NYGA 2QYZA 7AT1B 5HK3A 1A0NB 3EFOB 5EC7A 1CR5A 4A4GA 4RTTA 4DBHA 2YLCA 4BDYA 4ZN1A 2O01E 3KBGA 1G3SA 3M0RA 1RAFB 5KYXA 3CCSQ 3X26B 2P4RA 4ATOA 2DBKA 2NUPA 2J06A 3QHSA 3M58A 3A1PA 2DIGA 4LDUA 2D8HA 3DLLA 3CXCP 2O31A 2KDSA 1CKAA 1ZSZA 5GAMf 1B3QA 1E6GA 1YITA 1QVGS 1U5SA 4ELYC 2CSQA 4J9DA 1H641 2ROLA 3CF2A 3ER0A 1M1FA 2V1QA 5A2QE 4E7IA 1ACMB 1Z9ZA 1M8MA 2K2MA 2YDLA 3VS4A 1D0YA 4A63B 3QJYA 4J9GA 1VQ8A 5C6SA 1VQOA 1D1CA 2E5KA 3ZFJA 2WSCE 2EGCA 3OYJA 5GAMd 2JVVA 4Z88A 4M78E 2C06A 4R0KA 3JCMb 1M1KU 2EIFA 3CC4A 4XTZA 1XTDA 5FW9A 3VS6A 2KVQG 1WXTA 1PCXA 2CP6A 3UA6A 5EG2A 1M90U 4LD9K 2QI2A 3TQ7P 1N9RA 4FYWB 3CPWS 1X69A 1FX7A 1G3WA 4KUDK 1YNZA 3QPHA 2J7IA 4M78C 1M3CA 1ZBJA 2YUOA 3OS2A 2CKKA 3I5RA 4KH1B 1WHGA 2KYBA 2DXCA 2QQRA 4CC4B 2X4XA 3TCJA 3I5SA 3MO8A 3LX7A 2M0OA 1JBMA 5CIUA 3RERA 1GL5A 1BKBA 1WI7A 5GAN4 2B25A 1JJ2A 4NL3A 2EYWA 1WHKA 4J9EA 1K8AU 4MZTA 3J7AF 4GLMA 5LJ5f 3VUBA 5KCHA 1M3AA 4IUUA 5KYUA 5GMKe 2G6FX 5DLOA 2P0PA 1J3TA 3GF5A 1AHJB 1SSHA 3V8KA 2F2WA 1V29B 4EMKB 1LCKA 3ASKA 2K5IA 3RBBB 4BY6B 4BI3A 2P84A 1IRXA 2HL3A 5LJ3j 3META 4J9BA 9ATCB 1HJDA 2ENMA 2YUPA 3M9QA 1X27A 2QAZA 3JCMh 1K9MU 4FT2A 5D6WA 5LJ5d 1QW1A 2C0IA 3H6ZA 2QTXA 1UB4A 2RO0A 4N0AC 3MP6A 1EFNA 4M7AE 2HMAA 5GJWB 3RESA 2KBTA 2CDTA 2JXBA 2M02A 1N8RU 5LJ3h 1NZ9A 2P0KA 3MEAA 1IHVA 1DJ7B 2QGFB 2IPOB 2JS0A 3X28B 2DZCA 4HVWA 4XTUA 2LJ3A 3CMAA 5IN1A 2AIRB 4Y91A 4C5IA 3E19A 3VV0A 1YITQ 1YJNQ 3REBB 2L3QA 4BI8B 4C8QE 5CKBA 5GAOm 5D6XA 3CC2T 2DA9A 2ZPFB 2O4XB 3TU4K 4KO8A 2KROA 4LUEA 1X2QA 3PT9A 1VQ9T 3ZJTA 2RN8A 2OTLA 5I2SA 4L59A 2XD0A 3PMTA 3CC7A 5FTLA 4IUQA 3UPUA 1VQOQ 2KY9A 1EZZB 3QZ5B 2DL7A 1I5LA 1Q81C 4DOVA 1JXMA 1PG5B 3GLXA 3NHNA 2VYTA 1OYXA 5KYWA 1K9AA 2P0QA 2E3HA 2W10A 3CC4Q 4X9DA 2HDAA 4L6V5 4BB7A 2BZXA 1BI1A 3HFOA 5GAN7 3TSZA 3OS0A 2VB6A 2EJ9A 3HP9A 1AEYA 1CZ5A 1WJRA 3JB9F 1JO8A 5KE3A 2CZ1B 2EQKA 1YJNT 1SF9A 2DK3A 1Q81R 2DL8A 3C95A 3JB9J 3JB9G 4M78B 2ESWA 2HBPA 2P4TA 4HVUA 2BZYA 2Y4XA 2G3RA 2E3IA 2EYQA 2JT4A 4AS1A 2H3EB 2JNGA 4D8DA 3CCQT 4KODA 1JU5C 4P5NA 5CK9A 2CT4A 1G2BA 3ME9A 1ZA2B 3FEOA 1O9SA 1OOTA 4RTVA 3EFSA 3P8BB 2FPFA 2VKNA 3ZJUA 3HRSA 2F5TX 4HCKA 2J6KA 1NLPC 4M7DE 3JCMe 4E6RA 3RNJA 3OYDA 4F7UF 1NLOC 1X6GA 3NGPA 2E41A 2RA2A 4OB1B 3FIFA 4M75A 2JMAA 4F7UG 1Y7XA 5IHIA 2LQWA 3V7RA 1BI3A 2ED0A 1VA7A 3LWIA 5LJ3e 2K79A 2FZCB 2GQVA 2LCLA 2M16A 3UDCA 4FL6A 1VQKT 2EQJA 1AWXA 1MHNA 3O5ZA 1I0CA 1OULA 3L2WA 4F17A 3JCMX 2LT4A 3L2VA 1NG2A 4JJCA 3JCMc 2HQEA 2FRWA 2RH2A 2XMFA 2LX7A 3PMIA 2RJFA 1UE9A 3CCVT 2AHJB 1VQ7Q 4J6YA 3I56T 3M54A 4ZGJB 3M0SA 1NPRA 4XU2A 1N27A 2COZA 3V7SA 1G5VA 5CQXA 3VS5A 2DETA 4KLNA 4JJNK 1AZEA 2DXBA 3CMAQ 3HL8A 4HVVA 4AFZC 2EJGA 2HCKA 2VXFA 1PM3A 3M53A 5A0DA 1I9GA 2A0FB 2MCNA 4LD6A 1AD5A 4LXCA 2JOYA 2DEQA 5GAMe 4MDWA 1W2BS 2RHXA 2CUDA 1WQ7A 1MGQA 5HKCA 3JRZA 1K0SA 2QG9B 1E6HA 2MWOA 2OTLQ 4PJOF 4XAXB 2X3XD 2Y4YA 3CC7Q 2QQ9A 2O9VA 3H0HA 4D6WA 1RLPC 2YUQA 1LPLA 4PLLA 3G6ET 1ZA1B 4B9WA 4BE1A 2ZPBB 1VQ7T 3WXMB 2J6OA 2MYSA 3JCMg 4F16A 1OX9A 3RMSA 5A0LA 1OPKA 1ZHIA 5CR2A 3JV3A 4EDUA 1M30A 4C5EA 2QQAA 1S3SA 4AFSC 3OYNA 3OYCA 3EFOA 5CKHA 1SKUB 2QQBA 2CP3A 2E6NA 3E2UA 3N5BB 1UFFA 2O9SA 1TUCA 2RQUA 1K8AC 1R7RA 2HQHA 2E4HA 2EQIA 1HD3A 3EAEA 1KG1A 2CT3A 3FLGA 1QWFA 2KMTA 1MNEA 5LJ3g 4UC4A 1KQSA 3CPFA 8AT1B 5GAOr 1K4US 1WJSA 4NL2A 2PUKB 4DEXA 1RAGB 1HXDA 3ZGZA 1VQMA 1QVFP 1WHJA 1K1ZA 4OGCA 5GAOp 1QLYA 1MMDA 1K8AR 3CC7T 3VKIA 2MK5A 3ZEHA 3PE0A 1D1AA 2DYIA 3GNFB 4WF2A 1K9MC 2DNUA 2A36A 4HCCA 1BCMA 1M4ZA 2DD5A 4RG2A 3HTRA 3NTHA 1BI0A 2PQWA 5DLQE 5LJ5e 2VASA 4F7UA 3DKMA 5KYNA 1Q81U 3INZA 2YLBA 3V7CA 2DVEA 1G3TA 3OYBA 4XTYA 1N8RC 5LL6S 3E9GA 1K9MR 3M4GA 5L8RE 3NTIA 4OMQA 2HEQA 5GAMg 1MMNA 1WA7A 2PTKA 1Y71A 1P92A 3RKYA 3ZBDA 5GANf 3E1SA 2DFUA 3C94A 1QVGP 3R6NA 4E2FB 2GF7A 5IT9E 1PKTA 1WNLA 2F5KA 4HT8A 1C0MA 2Q18X 3AHUA 2YUJA 2MMPA 1N8RR 3RIRA 3EFRA 1BCOA 3V8JA 5CCXA 3BDLA 2YHTA 5FLXE 2RJEA 3VYGA 2JMCA 3S6WA 3CC2A 3OB9A 3JCMd 2EYXA 1TU0B 3M4YA 3EG9B 1RI9A 3CCLT 1KC8C 2MI6A 1VQ9A 1UGQB 3CBPA 2NUZA 3EG1A 1Y57A 4IUVA 1O75A 2ROTA 1ZUUA 1QQJA 2LMJA 2CH4W 3JB9D 1KSWA 5CO7A 4RTYA 1UHFA 1ZSZC 1W1FA 2DL4A 4OF1A 5LJ3d 1T0JA 1I8FA 2YUNA 4KGVB 2JTFA 3X24B 2K6DA 3LW5E 1Y96A 1M2OA 1HSQA 1VQ6A 3CPWP 5GLFA 2E70A 4PFPA 2YRVA 4X1VA 4PJOA 2DAQA 4Z89A 2Q19X 4DQ2A 3EHRA 3KFVA 3MCAB 2QTVA 5CQYA 3JB9I 1YJNA 3SHWA 2PVOB 2ZCFB 2KAFA 2WSEE 4IUPA 1NEBA 1C6VX 4CC2A 4KDLA 2DJZA 5LJ5g 2GTJA 2M9UA 4ANJA 4FIBA 4PJLA 4DEYA 1CZ4A 2K3BA 3MEWA 3TVTA 1FWZA 3OMGA 1YCYA 4B9XA 2FRYA 4ME7A 2AZVA 3CCQA 2RPNA 2F69A 3UWNA 3ULRB 1Q7YC 1GRIA 2FB7A 1UECA 3EGUA 2OJ2A 4QQ6A 5KH6A 3HFNA 2RHIA 4JJDA 4LDVA 2FO0A 5I22A 4GBQA 1VQMQ 4CRIA 4J7IA 2GBQA 3S3OA 3OY9A 4M7AF 4M77F 2DXTA 1Q7YR 3CD6Q 2YRDA 1K73C 1ZSGA 4M7AG 1RAAB 2XDPA 2RHUA 4M77G 2CZ0B 5ECAA 2XDBA 2LJ1A 3EGXA 1S1NA 1AOJA 2PVDB 4Z02A 4LDYA 4AFQC 3QZ9B 2HD0A 2L5QA 3JB9H 4HXJA 1VQKA 1QMCA 3WVDB 3QXEB 4KGZB 3OYKA 3LYIA 3H41A 4JLGA 1ZX6A 4C8QF 3L2RA 1X43A 2DRMA 3MJXA 3P8HA 4O5VA 1K73R 2X4JA 5GJVB 1TUGB 2JUFA 2MM2A 3QYHB 3CCEA 5IXFA 1QDNA 3CCVA 2EFIA 4PKCC 3PFSA 1VQ4Q 1MUZA 3I56A 2X51A 5GANj 2X3WD 3KUFA 3JCMW 5GAOn 3EGDB 1VQMT 1VQLQ 2DXUA 4M75F 1WLFA 1TS9A 3CD6T 1C1AA 2E10A 4R56A 2DVJA 2DE0X 4M75G 2CYZB 2L3PA 2DKGA 3CC2Q 2R58A 2DM1A 3M0PA 5KYXB 2X4YA 3HHTB 1WQWA 1W6XA 2CP7A 1VQ9Q 1UGPB 5HY6A 4JZ3A 5GANh 5HK0A 1Y0MA
chains in the Genus database with same CATH topology
