4FIBA

Crystal structure of the ydhk protein from bacillus subtilis. northeast structural genomics consortium target sr518a.
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
123
structure length
123
Chain Sequence
MKVGSQVIINTSHMKGMKGAEATVTGAYDTTAYVVSYTPTNGGQRVDHHKWVIQEEIKDAGDKTLQPGDQVILEASHMKGMKGATAEIDSAEKTTVYMVDYTSTTSGEKVKNHKWVTEDELLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the ydhK protein from Bacillus subtilis.
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Structural genomics, unknown function
molecule keywords Uncharacterized protein ydhK
total genus 23
structure length 123
sequence length 123
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07563 DUF1541 Protein of unknown function (DUF1541)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.1130 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4fibA01
3.10.330.60 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4fibA02
4FIBA 2KY9A
chains in the Genus database with same CATH superfamily
3BDLA 2CYZB 3DB3A 1K9MR 1LCKA 2CUDA 3EG0A 1PM3A 3CC4Q 1NEBA 4DOVA 3OYDA 4J9CA 3CXCP 4CI0C 2KROA 4QVZA 2PTKA 3G71A 1KIKA 2LW6A 4C92G 2FPEA 3OS1A 4LD9K 5C1BA 3A8OB 5CCXA 1QWFA 2J06A 4GBQA 4ESRA 3C95A 2I2LA 3CCMT 3SWNC 1MV3A 4OMFB 2RJCA 1TSFA 2KI7A 2XHCA 4LDVA 1RI0A 5KYYB 4HCKA 4A4GA 1PSEA 2IIMA 4M78B 5FU6C 3VV0A 3E1SA 1ZHIA 1QVGA 4E6RA 1Q82R 4XU0A 3I5SA 5EC7A 3CCRT 3X24B 3PVQA 3HRTA 1VQ7T 4KUDK 1B34A 1ZUKA 2XG8D 2L3QA 4PFPA 2M1HA 3CC2A 2F2XA 1WHKA 2RD1A 3PVLA 2YRVA 3LWHA 4ELYC 3EHQA 3NFCA 2ABLA 2XI9A 4HXJA 3PGGA 2RQVA 4M78G 4DEXA 1N9RA 1M9SA 2XKOC 3SB2A 4HCCA 4AG2C 1VQ7Q 1BI0A 4EMGA 2CP5A 2O9VA 2F5KA 2MF2A 2MAMA 4LN2A 1KHCA 3CCVT 2FPFA 1BBZA 4L6V5 3NTIA 5FTLA 1QKWA 2C0OA 5I2MA 5CKDA 2OAUA 2EW3A 2AKKA 4RCBA 3OYEA 1X75C 1IZ6A 4XQ3A 2I0NA 3PT9A 3G71T 1UDLA 4XTVA 3UPUA 3CMAQ 1WXTA 1VQ6Q 4QVDA 1QW1A 1TG0A 1FMVA 1D1CA 2O88A 3BY7A 1VQKA 3M0QA 2NYSA 2X4JA 1GBQA 4J9EA 2EQJA 4M7DE 1CSKA 4IURA 1OQKA 1O75A 2MM0A 1C6VX 3EH1A 5EG2A 3VU3C 4J7FA 5LJ3e 3OY9A 3PE0A 3EFOA 1QCNA 1X27A 1W2BS 1XOVA 1Y0MA 2JTFA 1OI1A 5GAOr 1KSWA 1VQMA 1I5OB 3CBMA 3A1PA 1AT1B 4M7AE 1H641 3RKYA 3DKMA 4PKCC 2ZPHB 2AIRB 2OI3A 1V76A 4J9GA 3M56A 4FYXB 4O5VA 2E5QA 2KXDA 3EG2A 2K4YA 4LE9A 1VQPQ 5GAN4 3H0FA 1M3CA 5GAN3 2ROTA 3OS2A 4Z89A 2CSIA 4BB7A 1S72Q 3OYNA 5A2QE 3CD6T 1HXDA 2QEXQ 1PC0A 2VWFA 2BZXA 3C4SA 1HJDA 1NEGA 2KAFA 2YLBA 3CCEA 1NJIC 1BKBA 2EJGA 2PWYA 2HNIA 5IN1A 4JZ3A 2RQUA 2YSQA 5FLXE 4K11A 3VRZA 5DYGA 5EPPA 1PD0A 1IGUA 4E47A 2PU9B 3OYKA 1VQ6A 2HSPA 2DYIA 1OEBA 4AT1B 2CH4A 2LJ1A 4BDYA 4KLNA 5KE2A 4JRPA 1B34B 3MEUA 2DL4A 1UG1A 4JJCA 2E64A 4XK8E 1VIEA 3PTAA 1D3BB 2LQNA 1OOTA 1GCPA 2DZ9A 2JTEA 2P84A 3TSWA 3PMTA 4R55A 2C06A 1E7OA 1N6AA 1NG2A 4FSXA 3MHXA 4N4IA 2JT4A 2KVQG 2QEXT 1VQ7A 5GMKl 3VS6A 4QKUA 2XICA 4F7UG 3ZEHA 3OYHA 3CCRA 3X25B 1QVFS 3WXMB 2HDAA 1LVKA 2WSEE 2FZCB 3ULRB 2LCSA 3E19A 5LJ3h 3VS7A 1AWXA 4E2FB 2Y90A 2HKQB 1S1NA 2O01E 1NPRA 3MCAB 5HY6A 4PFOA 3L2QA 2H8HA 2FPDA 4DEYA 3CCMA 4CC4B 2RI2A 4BE2A 2K57A 4C92F 3X26B 1X6BA 1UGQB 5GMKm 3V7RA 4KBMB 1Q95G 2V1QA 1ZQ1A 3L1AA 3VS1A 2CP0A 2EGCA 2DEQA 3CF2A 1YI2A 4BD3A 2WSFE 1T0JA 1WQ7A 1PWTA 2O31A 4OMPA 2YWWA 4ME7A 5I22A 3CCQQ 2M51A 1TUCA 3REAB 4KT0E 3ZJVA 5FTMA 2EWNA 1N8RU 2HL5C 1N9SA 3L2VA 2A28A 1AWOA 3JCMQ 2RHZA 2QA4Q 1UGVA 3I5RA 1VQMQ 2BUDA 1I0CA 1KC8C 3QC8A 3EG3A 3Q1JA 1RACB 5FRMA 1K73R 2DXTA 4FIBA 5IHIA 3HFNA 4LNPA 4DA4A 3OSVA 4Y91A 4KULA 5D7UA 1RLQC 4QVCA 5L8RE 4N4HA 2QQBA 4RTXA 4KODA 2X9HA 1EFNA 1FWZA 1HYOA 2E3IA 5CIUA 4JS5A 1Y96B 1VUBA 2ATCB 2JS0A 3EG9A 3RKXA 1B3QA 1ZUUA 2P0QA 1W1FA 3INZA 1D0YA 2FRWA 3MP8A 2G3RA 4FW1A 2YLCA 3JCMb 4M78A 3VS2A 3N5BB 2DTHA 5EQJB 2HD0A 3LHDA 3LGAA 1P92A 3FRNA 1OULA 3CPWA 1FX7A 2EYWA 1ZBJA 2AHJB 1VQLA 3LH0A 1SF9A 2LQKA 1QVFP 1RAFB 3FJPA 3META 2NUZA 1AWJA 2KY9A 1Q82U 1YI2T 4IUTA 3AHUA 3G7ZA 1JQQA 2HQXA 5LJ5d 1QLYA 3RMQA 5IXBA 2ED1A 4XAXB 2ESWA 1G8XA 5DYIA 2E10A 3LW5E 