4M7DE 2XI9A 3JCMe 1KQ2A 3GIBA 2LX9A 4M75B 1Q82U 2L8DA 2QXFA 3CCMA 2VXEA 4A53A 4F7UF 3OYDA 3MEUA 1Q86C 1B34A 2JN0A 3PTAA 2BIVA 4JDSA 4ARCA 2E41A 2RA2A 3O8VA 4OB1B 3G6EA 4BE0A 2I2LA 4KT0E 3OYMA 3X25B 3OYHA 3FIFA 4M75A 5J26A 4F7UG 1VQ7A 2VGMA 2EQUA 1VQ4T 1Y7XA 3URGA 2JZ2A 3RKWA 1D3BB 2K57A 3A5ZB 4R55A 3L2UA 2WACA 4IKFA 3FRNA 3V7RA 3QC8A 1BI3A 2IVWA 4EMGA 2OTLT 3HSBA 3M57A 4OGEA 5DYIA 2OTJT 3LWIA 1VQLT 4E47A 3BW1A 5LJ3e 5DM7R 3CCRT 2NLUA 2GQVA 5GAOq 2RJCA 4M7DF 2LCLA 2M16A 3UDCA 1UEBA 3L2QA 4FL6A 4N4IA 1VQKT 2EQJA 3LGFA 1MHNA 2DTIA 4M7DD 4RV0A 4C5HA 4IUTA 3L2WA 4X9CA 4F7UB 2H3JA 3JCMX 1VUBA 2LT4A 5J39A 3L2VA 2XK0A 5GAN3 5CKEA 4LDXA 1KQSS 2XG8D 5ERGB 5DY9A 4A4KA 3JCMc 4QVDA 2RHYA 4N4GA 3OQ5A 2HQEA 3TEEA 5GMKm 2PUOB 2RB6A 4DOWA 2RH2A 2LRQA 4ZGEB 5B6CA 5A0GA 3CBMA 3PMIA 2RJFA 4QVZA 4Y28E 3OYYA 1H3ZA 3CCVT 4FU6A 2AHJB 2DTOA 1I81A 4J6YA 3CCST 2O4XA 4OP0A 4NS5A 3CXCA 3A8GB 4C0DB 3I56T 3LGLA 3HU1A 4A4FA 3GNGA 3M54A 4ZGJB 4C92F 1KC8U 1NPRA 1YIJT 3OYIA 1KD1U 1VQ5T 2FHDA 3LLRA 4XU2A 3VUZA 4C0GA 4M7DB 1N27A 1X6OA 4LDWA 3V7SA 5CQXA 2IG0A 1NJIU 1YJ9A 2ZPHB 3FB9A 1JJ2S 4PJOE 1G5VA 3JCMf 3RKXA 4KLNA 2A3LA 2HNIA 4JJNK 3OSSC 2DXBA 3L1AA 3HL8A 4C92G 2ZPGB 3G4SA 1N9SA 2EKOA 2PJHB 2EJGA 3G7ZA 4A4EA 3M53A 2VXFA 5A0DA 4HCZA 2RJDA 4HCBA 3HRTA 3QJ6A 4A54A 4HKEA 1I9GA 2MAMA 4KBMB 2OAUA 3CMEA 1VQ6T 3HRUA 4LD6A 4EPCA 2JOYA 2DEQA 4C8QG 3G71T 1VIFA 5GAMe 3JSCA 4MDWA 1W2BS 2RHXA 1XQHA 1WQ7A 4M7AA 2VGNA 1MGQA 5HKCA 3CXCS 2LTOA 4M77A 1LNXA 4O6JA 3SFMA 3H8ZA 1YJWA 3JRZA 1YI2A 4HT9A 4IURA 1Y07A 1EIFA 4EMKC 3MP8A 4Q5WA 3QDRB 1S72A 1QCSA 5LJ3f 5FU6C 4C92B 4KDIA 5FTJA 2MWOA 4PNOA 4BY6C 2LNVA 4JRKA 4XAXB 4PJOF 1QVFS 4OMFB 2LQ8A 4MDXA 2RI5A 2Y4YA 2QQ9A 2CZ6B 3OMCA 3L42A 4D6WA 3OW2A 3VJPA 4PJOD 3CCMT 5D6YA 1QVPA 4PLLA 3C12A 3G6ET 3HU2A 3BQBA 2LCCA 3L2ZA 2Q1CX 3HU3A 4M78A 4B9WA 4BE1A 3CCJA 1N6AA 2ZPBB 4QW2A 1VQ7T 5EQJB 3WXMB 1NPPA 4JS4A 5HK3A 4C8QA 1E32A 2CS7A 3JCMg 3RMSA 5A0LA 1CR5A 4A4GA 1ZHIA 5GMKl 2LT1A 5CR2A 1XNIA 2YLCA 3QG1A 4BDYA 4EDUA 2PWYA 5EPPA 4ZN1A 1M5Q1 2O01E 4C5EA 1Y96B 3FDRA 2RHZA 4MMLA 2QQAA 1S3SA 3KBGA 1G3SA 1QP3A 2LDMA 3RUXA 3OYNA 3OYCA 5CKHA 1ZBXA 2QQBA 3X26B 3TIWA 4PJOB 1U1TA 2HAXA 2E6NA 4ATOA 2A7YA 3N5BB 1YHQT 3OW2S 1Q7YU 1K8AC 1R7RA 2ZZDA 3OYFA 4CI0C 4J5YA 1JRIA 1RL2A 3OSVA 2KSSA 2E6ZA 2XHCA 3M56A 3M58A 2D9TA 3QHSA 3EAEA 3JCMJ 1SSFA 3CCUA 5GANe 3CCLA 1KG1A 2HQXA 4MZPA 2DIGA 2KMTA 3FLGA 2M1HA 4LDUA 3RMQA 3SWNA 4RG8A 4RMOA 3DLLA 2K4YA 5LJ3g 2V8IA 4UC4A 5C1BA 1ZC1A 4JS5A 1VQNT 5GMKi 4QQGA 2K5LA 1KQSA 3CPFA 4X34A 5GAOr 2KDSA 1WJSA 4NL2A 3OBYA 4ZTFA 5GAMf 2PUKB 3ZGZA 1HXDA 1YITA 3PNWC 1VQMA 4VUBA 3QSUA 1QVGS 4ELYC 2DIQA 2LQKA 4OGCA 4PL6A 5GAOp 2K3XA 5GAN2 3A8MB 3M59A 3SD4A 5CKDA 1H641 3CC7T 3VKIA 3PIPA 5AYFA 1K73U 3ZEHA 4FM4B 1D3BA 3CF2A 1UGRB 2RI2A 3E9FA 2LVMA 3ER0A 3Q1JA 3GNFB 4QQDA 5C18A 4WF2A 1M1FA 3A8OB 2QEXA 1IZ6A 1K9MC 5A2QE 4M77E 4BE2A 3I55A 3BY7A 4E7IA 3FPTA 3OYGA 3KXTA 4HCCA 4M7DG 2DO3A 2XU8A 1M4ZA 2DD5A 1G3YA 3QJYA 4KULA 3GOXA 4RG2A 1OZ2A 1VQ8A 2QA4A 3NTHA 3CMET 1BI0A 2PQWA 5DLQE 5C6SA 1Q82C 5LJ5e 1VQOA 3ZFJA 4F7UA 4MZMA 2WSCE 3DKMA 4DA4A 5FU7C 3OYJA 1Q81U 2EJFA 3INZA 3CCET 3FPRA 3QWZA 5GAMd 2JVVA 2YLBA 2CGHA 2DVEA 3V7CA 1W2BA 4N0AA 1G3TA 1X75C 2GFAA 2VUBA 3A8LB 3VU3C 1YJWT 1YI2T 5IAYA 3OYBA 4XTYA 5GAMj 5FROA 4E7JA 3GPLA 3C4SA 1N8RC 5CD1A 4M78E 5LL6S 4M7AC 3E9GA 1XOVA 2C06A 3M4GA 1OZ3A 3JCMb 4M77C 1M1KU 2EIFA 3NTIA 5L8RE 3DLMA 4XTZA 2RI3A 3CC4A 1XTDA 3JCMV 5GAMg 3PIOA 1U8RA 1QVFA 4M7AD 2KVQG 1UGSB 2R5MA 4M77D 4C5GA 5HK0A 1Y71A 1P92A 5EG2A 3RKYA 3ZBDA 4M7DA 2DZ9A 5GANf 2D6FA 3E1SA 1M90U 4LD9K 3C94A 1KHIA 2QI2A 2EAYA 3CCJT 1N9RA 5FRNA 2Y90A 3CPWS 2GF7A 2OTJA 1BIBA 4XU1A 3F70A 5IT9E 1WNLA 1W4SA 2F5KA 3CBOA 3OA6A 1FX7A 4HT8A 3AHUA 2Q18X 1G3WA 2MMPA 2YUJA 4KUDK 3RIRA 3QPHA 2BUDA 1VQPT 4M78C 3EFRA 2ZPIB 1QP2A 3V8JA 3OS2A 2BKDN 5CCXA 2CKKA 4RCCA 2KQWA 3BDLA 4C8QC 4M75E 3MB5A 4V2SA 1R8OB 2YHTA 5FLXE 2Q1DX 2RJEA 4M78D 5CKFA 4RCBA 3VYGA 4GLKA 5GAMh 2XDDA 2DXCA 2JTMA 2QQRA 3S6WA 2X4XA 2YVLA 3CC2A 5GAN5 4JUVA 3TREA 3OB9A 2GFUA 3TCJA 2PU9B 3MO8A 3M5AA 3LX7A 3JCMd 2M0OA 1JBMA 3M4YA 4L5GA 5CIUA 2B8AA 3CCLT 4FSXA 4C92A 1KC8C 3RERA 1BKBA 4PJOG 5GAN4 2MI6A 3WVEB 2B25A 1JJ2A 1VQ9A 1NJIC 4NL3A 1BIAA 4NOYA 1UGQB 5CCBA 2RD1A 3CBPA 1K8AU 4MZTA 3J7AF 2XKOC 4BD3A 5LJ5f 4E7HA 3VUBA 5KCHA 4ARIA 4IUVA 1O75A 3SWNC 4IUUA 1Q86U 1TH7A 1YIJA 1YITT 5GMKe 1VQ5A 1GXIE 3JB9D 1IREB 4HA8A 2JV2A 5DLOA 5CO7A 2DPPB 2P0PA 4M75C 3GF5A 4PLIA 5KE2A 1AHJB 4XK8E 4XTXA 5GANg 1QVGA 3DB4A 3V8KA 3JCMP 4OF1A 1V29B 4KUIA 2DTHA 5FTKA 4EMKB 5LJ3d 2LC4A 3ASKA 4M75D 3OYAA 3FPUA 2K5IA 5FU6B 4EMHA 4BY6B 1I8FA 3X24B 4BI3A 2JTFA 4J83A 2QEXT 3LW5E 1Y96A 5LJ3j 1VQ6A 3META 5GLFA 2E70A 2YRVA 2E65A 4PJOA 5J3BA 3BDUA 1VQ8T 2FVUA 3M9QA 2QA4T 2FL7A 2DAQA 1JB0E 2E1HA 5GAN6 3J81E 1VQOT 3CMAT 3JCMh 1K9MU 4FT2A 3P8DA 4OB3B 5D6WA 5LJ5d 2Q19X 4DQ2A 1QW1A 2R57A 3MCAB 1B34B 5CQYA 4AQ7A 3JB9I 1YJNA 2PVOB 3DB3A 5LJ5j 1I4K1 2ZPEB 2ZCFB 4OB2B 3V8LA 3H6ZA 2RK1A 2KAFA 2WSEE 2QTXA 2KK4A 1UB4A 4IUPA 2RO0A 2VV5A 4GY5A 5FTNA 5CVIA 2XIDA 4XTVA 1BYMA 4KDLA 2DJZA 3CC4T 4N0AC 3QQ8A 3MP6A 3CD6A 5LJ5g 2X35A 2M9UA 4JRPA 1NE8A 3MP1A 1YJ9T 4FIBA 4M7AE 1CZ4A 3RESA 1O54A 3MEWA 2QDYB 1FWZA 1LJOA 3G4ST 3OMGA 1YCYA 4N4HA 4B9XA 5KCOA 1N8RU 4ME7A 5LJ3h 3CCQA 3UT1A 2F69A 4J6WA 3UWNA 2MM0A 1WPYA 4BACA 2FB7A 1Q7YC 4CQNA 1NZ9A 4C0DC 2EWNA 2P0KA 3MEAA 1DJ7B 4OB0B 2DD4A 4A4HA 3QKJA 3QQ7A 4QQ6A 5KH6A 