2WACA 4J6YA 4R56A 1G5VA 1K8AU 3NPFA 2CP2A 3OYBA 2L89A 5D6WA 1UJYA 1WIEA 3GNGA 2GGRA 2YUPA 3J81E 4BY6B 3C0CA 1Q82C 4FYVB 5AYFA 2NUPB 5C0MA 3ZGZA 4AFQC 2DL3A 5GAN5 3QPHA 1T3SA 2V1RA 1YIJA 1ZSZA 2DNUA 1VQLT 1NPPA 4BY6C 3J7AF 3OYCA 4FW2A 4C0DC 2C0IA 4EMKB 2D6FA 4JJNK 2DM1A 3QWXX 3CCMQ 2EPDA 1WXUA 4JJDA 4OVAA 2EJFA 2DE0X 2QG9B 3I9QA 4J6XA 1UHFA 3NHNA 2M0OA 2XDPA 2H3EB 3HFOA 3RR6A 1KJWA 3QZ5B 4F7UA 1HD3A 4LXCA 4MZPA 4ZNXA 4OF1A 2RHYA 2DXCA 1M3AA 1XTDA 4MDWA 4DBRA 3G6EQ 4PJOA 1VQKQ 2CZ7B 1OX8A 5HK0A 1WDXA 5GAMd 2K3XA 2ZZDA 1WGSA 4RG8A 3GP8A 4C8QF 3CPWP 2KT8A 5LJ5f 2RHIA 4GY5A 3OYLA 2EQIA 3VS4A 1K9MC 4KGVB 1PG5B 2KT1A 2RQRA 1KD1C 1QVFA 4M77C 2P4TA 3FDRA 1M5Q1 1WJQA 2RI5A 4A54A 2B25A 3V8JA 1N8RR 5GMKi 4B6MA 3CCJQ 1OPKA 1WLFA 2RK2A 4QQGA 3CMEQ 1VQOQ 2DXBA 3G4SQ 2RN8A 4C8QA 1RI9A 3LWIA 2DERA 2K6DA 4QQ6A 1Q81R 1FYNA 5GMKh 1PHTA 5FTNA 5CKEA 2GQIA 2Q19X 2AZVA 5FU7C 4PJOC 2QGFB 1ZLMA 3JCMf 2IPOB 3CPFA 3JCMW 5GAOn 3CMET 1NLOC 1VQMT 3G1JA 3MP6A 1LOJA 4M75C 1K4US 3I55T 2KSSA 1MGQA 1U3OA 4ZTFA 3EG1A 2F2VA 3OMCA 2HSEB 5FWCA 3DLLA 1ZA2B 1M1KU 1VQ5Q 2LDMA 2CP3A 1TXQA 4ZTJA 1IHVA 3ZJUA 1TH7A 2RQTA 2Y4YA 4M7DF 3FJ5A 5LJ5j 1RADB 3HPWA 3V8LA 5KE3A 3HTRA 4OGCA 5LJ5g 3TEEA 2E6NA 3CMEA 1QVGS 1TUGB 1Q86U 2KMTA 1WZOA 4ZN3A 2FZGB 2DIGA 2EQUA 2RJEA 2X4WA 3CBPA 2DD5A 1KQSS 5FROA 5GAOp 2QA4A 2PQWA 2DETA 1IXDA 2EAYA 1WA7A 1PNJA 3M57A 4DOWA 4AMCA 3QIIA 1Q86R 1LJOA 4XTXA 1GL5A 2DL7A 3R6NA 2ZPGB 2MM2A 1Z9QA 4RTUA 1UGRB 2JNGA 2HAXA 1TOVA 1R0CB 2V26A 4C0DB 3JCMc 5GAN8 2K3BA 1V1CA 2D8HA 2M9UA 1QCSA 1JO8A 5CD1A 2ZPFB 4RTZA 2RA2A 3FB9A 1MHNA 2K7AA 1YIJQ 3HRSA 2E65A 2NUTB 3JB9D 2XK0A 1VQPA 3GIBA 2PVOB 1WJRA 2CT3A 2F1LA 3JB9G 1T3LA 3SFMA 5CR2A 3CC2Q 4GLKA 4F7UB 1W6XA 5KYWA 3CCLQ 1M90U 2AKLA 3AT1B 2GF7A 2D0QB 3L2WA 1QQJA 2XMFA 3EAEA 5GAN2 3TSZA 2VYTA 4C92D 1Y07A 3M0UA 1LPLA 2RF0A 2D8JA 5LJ3j 1U06A 5GAOq 3OS5A 5L23A 1WI7A 4FSSA 2KEAA 2VB6A 2YRCA 3JCMJ 3QUIA 1AVZC 1SKUB 1BIAA 3QYGB 1JJ2P 4AFZC 