4M7DC 3X20B 3HFNA 3X28B 2ZGWA 1WJQA 2RHIA 2DZCA 3CPWA 3NTKA 4QVCA 3BFMA 4C0ZA 3HPWA 4XTUA 4C92E 3CMAA 3QIIA 5IN1A 1YHQA 4LDVA 4Y91A 4C5IA 5I2MA 3T9NA 1M8VA 3E19A 3VV0A 2E5QA 1S72T 5LJ5h 4CRIA 2LW6A 4J7IA 4ZGDB 3S3OA 3OS5A 1M9SA 4BI8B 3OY9A 4M7AF 5M9OA 4J7FA 4C8QE 1ZQ1A 5CKBA 5GAOm 5D6XA 3CC2T 3MEVA 4M77F 1WGSA 2ZPFB 2O4XB 3TU4K 1VQNA 2DXTA 4KO8A 4OVAA 3OS0A 2RK2A 4XTWA 3OS1A 1K73C 5DYGA 2L3RA 4M7AG 3FC3A 3LHDA 4JRQA 3PT9A 1VQ4A 3OBWA 1VQ9T 2XDPA 2RHUA 2RM4A 4M77G 4JLIA 3ZJTA 1HK9A 2CZ0B 1OI1A 2XDBA 3JCMQ 4MMKA 4C92C 2OTLA 5I2SA 2PVDB 4Z02A 4L59A 1VQLA 4LDYA 4XU3A 2XD0A 2XICA 3PMTA 1LOJA 3QZ9B 2K3YA 1RI0A 3SB2A 3CC7A 3A8HB 3CCRA 5FTLA 4J6XA 2MWPA 2HD0A 4IUQA 2L5QA 5FU7B 3UPUA 2Q1AX 2KY9A 4BI4A 3SDZA 3VYHB 3JB9H 3QZ5B 4C92D 1VQKA 3QUIA 3WVDB 3MHXA 3QXEB 4M78F 3OYLA 1I5LA 5GMKj 3OYKA 3LYIA 1YBYA 1Q81C 3S3MA 4J8OA 4JLGA 1KHCA 4DOVA 4C8QF 2EQMA 4M7AB 3GLXA 4C0FA 2VYTA 3QO3A 1OYXA 3P8HA 4O5VA 3L2RA 2X4JA 4M77B 2D0QB 1PSEA 4M78G 3HKSA 4C8QD 2P0QA 2MF2A 4X9DA 4L6V5 3LGAA 4BB7A 4E7LA 1BI1A 3CCUT 2V8KA 4RKUE 1KD1C 2JUFA 1M1KC 3LWHA 3QYHB 2MM2A 5C0MA 3M55A 3CCEA 1QDNA 3HFOA 4TVRA 2EFIA 5GANd 5GAN7 2EJ9A 3HP9A 2K2VA 2GCXA 4PKCC 3CCVA 3R6OA 3PFSA 3CCSA 1CZ5A 1WJRA 3LH0A 2CZ7B 3I56A 5GANj 3JB9F 2E64A 3KUFA 2WSFE 5KE3A 3JCMW 4PJOC 5GAOn 3CCQT 2CZ1B 2EQKA 4JRIA 1YJNT 1M90C 1VQMT 4KODA 2DK3A 4BDZA 1M1GA 2DXUA 1PSFA 3C95A 3JB9J 3JB9G 4M78B 3CEYA 4M75F 2R5AA 4ZTJA 1WLFA 2HBPA 2P4TA 2X4WA 4XQ3A 5I21A 4C8QB 3NFCA 4XU0A 4F7UE 3CD6T 2K5FA 2Y4XA 4ZN3A 2G3RA 4BUGA 2L89A 2E10A 5GAN8 5GMKh 4R56A 2EYQA 3QYGB 4ELZC 4M75G 4AS1A 2CYZB 2VC8A 3I55T 1KQ1A 3J80E 2JNGA 3S3NA 2DKGA 1X01A 4EMKA 2E12A 5GAOl 2R58A 2V8JA 4P5NA 2QQSA 4II1A 3GP8A 3G71A 1BI2A 1FXXA 4FT4A 2X4YA 5CK9A 4E7KA 1VQPA 4YTLA 3ME9A 3HHTB 1U1SA 3FEOA 1WQWA 1O9SA 3JAME 5FRMA 3EFSA 3FJPA 1VIEA 5CAIA 2FYKA 5FTMA 1UGPB 5HY6A 3P8BB 3ZJVA 5CCAA 3ZJUA 3HRSA 2F5TX 3PGGA 3OYEA 5GANh 2PVGB 3SWNB 3QBYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIB A;  2KY9 A; 
#chains in the Genus database with same CATH topology
 2KRS A;  3GIB A;  2L8D A;  2QXF A;  4A53 A;  1Q86 C;  1ZSZ B;  1B34 A;  2DMO A;  1AWO A;  4JDS A;  1CSK A;  1FMK A;  3G6E A;  2KE9 A;  1RAD B;  5J26 A;  1VQ7 A;  2VGM A;  2EQU A;  1AZG B;  1VQ4 T;  3H0I A;  3URG A;  1VQ6 Q;  2EYY A;  3QC8 A;  2F2V A;  5DYI A;  4EMG A;  4M4Z A;  4KRT A;  1VQL T;  2CUB A;  3CCR T;  3TSW A;  5GAO q;  2RJC A;  4M7D F;  1R0B G;  3LH5 A;  3L2Q A;  1OPL A;  1Q86 R;  2HSE B;  3LGF A;  2FEI A;  1OU8 A;  2COY A;  4X9C A;  4OMP A;  1PRL C;  2CH4 A;  5DY9 A;  2CP2 A;  2RHY A;  4F04 B;  2LRQ A;  2QAS A;  5A0G A;  3OYY A;  1TSF A;  3A8G B;  3CCQ Q;  2KI7 A;  3HU1 A;  4A4F A;  4LNP A;  4C92 F;  3EH2 A;  1WLP B;  1KC8 U;  4C0G A;  4LDW A;  1GBQ A;  3FB9 A;  2HL5 C;  3OSS C;  3L1A A;  2DJQ A;  4C92 G;  3G4S A;  2EKO A;  2PJH B;  3ZL7 C;  3G7Z A;  4HCZ A;  2ECZ A;  4HCB A;  3HRT A;  1OQK A;  1QCN A;  1VQ6 T;  3HRU A;  2NWM A;  3G71 T;  1VIF A;  4M7A A;  2W0Z A;  2MIO A;  4M77 A;  2EKH A;  4O6J A;  5HCK A;  3H8Z A;  4IUR A;  2L0A A;  1EIF A;  4Q5W A;  8ATC B;  5FU6 C;  1WZO A;  2LQ8 A;  2LJ0 A;  4MDX A;  2RI5 A;  1OEB A;  2CZ6 B;  2FPD A;  1BK2 A;  1VQK Q;  2GGR A;  5KYU B;  1M2V A;  3HU2 A;  1GFD A;  3L2Z A;  2GNC A;  1NPP A;  3EG0 A;  4C8Q A;  3RDV A;  2CS7 A;  2FZK B;  5GMK l;  2LT1 A;  1KIK A;  2PWY A;  2QGG A;  1M5Q 1;  2LZ6 B;  2K7A A;  3CCE Q;  2RHZ A;  3UA7 A;  1K76 A;  3CCV Q;  2LDM A;  3RUX A;  2JW4 A;  1ZBX A;  4DBF A;  1YJW Q;  3TIW A;  1U1T A;  3I56 Q;  3OW2 S;  1Q7Y U;  1BB9 A;  2ZZD A;  5IH2 A;  1YCS B;  2KGT A;  2C0O A;  2XHC A;  2E6Z A;  3M56 A;  1JJ2 S;  2D9T A;  3CCL A;  5GAN e;  4MZP A;  2BE9 B;  4RMO A;  3SWN A;  2K4Y A;  2KT8 A;  2EGE A;  4JS5 A;  5GMK i;  4QQG A;  2K5L A;  2DER A;  2KRN A;  3QWY A;  3OBY A;  1SEM A;  1PHT A;  2DRK A;  1RAI B;  3PNW C;  4VUB A;  2KXC A;  3QSU A;  1NEG A;  2DIQ A;  2LQK A;  3C0C A;  5GAN 2;  1JEG A;  1ZUY A;  2EYZ A;  3PIP A;  3EG2 A;  5AYF A;  1K73 U;  2JM9 A;  1D3B A;  2RI2 A;  3E9F A;  4K11 A;  5C18 A;  3Q1J A;  5FWC A;  3A8O B;  1IZ6 A;  1Q95 G;  4BE2 A;  4PK4 A;  3BY7 A;  3I55 A;  3OYG A;  1D1B A;  2HKQ B;  2DO3 A;  2ATC B;  1G3Y A;  4QKU A;  3GOX A;  1OZ2 A;  3CME T;  1Q82 C;  3MKD A;  1N5Z A;  4MZM A;  3G6E Q;  5FU7 C;  2EJF A;  3CCE T;  3FPR A;  5KYY A;  2CGH A;  3A8L B;  1YJW T;  5FRO A;  2D1X A;  1R0C B;  1QCO A;  1XOV A;  1OZ3 A;  1BBZ A;  2RMO A;  1IXD A;  1B7T A;  3JCM V;  1U8R A;  1QVF A;  4M7A D;  4PFZ A;  2AT1 B;  2R5M A;  4M77 D;  1Q82 R;  4M7D A;  3CCJ T;  1RAB B;  1PC0 A;  2Y90 A;  1BIB A;  4XU1 A;  2Z0W A;  3F70 A;  3OA6 A;  2A08 A;  5KYW B;  4RCC A;  2KYM A;  3MB5 A;  1M27 C;  1R8O B;  4V2S A;  5CKF A;  2PZ1 A;  4RCB A;  2JTM A;  2AKL A;  2YVL A;  4JUV A;  2PU9 B;  3M5A A;  4L5G A;  2B8A A;  4FSX A;  4C92 A;  3I35 A;  1WHL A;  1TUD A;  4PJO G;  3WVE B;  1H8K A;  5CCB A;  3G4S Q;  2RD1 A;  2XKO C;  4BD3 A;  1QKW A;  2O88 A;  3EG9 A;  4E7H A;  4ARI A;  1Q86 U;  1TH7 A;  1VQ5 A;  1IRE B;  2DPP B;  2PNI A;  4XK8 E;  3PVQ A;  5GAN g;  3M0T A;  3SEM A;  1QVG A;  2LCS A;  3DB4 A;  1H92 A;  3JCM P;  4AG1 C;  3VS3 A;  2LC4 A;  4M75 D;  3FPU A;  5FU6 B;  4EMH A;  5I11 A;  1H3H A;  4J83 A;  2QEX T;  2X9H A;  5J3B A;  2FVU A;  2QA4 T;  2E1H A;  1JB0 E;  3J81 E;  1IB8 A;  5L23 A;  3P8D A;  4AQ7 A;  2EVR A;  1I4K 1;  2ZPE B;  4ELZ C;  5FTN A;  2B86 A;  1ZUK A;  2KK4 A;  2CP0 A;  2F1L A;  2VV5 A;  4GY5 A;  5CVI A;  2RNA A;  2XID A;  3QQ8 A;  3CD6 A;  4ESR A;  4JRP A;  3MP1 A;  1O54 A;  1T3L A;  2QDY B;  1EX4 A;  3G4S T;  2NUT B;  2MM0 A;  1VYT A;  4BAC A;  4CQN A;  2EWN A;  3CCL Q;  4OB0 B;  2DD4 A;  4A4H A;  3QQ7 A;  2ZGW A;  3CPW A;  1OV3 A;  3NTK A;  1AWJ A;  3BFM A;  4C0Z A;  3HPW A;  1YHQ A;  1FMV A;  3T9N A;  3VS1 A;  2D0N A;  1CKB A;  1V1C A;  4ZGD B;  1ABO A;  3OS5 A;  1M9S A;  5M9O A;  1AVZ C;  1YWO A;  4J7F A;  1ZQ1 A;  2MPX C;  2RQR A;  4IIM A;  1VQN A;  4OVA A;  4XTW A;  3OS1 A;  3FC3 A;  3LHD A;  1VQ4 A;  3I55 Q;  4JLI A;  4RUG A;  2SEM A;  1OI1 A;  3JCM Q;  1VQL A;  6AT1 B;  2XIC A;  1LOJ A;  3SB2 A;  3CCR A;  1RI0 A;  1RAE B;  3A8H B;  2MWP A;  5FU7 B;  2KR3 A;  2A28 A;  3SDZ A;  4C92 D;  3QUI A;  3MHX A;  4M78 F;  1GCQ A;  2HKN A;  1I1J A;  1NM7 A;  1YBY A;  2M51 A;  5GMK j;  3S3M A;  4J8O A;  1KHC A;  5IXB A;  4LN2 A;  1X2K A;  3QO3 A;  4M78 G;  5IHN A;  1B07 A;  3M0U A;  2MOX A;  3M55 A;  5GAN d;  4TVR A;  2LP5 A;  2GCX A;  3R6O A;  1F1B B;  2F2X A;  2CZ7 B;  4JPB W;  2YWW A;  4PJO C;  1PRM C;  3I9Q A;  1ZLM A;  4BDZ A;  1M1G A;  1PSF A;  2AK5 A;  3H9N A;  4ZTJ A;  2X4W A;  5I21 A;  1WX6 A;  2YXY A;  4ZN3 A;  4BUG A;  3U23 A;  2L89 A;  5GAN 8;  1KC8 R;  5GMK h;  3QYG B;  2KT1 A;  1U3O A;  4FW1 A;  3I55 T;  3J80 E;  3S3N A;  5C1B A;  1X01 A;  1AT1 B;  2M0Y A;  4EMK A;  3G71 A;  2QQS A;  4II1 A;  3GP8 A;  1IHW A;  1FXX A;  4FT4 A;  1YP5 A;  1VQP A;  3JAM E;  5FRM A;  1SHF A;  1VIE A;  2DEU A;  4AFU C;  3ZJV A;  5CCA A;  1MMG A;  3OYE A;  3PGG A;  2XI9 A;  3D7S B;  1VQ5 Q;  1Q82 U;  4EIK A;  2QK0 A;  2VXE A;  3MEU A;  1IO6 A;  2JN0 A;  4BE0 A;  1UGV A;  2I2L A;  1E7O A;  3OYM A;  4FYX B;  4RTZ A;  2RQW A;  2K57 A;  4R55 A;  3L2U A;  2WAC A;  1ARK A;  3M57 A;  2NLU A;  4CC7 A;  1R77 A;  1FMW A;  1UEB A;  4J9F A;  4N4I A;  1G83 A;  3PVL A;  3UAT A;  2A37 A;  1FYN A;  2AZS A;  4IUT A;  1PD0 A;  4F7U B;  1WYX A;  1SHG A;  5CKE A;  1KQS S;  2XG8 D;  3CCM Q;  4A4K A;  4QVD A;  3OQ5 A;  3TEE A;  5GMK m;  4DOW A;  1IGU A;  3CBM A;  1QKX A;  4PJM A;  4QVZ A;  4Y28 E;  4PJN A;  2D8J A;  4FU6 A;  3BE3 A;  1NBE B;  3CCS T;  1RLQ C;  2O4X A;  3LGL A;  1V76 A;  4D8K A;  2H8H A;  3GNG A;  1VOM A;  1VQ5 T;  1KD1 U;  2FHD A;  3LLR A;  3VUZ A;  4OMO A;  2IG0 A;  1YJ9 A;  2ZPH B;  3RKX A;  2ZPG B;  1N9S A;  3REA B;  1YHQ Q;  1T3S A;  4A54 A;  2JM8 A;  2MAM A;  4KBM B;  1UG1 A;  3CME A;  4EPC A;  1PNJ A;  4C8Q G;  1D09 B;  3JSC A;  2IIM A;  1XQH A;  2VGN A;  1VQN Q;  2ED1 A;  3CXC S;  2COW A;  2LTO A;  1LNX A;  2OX7 A;  1YJW A;  3QDR B;  1S72 A;  1QCS A;  4KDI A;  4PNO A;  2LNV A;  4OMF B;  3CCR Q;  1TWB A;  1OU9 A;  3OMC A;  3OW2 A;  4PJO D;  3CCM T;  1TOV A;  1LVK A;  2Q1C X;  3HU3 A;  4M78 A;  3CCJ A;  1N6A A;  4QW2 A;  5EQJ B;  4JS4 A;  1XJW B;  1E32 A;  1IGQ A;  1XNI A;  3MPU B;  3QG1 A;  2NUP B;  5EPP A;  1UDL A;  3IQL A;  1Y96 B;  3FDR A;  1X6B A;  4MML A;  1QP3 A;  2OI3 A;  1NYF A;  2DLP A;  1YI2 Q;  4PJO B;  2HAX A;  2A7Y A;  1YHQ T;  3OYF A;  4CI0 C;  4J5Y A;  1JRI A;  1RL2 A;  1YFN A;  2KSS A;  3OSV A;  2L3S A;  3JCM J;  1HYO A;  1SSF A;  3CCU A;  2HQX A;  3RMQ A;  2M1H A;  4DBR A;  3NPF A;  4RG8 A;  2V8I A;  1K0X A;  1ZC1 A;  1VQN T;  2EGA A;  4X34 A;  4ZTF A;  5AT1 B;  3G71 Q;  4PL6 A;  2K3X A;  4AMC A;  3A8M B;  3M59 A;  3SD4 A;  5CKD A;  1VQP Q;  4LUD A;  4FM4 B;  1UGR B;  2LVM A;  4QQD A;  2CSI A;  2QEX A;  4M77 E;  3FPT A;  2C0T A;  3KXT A;  4M7D G;  2HZY A;  2XU8 A;  1WDX A;  2JTE A;  4KUL A;  1TG0 A;  2V1R A;  1JQQ A;  1G8X A;  2QA4 A;  3GBQ A;  1RUW A;  4DA4 A;  2OAW A;  3QWZ A;  3VS7 A;  1D0X A;  1VYU A;  1W2B A;  4N0A A;  3VU3 C;  1X75 C;  2GFA A;  2VUB A;  3OW2 P;  4RTW A;  1YI2 T;  5IAY A;  2FZG B;  5GAM j;  4E7J A;  3GPL A;  3C4S A;  5CD1 A;  4M7A C;  1RAC B;  3NMZ C;  1JJ2 P;  4M77 C;  1OX8 A;  4FW2 A;  2DBM A;  3DLM A;  2RI3 A;  2LNH B;  3PIO A;  1UJ0 A;  1UGS B;  3EGX B;  4C5G A;  2DZ9 A;  4F14 A;  2D6F A;  4KH0 B;  1KHI A;  2EAY A;  5FRN A;  1GBR A;  2OTJ A;  1VYV A;  1VQ8 Q;  1W4S A;  3CBO A;  4E7S A;  1D0Z A;  2V26 A;  2BUD A;  1VQP T;  1MV3 A;  1YN8 A;  2ZPI B;  1QP2 A;  2BKD N;  2KQW A;  4C8Q C;  2CP5 A;  4M75 E;  2Q1D X;  4M78 D;  5GAM h;  4GLK A;  2XDD A;  1PWT A;  5GAN 5;  3TRE A;  2GFU A;  1ABQ A;  1YJ9 Q;  1NJI C;  1BIA A;  4FYV B;  4NOY A;  1UHC A;  2O2O A;  1GCP A;  3SWN C;  3H0F A;  1GXI E;  3CME Q;  1YIT T;  1YIJ A;  2JV2 A;  4HA8 A;  3RR6 A;  2NYS A;  4M75 C;  4PLI A;  5KE2 A;  4XTX A;  2VVK A;  1UTI A;  4KUI A;  2DTH A;  5FTK A;  3OYA A;  2GQI A;  1S72 Q;  2CRE A;  2VWF A;  1NJI R;  1MND A;  1WFW A;  2E65 A;  1W2B P;  3BDU A;  1VQ8 T;  2RQT A;  2FL7 A;  5GAN 6;  1VQO T;  4OB3 B;  2R57 A;  1B34 B;  3CCJ Q;  2J05 A;  3DB3 A;  5LJ5 j;  4OB2 B;  3V8L A;  2RK1 A;  4OMN A;  1KJW A;  4XTV A;  1BYM A;  2ZAE A;  2HBW A;  3CC4 T;  1Z9Q A;  2JJ9 A;  2X35 A;  1GFC A;  1NE8 A;  2ABL A;  2GTO A;  1YJ9 T;  2DL5 A;  2SRC A;  1LJO A;  4E7Z A;  4N4H A;  5KCO A;  4RTX A;  2BE7 D;  3UT1 A;  4J6W A;  1WPY A;  4C0D C;  3CCU Q;  3EHQ A;  3QKJ A;  2NUT A;  4M7D C;  3X20 B;  1WJQ A;  2AKK A;  4QVC A;  4C92 E;  4LE9 A;  1SPK A;  3QII A;  4FCY A;  3CQT A;  2BZ8 A;  5I2M A;  1M8V A;  2E5Q A;  2EBP A;  1S72 T;  3VRZ A;  3A98 A;  5LJ5 h;  2LW6 A;  4OMM A;  2I0N A;  