3KFVA 2OTLA 4ATOA 5FTKA 4FU6A 3CMAA 2JV2A 4ANJA 3OYMA 4M78F 2JOYA 2RHUA 5GAMe 2PJHB 1KD1U 2RM4A 3NGPA 1YITQ 1HK9A 2PVGB 1VQLQ 3OBWA 2IVWA 5D6YA 2JM9A 2AT1B 4C92E 1SHFA 1Q7YR 2RPNA 2QK0A 4HVUA 1I1JA 3CCUQ 2QAZA 1SEMA 2HZYA 2ZGWA 1EZZB 4HVWA 4JJBA 1ABOA 1X01A 3PFSA 4X9DA 2NWMA 3JB9J 3F70A 3FLGA 1M3BA 2JUFA 2D0NA 3JSCA 2E4HA 4N0AA 3FPUA 3EGUA 2RHXA 4BE0A 2X35A 2CGHA 2OJ2A 2VKNA 3EFSA 4N0AC 2K3YA 2Q18X 2DILA 1VQ5T 1G3SA 2A36A 2DRMA 5GAMg 5CO7A 3UT1A 3JB9I 3EGXA 2QQRA 3L2RA 4IUPA 1QMCA 1IO6A 1AOJA 1M30A 3WVEB 2COYA 3M4GA 2HCKA 4X9CA 1YHQA 3OYIA 4GLMA 3CC2T 3MKDA 2A0FB 4L59A 3JAME 2O4XB 2CSQA 3VYGA 5KCHA 4CQNA 4CC2A 2EYQA 1JJ2A 1D0XA 3JCMe 3I56T 2GFAA 3EHRA 4B9XA 1E6HA 4Y92A 1BIBA 3H9NA 1VQOT 2K79A 3RKWA 3CXCS 3H0IA 3NTKA 2DXUA 1QCOA 1YNZA 3A8GB 3GPLA 2L5QA 5FU7B 1N27A 4PJOB 3OYYA 4AS1A 1RUWA 2YT6A 1KG1A 5GAOm 2LRQA 1KK7A 3FEOA 2VC8A 1YFNA 2DIQA 2FHDA 3URGA 5IHKA 4BDZA 3HHTB 2A3LA 2MI6A 3HP9A 5GANh 1VQNQ 2KBTA 3JCMV 1TWBA 4A53A 5FU6B 4II1A 3G71Q 1YITT 1B7TA 4M77B 1JBMA 1VQ8A 3NTHA 3QWYA 1BYMA 1FMKA 2DF6A 2P0PA 4N4GA 4A4FA 2JZ2A 2GQVA 3CCVQ 3QDRB 2W10A 3CCST 2L3PA 2MWPA 2DVEA 1PSFA 3GBQA 2EQKA 3LGFA 5FRNA 1PKSA 1TS9A 1FXXA 1UE9A 2PUKB 4E7SA 3HSBA 1S3SA 3CCQA 2CH4W 2YVLA 2LVMA 3H41A 3D7SB 4DBHA 5DM7R 3L2ZA 4ZGDB 2FB7A 1YJNQ 3M5AA 4HCZA 1NM7A 1WHHA 2F69A 5IXFA 1RLPC 4DBFA 2OTLT 4C0GA 5CCAA 1MNEA 2DMOA 1I81A 3FC3A 1BCOA 4IKFA 1CKAA 4M7AF 3NMZC 4Z88A 1JEGA 3G4ST 1JB0E 2NUPA 3GF5A 5HKCA 3QWZA 5CCBA 1UB4A 2FEIA 1UUEA 3ZFJA 2KRMA 4X34A 5GAMj 4KDLA 1VQOA 5GJVB 1BK2A 1X2QA 2E41A 2D1XA 2LNVA 1IRXA 2HQEA 1M4ZA 2MCNA 2X4XA 3LLRA 2EGAA 4OMLA 1F1BB 3CC7T 3IQLA 3LX7A 1JXOA 2L3SA 3A8LB 2E3HA 1C1AA 2KRNA 1KHIA 4Z02A 4J5YA 4M7AA 3T9NA 1VQ8Q 3JRZA 4C8QE 4BI8B 3CCET 1XNIA 2CZ6B 4YTLA 1W2BA 3EGXB 2DD4A 4NOYA 4M7AD 1YN8A 1VQNA 5LJ5e 2LMJA 3CC4A 2J6KA 1VQ5A 2LT4A 2LZ6B 5GANe 2M02A 1XJWB 3VUBA 5KH6A 4PK4A 4M7DD 3I56A 4FCYA 5HCKA 5GMKj 4EPCA 2XDDA 4JDSA 2LQ8A 1R8OB 2CT4A 1ZA1B 