3MEV A;  1WXU A;  4KGX B;  1WGS A;  2RK2 A;  5DYG A;  2L3R A;  2RF0 A;  1YWP A;  4JRQ A;  2QEX Q;  3OBW A;  2FPE A;  2RM4 A;  1HK9 A;  4WTO B;  4MMK A;  4C92 C;  4XU3 A;  1PD1 A;  1SRL A;  2QA4 Q;  2K3Y A;  4AG2 C;  4J6X A;  2L2P A;  2Q1A X;  2QDL A;  4BI4 A;  3VYH B;  2EW3 A;  1QCF A;  3OYL A;  1SG5 A;  2KXD A;  2EQM A;  4M7A B;  4C0F A;  4CC3 A;  4M77 B;  2D0Q B;  1PSE A;  4IIO A;  3HKS A;  4C8Q D;  2MF2 A;  1U06 A;  3LGA A;  4E7L A;  1KD1 C;  3CCU T;  2V8K A;  4RKU E;  1M1K C;  3LWH A;  2K9G A;  5C0M A;  2KEA A;  3VS2 A;  4J9I A;  3M0Q A;  2K2V A;  3CCS A;  1WIE A;  3LH0 A;  4J9H A;  2E64 A;  3EG3 A;  2WSF E;  1KK7 A;  1SRM A;  1JXO A;  1BU1 A;  3EH1 A;  4JRI A;  1M90 C;  1M2V B;  2OTJ Q;  1AWW A;  4DBQ A;  3CEY A;  2R5A A;  4XQ3 A;  4C8Q B;  3NFC A;  4XU0 A;  4F7U E;  2K5F A;  1KD1 R;  5IHK A;  1UJY A;  1M1K R;  4WCI A;  2VC8 A;  3QDF A;  1KQ1 A;  3G1J A;  2YRC A;  5GAO l;  2E12 A;  2V8J A;  1BI2 A;  4E7K A;  1UUE A;  4YTL A;  3VRY A;  1U1S A;  1M90 R;  1RAH B;  3FJP A;  5CAI A;  2FYK A;  5FTM A;  1MMA A;  3CMA T;  2PVG B;  1TXQ A;  3QBY A;  3SWN B;  4JJB A;  2FG0 A;  2LX9 A;  5FWB A;  1KQ2 A;  1YIJ Q;  4M75 B;  3CCM A;  3PTA A;  2BIV A;  4ARC A;  3O8V A;  4KT0 E;  2RQV A;  3X25 B;  3OYH A;  2DIL A;  1WXB A;  4QT7 A;  2JZ2 A;  4FSS A;  3RKW A;  1D3B B;  3A5Z B;  2KNB B;  3FRN A;  4IKF A;  2IVW A;  2OTL T;  3HSB A;  4OGE A;  2OTJ T;  1TTH B;  4E47 A;  3BW1 A;  5DM7 R;  2JS2 A;  4Z8A A;  1WHH A;  1WHM A;  2DTI A;  4M7D D;  4RV0 A;  4C5H A;  3VS0 A;  3THK A;  4ORZ A;  2H3J A;  4RTU A;  1VUB A;  5J39 A;  2XK0 A;  5GAN 3;  5KYY B;  4LDX A;  5ERG B;  2HSP A;  2LQN A;  1GCQ C;  4N4G A;  2DF6 A;  2PUO B;  2RB6 A;  4ZGE B;  5B6C A;  2BTT A;  1H3Z A;  2J6F A;  1KFZ A;  2DTO A;  1I81 A;  4OP0 A;  4NS5 A;  2DX1 A;  3CXC A;  4C0D B;  3AT1 B;  1QWE A;  1YIJ T;  3OYI A;  4JZ4 A;  4M7D B;  4J9C A;  1X6O A;  1NJI U;  4FYY B;  2YT6 A;  1I07 A;  4PJO E;  3JCM f;  2YSQ A;  2A3L A;  2HNI A;  5D7U A;  4B6M A;  3UF4 A;  2DL3 A;  4A4E A;  1PKS A;  2RJD A;  3QJ6 A;  4HKE A;  4OML A;  1MV0 B;  2OAU A;  2DYB A;  1W70 A;  1M3B A;  1I5O B;  3SFM A;  1YI2 A;  4HT9 A;  4PFO A;  3FJ5 A;  1T0H A;  1Y07 A;  4EMK C;  3MP8 A;  5LJ3 f;  4C92 B;  5FTJ A;  4BY6 C;  4PJJ A;  4JRK A;  4AT1 B;  1QVF S;  1KQS P;  4ZNX A;  3L42 A;  4Y92 A;  3VJP A;  2EPD A;  5D6Y A;  1QVP A;  3EGD A;  3C12 A;  3QWX X;  2KRM A;  3BQB A;  2LCC A;  1NYG A;  2QYZ A;  7AT1 B;  5HK3 A;  1A0N B;  3EFO B;  5EC7 A;  1CR5 A;  4A4G A;  4RTT A;  4DBH A;  2YLC A;  4BDY A;  4ZN1 A;  2O01 E;  3KBG A;  1G3S A;  3M0R A;  1RAF B;  5KYX A;  3CCS Q;  3X26 B;  2P4R A;  4ATO A;  2DBK A;  2NUP A;  2J06 A;  3QHS A;  3M58 A;  3A1P A;  2DIG A;  4LDU A;  2D8H A;  3DLL A;  3CXC P;  2O31 A;  2KDS A;  1CKA A;  1ZSZ A;  5GAM f;  1B3Q A;  1E6G A;  1YIT A;  1QVG S;  1U5S A;  4ELY C;  2CSQ A;  4J9D A;  1H64 1;  2ROL A;  3CF2 A;  3ER0 A;  1M1F A;  2V1Q A;  5A2Q E;  4E7I A;  1ACM B;  1Z9Z A;  1M8M A;  2K2M A;  2YDL A;  3VS4 A;  1D0Y A;  4A63 B;  3QJY A;  4J9G A;  1VQ8 A;  5C6S A;  1VQO A;  1D1C A;  2E5K A;  3ZFJ A;  2WSC E;  2EGC A;  3OYJ A;  5GAM d;  2JVV A;  4Z88 A;  4M78 E;  2C06 A;  4R0K A;  3JCM b;  1M1K U;  2EIF A;  3CC4 A;  4XTZ A;  1XTD A;  5FW9 A;  3VS6 A;  2KVQ G;  1WXT A;  1PCX A;  2CP6 A;  3UA6 A;  5EG2 A;  1M90 U;  4LD9 K;  2QI2 A;  3TQ7 P;  1N9R A;  4FYW B;  3CPW S;  1X69 A;  1FX7 A;  1G3W A;  4KUD K;  1YNZ A;  3QPH A;  2J7I A;  4M78 C;  1M3C A;  1ZBJ A;  2YUO A;  3OS2 A;  2CKK A;  3I5R A;  4KH1 B;  1WHG A;  2KYB A;  2DXC A;  2QQR A;  4CC4 B;  2X4X A;  3TCJ A;  3I5S A;  3MO8 A;  3LX7 A;  2M0O A;  1JBM A;  5CIU A;  3RER A;  1GL5 A;  1BKB A;  1WI7 A;  5GAN 4;  2B25 A;  1JJ2 A;  4NL3 A;  2EYW A;  1WHK A;  4J9E A;  1K8A U;  4MZT A;  3J7A F;  4GLM A;  5LJ5 f;  3VUB A;  5KCH A;  1M3A A;  4IUU A;  5KYU A;  5GMK e;  2G6F X;  5DLO A;  2P0P A;  1J3T A;  3GF5 A;  1AHJ B;  1SSH A;  3V8K A;  2F2W A;  1V29 B;  4EMK B;  1LCK A;  3ASK A;  2K5I A;  3RBB B;  4BY6 B;  4BI3 A;  2P84 A;  1IRX A;  2HL3 A;  5LJ3 j;  3MET A;  4J9B A;  9ATC B;  1HJD A;  2ENM A;  2YUP A;  3M9Q A;  1X27 A;  2QAZ A;  3JCM h;  1K9M U;  4FT2 A;  5D6W A;  5LJ5 d;  1QW1 A;  2C0I A;  3H6Z A;  2QTX A;  1UB4 A;  2RO0 A;  4N0A C;  3MP6 A;  1EFN A;  4M7A E;  2HMA A;  5GJW B;  3RES A;  2KBT A;  2CDT A;  2JXB A;  2M02 A;  1N8R U;  5LJ3 h;  1NZ9 A;  2P0K A;  3MEA A;  1IHV A;  1DJ7 B;  2QGF B;  2IPO B;  2JS0 A;  3X28 B;  2DZC A;  4HVW A;  4XTU A;  2LJ3 A;  3CMA A;  5IN1 A;  2AIR B;  4Y91 A;  4C5I A;  3E19 A;  3VV0 A;  1YIT Q;  1YJN Q;  3REB B;  2L3Q A;  4BI8 B;  4C8Q E;  5CKB A;  5GAO m;  5D6X A;  3CC2 T;  2DA9 A;  2ZPF B;  2O4X B;  3TU4 K;  4KO8 A;  2KRO A;  4LUE A;  1X2Q A;  3PT9 A;  1VQ9 T;  3ZJT A;  2RN8 A;  2OTL A;  5I2S A;  4L59 A;  2XD0 A;  3PMT A;  3CC7 A;  5FTL A;  4IUQ A;  3UPU A;  1VQO Q;  2KY9 A;  1EZZ B;  3QZ5 B;  2DL7 A;  1I5L A;  1Q81 C;  4DOV A;  1JXM A;  1PG5 B;  3GLX A;  3NHN A;  2VYT A;  1OYX A;  5KYW A;  1K9A A;  2P0Q A;  2E3H A;  2W10 A;  3CC4 Q;  4X9D A;  2HDA A;  4L6V 5;  4BB7 A;  2BZX A;  1BI1 A;  3HFO A;  5GAN 7;  3TSZ A;  3OS0 A;  2VB6 A;  2EJ9 A;  3HP9 A;  1AEY A;  1CZ5 A;  1WJR A;  3JB9 F;  1JO8 A;  5KE3 A;  2CZ1 B;  2EQK A;  1YJN T;  1SF9 A;  2DK3 A;  1Q81 R;  2DL8 A;  3C95 A;  3JB9 J;  3JB9 G;  4M78 B;  2ESW A;  2HBP A;  2P4T A;  4HVU A;  2BZY A;  2Y4X A;  2G3R A;  2E3I A;  2EYQ A;  2JT4 A;  4AS1 A;  2H3E B;  2JNG A;  4D8D A;  3CCQ T;  4KOD A;  1JU5 C;  4P5N A;  5CK9 A;  2CT4 A;  1G2B A;  3ME9 A;  1ZA2 B;  3FEO A;  1O9S A;  1OOT A;  4RTV A;  3EFS A;  3P8B B;  2FPF A;  2VKN A;  3ZJU A;  3HRS A;  2F5T X;  4HCK A;  2J6K A;  1NLP C;  4M7D E;  3JCM e;  4E6R A;  3RNJ A;  3OYD A;  4F7U F;  1NLO C;  1X6G A;  3NGP A;  2E41 A;  2RA2 A;  4OB1 B;  3FIF A;  4M75 A;  2JMA A;  4F7U G;  1Y7X A;  5IHI A;  2LQW A;  3V7R A;  1BI3 A;  2ED0 A;  1VA7 A;  3LWI A;  5LJ3 e;  2K79 A;  2FZC B;  2GQV A;  2LCL A;  2M16 A;  3UDC A;  4FL6 A;  1VQK T;  2EQJ A;  1AWX A;  1MHN A;  3O5Z A;  1I0C A;  1OUL A;  3L2W A;  4F17 A;  3JCM X;  2LT4 A;  3L2V A;  1NG2 A;  4JJC A;  3JCM c;  2HQE A;  2FRW A;  2RH2 A;  2XMF A;  2LX7 A;  3PMI A;  2RJF A;  1UE9 A;  3CCV T;  2AHJ B;  1VQ7 Q;  4J6Y A;  3I56 T;  3M54 A;  4ZGJ B;  3M0S A;  1NPR A;  4XU2 A;  1N27 A;  2COZ A;  3V7S A;  1G5V A;  5CQX A;  3VS5 A;  2DET A;  4KLN A;  4JJN K;  1AZE A;  2DXB A;  3CMA Q;  3HL8 A;  4HVV A;  4AFZ C;  2EJG A;  2HCK A;  2VXF A;  1PM3 A;  3M53 A;  5A0D A;  1I9G A;  2A0F B;  2MCN A;  4LD6 A;  1AD5 A;  4LXC A;  2JOY A;  2DEQ A;  5GAM e;  4MDW A;  1W2B S;  2RHX A;  2CUD A;  1WQ7 A;  1MGQ A;  5HKC A;  3JRZ A;  1K0S A;  2QG9 B;  1E6H A;  2MWO A;  2OTL Q;  4PJO F;  4XAX B;  2X3X D;  2Y4Y A;  3CC7 Q;  2QQ9 A;  2O9V A;  3H0H A;  4D6W A;  1RLP C;  2YUQ A;  1LPL A;  4PLL A;  3G6E T;  1ZA1 B;  4B9W A;  4BE1 A;  2ZPB B;  1VQ7 T;  3WXM B;  2J6O A;  2MYS A;  3JCM g;  4F16 A;  1OX9 A;  3RMS A;  5A0L A;  1OPK A;  1ZHI A;  5CR2 A;  3JV3 A;  4EDU A;  1M30 A;  4C5E A;  2QQA A;  1S3S A;  4AFS C;  3OYN A;  3OYC A;  3EFO A;  5CKH A;  1SKU B;  2QQB A;  2CP3 A;  2E6N A;  3E2U A;  3N5B B;  1UFF A;  2O9S A;  1TUC A;  2RQU A;  1K8A C;  1R7R A;  2HQH A;  2E4H A;  2EQI A;  1HD3 A;  3EAE A;  1KG1 A;  2CT3 A;  3FLG A;  1QWF A;  2KMT A;  1MNE A;  5LJ3 g;  4UC4 A;  1KQS A;  3CPF A;  8AT1 B;  5GAO r;  1K4U S;  1WJS A;  4NL2 A;  2PUK B;  4DEX A;  1RAG B;  1HXD A;  3ZGZ A;  1VQM A;  1QVF P;  1WHJ A;  1K1Z A;  4OGC A;  5GAO p;  1QLY A;  1MMD A;  1K8A R;  3CC7 T;  3VKI A;  2MK5 A;  3ZEH A;  3PE0 A;  1D1A A;  2DYI A;  3GNF B;  4WF2 A;  1K9M C;  2DNU A;  2A36 A;  4HCC A;  1BCM A;  1M4Z A;  2DD5 A;  4RG2 A;  3HTR A;  3NTH A;  1BI0 A;  2PQW A;  5DLQ E;  5LJ5 e;  2VAS A;  4F7U A;  3DKM A;  5KYN A;  1Q81 U;  3INZ A;  2YLB A;  3V7C A;  2DVE A;  1G3T A;  3OYB A;  4XTY A;  1N8R C;  5LL6 S;  3E9G A;  1K9M R;  3M4G A;  5L8R E;  3NTI A;  4OMQ A;  2HEQ A;  5GAM g;  1MMN A;  1WA7 A;  2PTK A;  1Y71 A;  1P92 A;  3RKY A;  3ZBD A;  5GAN f;  3E1S A;  2DFU A;  3C94 A;  1QVG P;  3R6N A;  4E2F B;  2GF7 A;  5IT9 E;  1PKT A;  1WNL A;  2F5K A;  4HT8 A;  1C0M A;  2Q18 X;  3AHU A;  2YUJ A;  2MMP A;  1N8R R;  3RIR A;  3EFR A;  1BCO A;  3V8J A;  5CCX A;  3BDL A;  2YHT A;  5FLX E;  2RJE A;  3VYG A;  2JMC A;  3S6W A;  3CC2 A;  3OB9 A;  3JCM d;  2EYX A;  1TU0 B;  3M4Y A;  3EG9 B;  1RI9 A;  3CCL T;  1KC8 C;  2MI6 A;  1VQ9 A;  1UGQ B;  3CBP A;  2NUZ A;  3EG1 A;  1Y57 A;  4IUV A;  1O75 A;  2ROT A;  1ZUU A;  1QQJ A;  2LMJ A;  2CH4 W;  3JB9 D;  1KSW A;  5CO7 A;  4RTY A;  1UHF A;  1ZSZ C;  1W1F A;  2DL4 A;  4OF1 A;  5LJ3 d;  1T0J A;  1I8F A;  2YUN A;  4KGV B;  2JTF A;  3X24 B;  2K6D A;  3LW5 E;  1Y96 A;  1M2O A;  1HSQ A;  1VQ6 A;  3CPW P;  5GLF A;  2E70 A;  4PFP A;  2YRV A;  4X1V A;  4PJO A;  2DAQ A;  4Z89 A;  2Q19 X;  4DQ2 A;  3EHR A;  3KFV A;  3MCA B;  2QTV A;  5CQY A;  3JB9 I;  1YJN A;  3SHW A;  2PVO B;  2ZCF B;  2KAF A;  2WSE E;  4IUP A;  1NEB A;  1C6V X;  4CC2 A;  4KDL A;  2DJZ A;  5LJ5 g;  2GTJ A;  2M9U A;  4ANJ A;  4FIB A;  4PJL A;  4DEY A;  1CZ4 A;  2K3B A;  3MEW A;  3TVT A;  1FWZ A;  3OMG A;  1YCY A;  4B9X A;  2FRY A;  4ME7 A;  2AZV A;  3CCQ A;  2RPN A;  2F69 A;  3UWN A;  3ULR B;  1Q7Y C;  1GRI A;  2FB7 A;  1UEC A;  3EGU A;  2OJ2 A;  4QQ6 A;  5KH6 A;  3HFN A;  2RHI A;  4JJD A;  4LDV A;  2FO0 A;  5I22 A;  4GBQ A;  1VQM Q;  4CRI A;  4J7I A;  2GBQ A;  3S3O A;  3OY9 A;  4M7A F;  4M77 F;  2DXT A;  1Q7Y R;  3CD6 Q;  2YRD A;  1K73 C;  1ZSG A;  4M7A G;  1RAA B;  2XDP A;  2RHU A;  4M77 G;  2CZ0 B;  5ECA A;  2XDB A;  2LJ1 A;  3EGX A;  1S1N A;  1AOJ A;  2PVD B;  4Z02 A;  4LDY A;  4AFQ C;  3QZ9 B;  2HD0 A;  2L5Q A;  3JB9 H;  4HXJ A;  1VQK A;  1QMC A;  3WVD B;  3QXE B;  4KGZ B;  3OYK A;  3LYI A;  3H41 A;  4JLG A;  1ZX6 A;  4C8Q F;  3L2R A;  1X43 A;  2DRM A;  3MJX A;  3P8H A;  4O5V A;  1K73 R;  2X4J A;  5GJV B;  1TUG B;  2JUF A;  2MM2 A;  3QYH B;  3CCE A;  5IXF A;  1QDN A;  3CCV A;  2EFI A;  4PKC C;  3PFS A;  1VQ4 Q;  1MUZ A;  3I56 A;  2X51 A;  5GAN j;  2X3W D;  3KUF A;  3JCM W;  5GAO n;  3EGD B;  1VQM T;  1VQL Q;  2DXU A;  4M75 F;  1WLF A;  1TS9 A;  3CD6 T;  1C1A A;  2E10 A;  4R56 A;  2DVJ A;  2DE0 X;  4M75 G;  2CYZ B;  2L3P A;  2DKG A;  3CC2 Q;  2R58 A;  2DM1 A;  3M0P A;  5KYX B;  2X4Y A;  3HHT B;  1WQW A;  1W6X A;  2CP7 A;  1VQ9 Q;  1UGP B;  5HY6 A;  4JZ3 A;  5GAN h;  5HK0 A;  1Y0M A; 
#chains in the Genus database with same CATH homology
 4M7D E;  2XI9 A;  3JCM e;  1KQ2 A;  3GIB A;  2LX9 A;  4M75 B;  1Q82 U;  2L8D A;  2QXF A;  3CCM A;  2VXE A;  4A53 A;  4F7U F;  3OYD A;  3MEU A;  1Q86 C;  1B34 A;  2JN0 A;  3PTA A;  2BIV A;  4JDS A;  4ARC A;  2E41 A;  2RA2 A;  3O8V A;  4OB1 B;  3G6E A;  4BE0 A;  2I2L A;  4KT0 E;  3OYM A;  3X25 B;  3OYH A;  3FIF A;  4M75 A;  5J26 A;  4F7U G;  1VQ7 A;  2VGM A;  2EQU A;  1VQ4 T;  1Y7X A;  3URG A;  2JZ2 A;  3RKW A;  1D3B B;  2K57 A;  3A5Z B;  4R55 A;  3L2U A;  2WAC A;  4IKF A;  3FRN A;  3V7R A;  3QC8 A;  1BI3 A;  2IVW A;  4EMG A;  2OTL T;  3HSB A;  3M57 A;  4OGE A;  5DYI A;  2OTJ T;  3LWI A;  1VQL T;  4E47 A;  3BW1 A;  5LJ3 e;  5DM7 R;  3CCR T;  2NLU A;  2GQV A;  5GAO q;  2RJC A;  4M7D F;  2LCL A;  2M16 A;  3UDC A;  1UEB A;  3L2Q A;  4FL6 A;  4N4I A;  1VQK T;  2EQJ A;  3LGF A;  1MHN A;  2DTI A;  4M7D D;  4RV0 A;  4C5H A;  4IUT A;  3L2W A;  4X9C A;  4F7U B;  2H3J A;  3JCM X;  1VUB A;  2LT4 A;  5J39 A;  3L2V A;  2XK0 A;  5GAN 3;  5CKE A;  4LDX A;  1KQS S;  2XG8 D;  5ERG B;  5DY9 A;  4A4K A;  3JCM c;  4QVD A;  2RHY A;  4N4G A;  3OQ5 A;  2HQE A;  3TEE A;  5GMK m;  2PUO B;  2RB6 A;  4DOW A;  2RH2 A;  2LRQ A;  4ZGE B;  5B6C A;  5A0G A;  3CBM A;  3PMI A;  2RJF A;  4QVZ A;  4Y28 E;  3OYY A;  1H3Z A;  3CCV T;  4FU6 A;  2AHJ B;  2DTO A;  1I81 A;  4J6Y A;  3CCS T;  2O4X A;  4OP0 A;  4NS5 A;  3CXC A;  3A8G B;  4C0D B;  3I56 T;  3LGL A;  3HU1 A;  4A4F A;  3GNG A;  3M54 A;  4ZGJ B;  4C92 F;  1KC8 U;  1NPR A;  1YIJ T;  3OYI A;  1KD1 U;  1VQ5 T;  2FHD A;  3LLR A;  4XU2 A;  3VUZ A;  4C0G A;  4M7D B;  1N27 A;  1X6O A;  4LDW A;  3V7S A;  5CQX A;  2IG0 A;  1NJI U;  1YJ9 A;  2ZPH B;  3FB9 A;  1JJ2 S;  4PJO E;  1G5V A;  3JCM f;  3RKX A;  4KLN A;  2A3L A;  2HNI A;  4JJN K;  3OSS C;  2DXB A;  3L1A A;  3HL8 A;  4C92 G;  2ZPG B;  3G4S A;  1N9S A;  2EKO A;  2PJH B;  2EJG A;  3G7Z A;  4A4E A;  3M53 A;  2VXF A;  5A0D A;  4HCZ A;  2RJD A;  4HCB A;  3HRT A;  3QJ6 A;  4A54 A;  4HKE A;  1I9G A;  2MAM A;  4KBM B;  2OAU A;  3CME A;  1VQ6 T;  3HRU A;  4LD6 A;  4EPC A;  2JOY A;  2DEQ A;  4C8Q G;  3G71 T;  1VIF A;  5GAM e;  3JSC A;  4MDW A;  1W2B S;  2RHX A;  1XQH A;  1WQ7 A;  4M7A A;  2VGN A;  1MGQ A;  5HKC A;  3CXC S;  2LTO A;  4M77 A;  1LNX A;  4O6J A;  3SFM A;  3H8Z A;  1YJW A;  3JRZ A;  1YI2 A;  4HT9 A;  4IUR A;  1Y07 A;  1EIF A;  4EMK C;  3MP8 A;  4Q5W A;  3QDR B;  1S72 A;  1QCS A;  5LJ3 f;  5FU6 C;  4C92 B;  4KDI A;  5FTJ A;  2MWO A;  4PNO A;  4BY6 C;  2LNV A;  4JRK A;  4XAX B;  4PJO F;  1QVF S;  4OMF B;  2LQ8 A;  4MDX A;  2RI5 A;  2Y4Y A;  2QQ9 A;  2CZ6 B;  3OMC A;  3L42 A;  4D6W A;  3OW2 A;  3VJP A;  4PJO D;  3CCM T;  5D6Y A;  1QVP A;  4PLL A;  3C12 A;  3G6E T;  3HU2 A;  3BQB A;  2LCC A;  3L2Z A;  2Q1C X;  3HU3 A;  4M78 A;  4B9W A;  4BE1 A;  3CCJ A;  1N6A A;  2ZPB B;  4QW2 A;  1VQ7 T;  5EQJ B;  3WXM B;  1NPP A;  4JS4 A;  5HK3 A;  4C8Q A;  1E32 A;  2CS7 A;  3JCM g;  3RMS A;  5A0L A;  1CR5 A;  4A4G A;  1ZHI A;  5GMK l;  2LT1 A;  5CR2 A;  1XNI A;  2YLC A;  3QG1 A;  4BDY A;  4EDU A;  2PWY A;  5EPP A;  4ZN1 A;  1M5Q 1;  2O01 E;  4C5E A;  1Y96 B;  3FDR A;  2RHZ A;  4MML A;  2QQA A;  1S3S A;  3KBG A;  1G3S A;  1QP3 A;  2LDM A;  3RUX A;  3OYN A;  3OYC A;  5CKH A;  1ZBX A;  2QQB A;  3X26 B;  3TIW A;  4PJO B;  1U1T A;  2HAX A;  2E6N A;  4ATO A;  2A7Y A;  3N5B B;  1YHQ T;  3OW2 S;  1Q7Y U;  1K8A C;  1R7R A;  2ZZD A;  3OYF A;  4CI0 C;  4J5Y A;  1JRI A;  1RL2 A;  3OSV A;  2KSS A;  2E6Z A;  2XHC A;  3M56 A;  3M58 A;  2D9T A;  3QHS A;  3EAE A;  3JCM J;  1SSF A;  3CCU A;  5GAN e;  3CCL A;  1KG1 A;  2HQX A;  4MZP A;  2DIG A;  2KMT A;  3FLG A;  2M1H A;  4LDU A;  3RMQ A;  3SWN A;  4RG8 A;  4RMO A;  3DLL A;  2K4Y A;  5LJ3 g;  2V8I A;  4UC4 A;  5C1B A;  1ZC1 A;  4JS5 A;  1VQN T;  5GMK i;  4QQG A;  2K5L A;  1KQS A;  3CPF A;  4X34 A;  5GAO r;  2KDS A;  1WJS A;  4NL2 A;  3OBY A;  4ZTF A;  5GAM f;  2PUK B;  3ZGZ A;  1HXD A;  1YIT A;  3PNW C;  1VQM A;  4VUB A;  3QSU A;  1QVG S;  4ELY C;  2DIQ A;  2LQK A;  4OGC A;  4PL6 A;  5GAO p;  2K3X A;  5GAN 2;  3A8M B;  3M59 A;  3SD4 A;  5CKD A;  1H64 1;  3CC7 T;  3VKI A;  3PIP A;  5AYF A;  1K73 U;  3ZEH A;  4FM4 B;  1D3B A;  3CF2 A;  1UGR B;  2RI2 A;  3E9F A;  2LVM A;  3ER0 A;  3Q1J A;  3GNF B;  4QQD A;  5C18 A;  4WF2 A;  1M1F A;  3A8O B;  2QEX A;  1IZ6 A;  1K9M C;  5A2Q E;  4M77 E;  4BE2 A;  3I55 A;  3BY7 A;  4E7I A;  3FPT A;  3OYG A;  3KXT A;  4HCC A;  4M7D G;  2DO3 A;  2XU8 A;  1M4Z A;  2DD5 A;  1G3Y A;  3QJY A;  4KUL A;  3GOX A;  4RG2 A;  1OZ2 A;  1VQ8 A;  2QA4 A;  3NTH A;  3CME T;  1BI0 A;  2PQW A;  5DLQ E;  5C6S A;  1Q82 C;  5LJ5 e;  1VQO A;  3ZFJ A;  4F7U A;  4MZM A;  2WSC E;  3DKM A;  4DA4 A;  5FU7 C;  3OYJ A;  1Q81 U;  2EJF A;  3INZ A;  3CCE T;  3FPR A;  3QWZ A;  5GAM d;  2JVV A;  2YLB A;  2CGH A;  2DVE A;  3V7C A;  1W2B A;  4N0A A;  1G3T A;  1X75 C;  2GFA A;  2VUB A;  3A8L B;  3VU3 C;  1YJW T;  1YI2 T;  5IAY A;  3OYB A;  4XTY A;  5GAM j;  5FRO A;  4E7J A;  3GPL A;  3C4S A;  1N8R C;  5CD1 A;  4M78 E;  5LL6 S;  4M7A C;  3E9G A;  1XOV A;  2C06 A;  3M4G A;  1OZ3 A;  3JCM b;  4M77 C;  1M1K U;  2EIF A;  3NTI A;  5L8R E;  3DLM A;  4XTZ A;  2RI3 A;  3CC4 A;  1XTD A;  3JCM V;  5GAM g;  3PIO A;  1U8R A;  1QVF A;  4M7A D;  2KVQ G;  1UGS B;  2R5M A;  4M77 D;  4C5G A;  5HK0 A;  1Y71 A;  1P92 A;  5EG2 A;  3RKY A;  3ZBD A;  4M7D A;  2DZ9 A;  5GAN f;  2D6F A;  3E1S A;  1M90 U;  4LD9 K;  3C94 A;  1KHI A;  2QI2 A;  2EAY A;  3CCJ T;  1N9R A;  5FRN A;  2Y90 A;  3CPW S;  2GF7 A;  2OTJ A;  1BIB A;  4XU1 A;  3F70 A;  5IT9 E;  1WNL A;  1W4S A;  2F5K A;  3CBO A;  3OA6 A;  1FX7 A;  4HT8 A;  3AHU A;  2Q18 X;  1G3W A;  2MMP A;  2YUJ A;  4KUD K;  3RIR A;  3QPH A;  2BUD A;  1VQP T;  4M78 C;  3EFR A;  2ZPI B;  1QP2 A;  3V8J A;  3OS2 A;  2BKD N;  5CCX A;  2CKK A;  4RCC A;  2KQW A;  3BDL A;  4C8Q C;  4M75 E;  3MB5 A;  4V2S A;  1R8O B;  2YHT A;  5FLX E;  2Q1D X;  2RJE A;  4M78 D;  5CKF A;  4RCB A;  3VYG A;  4GLK A;  5GAM h;  2XDD A;  2DXC A;  2JTM A;  2QQR A;  3S6W A;  2X4X A;  2YVL A;  3CC2 A;  5GAN 5;  4JUV A;  3TRE A;  3OB9 A;  2GFU A;  3TCJ A;  2PU9 B;  3MO8 A;  3M5A A;  3LX7 A;  3JCM d;  2M0O A;  1JBM A;  3M4Y A;  4L5G A;  5CIU A;  2B8A A;  3CCL T;  4FSX A;  4C92 A;  1KC8 C;  3RER A;  1BKB A;  4PJO G;  5GAN 4;  2MI6 A;  3WVE B;  2B25 A;  1JJ2 A;  1VQ9 A;  1NJI C;  4NL3 A;  1BIA A;  4NOY A;  1UGQ B;  5CCB A;  2RD1 A;  3CBP A;  1K8A U;  4MZT A;  3J7A F;  2XKO C;  4BD3 A;  5LJ5 f;  4E7H A;  3VUB A;  5KCH A;  4ARI A;  4IUV A;  1O75 A;  3SWN C;  4IUU A;  1Q86 U;  1TH7 A;  1YIJ A;  1YIT T;  5GMK e;  1VQ5 A;  1GXI E;  3JB9 D;  1IRE B;  4HA8 A;  2JV2 A;  5DLO A;  5CO7 A;  2DPP B;  2P0P A;  4M75 C;  3GF5 A;  4PLI A;  5KE2 A;  1AHJ B;  4XK8 E;  4XTX A;  5GAN g;  1QVG A;  3DB4 A;  3V8K A;  3JCM P;  4OF1 A;  1V29 B;  4KUI A;  2DTH A;  5FTK A;  4EMK B;  5LJ3 d;  2LC4 A;  3ASK A;  4M75 D;  3OYA A;  3FPU A;  2K5I A;  5FU6 B;  4EMH A;  4BY6 B;  1I8F A;  3X24 B;  4BI3 A;  2JTF A;  4J83 A;  2QEX T;  3LW5 E;  1Y96 A;  5LJ3 j;  1VQ6 A;  3MET A;  5GLF A;  2E70 A;  2YRV A;  2E65 A;  4PJO A;  5J3B A;  3BDU A;  1VQ8 T;  2FVU A;  3M9Q A;  2QA4 T;  2FL7 A;  2DAQ A;  1JB0 E;  2E1H A;  5GAN 6;  3J81 E;  1VQO T;  3CMA T;  3JCM h;  1K9M U;  4FT2 A;  3P8D A;  4OB3 B;  5D6W A;  5LJ5 d;  2Q19 X;  4DQ2 A;  1QW1 A;  2R57 A;  3MCA B;  1B34 B;  5CQY A;  4AQ7 A;  3JB9 I;  1YJN A;  2PVO B;  3DB3 A;  5LJ5 j;  1I4K 1;  2ZPE B;  2ZCF B;  4OB2 B;  3V8L A;  3H6Z A;  2RK1 A;  2KAF A;  2WSE E;  2QTX A;  2KK4 A;  1UB4 A;  4IUP A;  2RO0 A;  2VV5 A;  4GY5 A;  5FTN A;  5CVI A;  2XID A;  4XTV A;  1BYM A;  4KDL A;  2DJZ A;  3CC4 T;  4N0A C;  3QQ8 A;  3MP6 A;  3CD6 A;  5LJ5 g;  2X35 A;  2M9U A;  4JRP A;  1NE8 A;  3MP1 A;  1YJ9 T;  4FIB A;  4M7A E;  1CZ4 A;  3RES A;  1O54 A;  3MEW A;  2QDY B;  1FWZ A;  1LJO A;  3G4S T;  3OMG A;  1YCY A;  4N4H A;  4B9X A;  5KCO A;  1N8R U;  4ME7 A;  5LJ3 h;  3CCQ A;  3UT1 A;  2F69 A;  4J6W A;  3UWN A;  2MM0 A;  1WPY A;  4BAC A;  2FB7 A;  1Q7Y C;  4CQN A;  1NZ9 A;  4C0D C;  2EWN A;  2P0K A;  3MEA A;  1DJ7 B;  4OB0 B;  2DD4 A;  4A4H A;  3QKJ A;  3QQ7 A;  4QQ6 A;  5KH6 A;  4M7D C;  3X20 B;  3HFN A;  3X28 B;  2ZGW A;  1WJQ A;  2RHI A;  2DZC A;  3CPW A;  3NTK A;  4QVC A;  3BFM A;  4C0Z A;  3HPW A;  4XTU A;  4C92 E;  3CMA A;  3QII A;  5IN1 A;  1YHQ A;  4LDV A;  4Y91 A;  4C5I A;  5I2M A;  3T9N A;  1M8V A;  3E19 A;  3VV0 A;  2E5Q A;  1S72 T;  5LJ5 h;  4CRI A;  2LW6 A;  4J7I A;  4ZGD B;  3S3O A;  3OS5 A;  1M9S A;  4BI8 B;  3OY9 A;  4M7A F;  5M9O A;  4J7F A;  4C8Q E;  1ZQ1 A;  5CKB A;  5GAO m;  5D6X A;  3CC2 T;  3MEV A;  4M77 F;  1WGS A;  2ZPF B;  2O4X B;  3TU4 K;  1VQN A;  2DXT A;  4KO8 A;  4OVA A;  3OS0 A;  2RK2 A;  4XTW A;  3OS1 A;  1K73 C;  5DYG A;  2L3R A;  4M7A G;  3FC3 A;  3LHD A;  4JRQ A;  3PT9 A;  1VQ4 A;  3OBW A;  1VQ9 T;  2XDP A;  2RHU A;  2RM4 A;  4M77 G;  4JLI A;  3ZJT A;  1HK9 A;  2CZ0 B;  1OI1 A;  2XDB A;  3JCM Q;  4MMK A;  4C92 C;  2OTL A;  5I2S A;  2PVD B;  4Z02 A;  4L59 A;  1VQL A;  4LDY A;  4XU3 A;  2XD0 A;  2XIC A;  3PMT A;  1LOJ A;  3QZ9 B;  2K3Y A;  1RI0 A;  3SB2 A;  3CC7 A;  3A8H B;  3CCR A;  5FTL A;  4J6X A;  2MWP A;  2HD0 A;  4IUQ A;  2L5Q A;  5FU7 B;  3UPU A;  2Q1A X;  2KY9 A;  4BI4 A;  3SDZ A;  3VYH B;  3JB9 H;  3QZ5 B;  4C92 D;  1VQK A;  3QUI A;  3WVD B;  3MHX A;  3QXE B;  4M78 F;  3OYL A;  1I5L A;  5GMK j;  3OYK A;  3LYI A;  1YBY A;  1Q81 C;  3S3M A;  4J8O A;  4JLG A;  1KHC A;  4DOV A;  4C8Q F;  2EQM A;  4M7A B;  3GLX A;  4C0F A;  2VYT A;  3QO3 A;  1OYX A;  3P8H A;  4O5V A;  3L2R A;  2X4J A;  4M77 B;  2D0Q B;  1PSE A;  4M78 G;  3HKS A;  4C8Q D;  2P0Q A;  2MF2 A;  4X9D A;  4L6V 5;  3LGA A;  4BB7 A;  4E7L A;  1BI1 A;  3CCU T;  2V8K A;  4RKU E;  1KD1 C;  2JUF A;  1M1K C;  3LWH A;  3QYH B;  2MM2 A;  5C0M A;  3M55 A;  3CCE A;  1QDN A;  3HFO A;  4TVR A;  2EFI A;  5GAN d;  5GAN 7;  2EJ9 A;  3HP9 A;  2K2V A;  2GCX A;  4PKC C;  3CCV A;  3R6O A;  3PFS A;  3CCS A;  1CZ5 A;  1WJR A;  3LH0 A;  2CZ7 B;  3I56 A;  5GAN j;  3JB9 F;  2E64 A;  3KUF A;  2WSF E;  5KE3 A;  3JCM W;  4PJO C;  5GAO n;  3CCQ T;  2CZ1 B;  2EQK A;  4JRI A;  1YJN T;  1M90 C;  1VQM T;  4KOD A;  2DK3 A;  4BDZ A;  1M1G A;  2DXU A;  1PSF A;  3C95 A;  3JB9 J;  3JB9 G;  4M78 B;  3CEY A;  4M75 F;  2R5A A;  4ZTJ A;  1WLF A;  2HBP A;  2P4T A;  2X4W A;  4XQ3 A;  5I21 A;  4C8Q B;  3NFC A;  4XU0 A;  4F7U E;  3CD6 T;  2K5F A;  2Y4X A;  4ZN3 A;  2G3R A;  4BUG A;  2L89 A;  2E10 A;  5GAN 8;  5GMK h;  4R56 A;  2EYQ A;  3QYG B;  4ELZ C;  4M75 G;  4AS1 A;  2CYZ B;  2VC8 A;  3I55 T;  1KQ1 A;  3J80 E;  2JNG A;  3S3N A;  2DKG A;  1X01 A;  4EMK A;  2E12 A;  5GAO l;  2R58 A;  2V8J A;  4P5N A;  2QQS A;  4II1 A;  3GP8 A;  3G71 A;  1BI2 A;  1FXX A;  4FT4 A;  2X4Y A;  5CK9 A;  4E7K A;  1VQP A;  4YTL A;  3ME9 A;  3HHT B;  1U1S A;  3FEO A;  1WQW A;  1O9S A;  3JAM E;  5FRM A;  3EFS A;  3FJP A;  1VIE A;  5CAI A;  2FYK A;  5FTM A;  1UGP B;  5HY6 A;  3P8B B;  3ZJV A;  5CCA A;  3ZJU A;  3HRS A;  2F5T X;  3PGG A;  3OYE A;  5GAN h;  2PVG B;  3SWN B;  3QBY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...