3RUXA 1D1AA 3SEMA 1JU5C 1UGSB 2GCXA 3VKIA 1YCYA 1N5ZA 4M75B 1YITA 2EQMA 4BI3A 1HSQA 3HU3A 3DB4A 3PIPA 2Q1CX 4JZ4A 3EG9B 4RTWA 5A0GA 2OTJA 2KK4A 2X4YA 2FYKA 1U8RA 3QZ9B 1ZX6A 5ERGB 7AT1B 1O54A 2R57A 3BQBA 1WHGA 2MPXC 4A4KA 2PVDB 1YJ9T 2M0YA 4RTTA 4XTZA 1H92A 1VYUA 1M90R 1K73C 4ARCA 3CEYA 4F04B 2BZYA 2A08A 1MV0B 4PJOE 1YJNT 5B6CA 1IGQA 2GFUA 4CRIA 4M78C 4C8QD 2K2MA 3EFOB 1VQ9T 2MIOA 4D8KA 1GBRA 5GAN6 4J9BA 5GANj 3MP1A 3SWNB 4M75E 1RAGB 2K5IA 5IAYA 1GRIA 5LJ3d 4HA8A 1BI3A 4XU2A 4LUEA 3CCVA 1GCQA 2KQWA 1W2BP 2JXBA 3HKSA 2E6ZA 4OMQA 4HKEA 4EDUA 1AWWA 4RCCA 3TIWA 2CZ0B 3CC4T 1SRMA 1H3ZA 2OTJT 2V8JA 2H3JA 4HT8A 2LCCA 2A37A 5LJ5h 2QDYB 1K8AR 2SRCA 2KR3A 1OZ3A 2JS2A 4M7DG 4WF2A 1WYXA 1NYFA 1RAEB 2QQ9A 2BTTA 2X3XD 1JRIA 1VA7A 2LJ0A 3J80E 3I55Q 3C94A 1X6GA 3EH2A 4EMKA 4ZGEB 1CZ4A 1WJSA 2MK5A 8ATCB 2DLPA 2MMPA 4Q5WA 3VUZA 4EMKC 4CC3A 1M8MA 2K2VA 4F7UF 5A0LA 2Z0WA 3S6WA 2QQSA 2CZ1B 4MZMA 2ED0A 3CCJA 2NLUA 1NZ9A 2ROLA 1VQ9A 1I8FA 3TQ7P 2DL5A 2M16A 4ORZA 4E7IA 2BE7D 1QDNA 4RUGA 1VQNT 3M59A 4ARIA 2XU8A 1OZ2A 3OB9A 3OMGA 4E7LA 2LX9A 2AZSA 2YDLA 4M77F 1YJ9A 1I9GA 1WHMA 4M7DA 1ZSGA 2J7IA 4KO8A 2OAWA 1FMWA 4OB0B 3REBB 5LJ3f 2QTVA 2COZA 3UWNA 2J6FA 3U23A 2LTOA 1NJIU 3ASKA 3QQ7A 3QBYA 2ZCFB 4KUIA 1NYGA 4WCIA 1UTIA 1K1ZA 2E1HA 4ELZC 1N8RC 3S3NA 1TUDA 1UECA 3QDFA 3RBBB 5KCOA 3V7SA 2EKHA 4M78E 2VGNA 4BACA 1AZGB 3BW1A 3OW2P 1WXBA 5D6XA 1CR5A 3MO8A 1UFFA 5GAN7 4RKUE 3CCRQ 5DLOA 3A5ZB 3CCJT 3PNWC 2DO3A 2VVKA 2GTOA 2DL8A 1VQ9Q 4EMHA 1MMNA 1RL2A 5KYUB 3HU1A 3QKJA 1YI2Q 2QASA 1UHCA 3JCMg 2DTOA 3CPWS 2CP6A 4X1VA 3VRYA 1G83A 4A63B 1Q7YU 8AT1B 4O6JA 2O2OA 4J6WA 4C92C 1YJ9Q 4M75G 2V8IA 2HL3A 4MZTA 3UA7A 3M0SA 3I35A 2JW4A 3KBGA 1UJ0A 2YHTA 3GNFB 4M7AC 5I11A 4PJOG 4RTVA 3CCEQ 1VQ4A 4NL2A 2RNAA 1VOMA 3RNJA 1QCFA 1Q7YC 1W4SA 1YWPA 2XDBA 2MYSA 1IHWA 1ABQA 1JJ2S 2R5MA 2HBPA 3R6OA 1K0SA 1Y71A 2QXFA 1YJNA 1PRMC 3BFMA 3KXTA 5CKBA 4NS5A 3QSUA 3HRUA 2RQWA 3CCQT 2RMOA 1G3YA 1D0ZA 1R77A 4CC7A 3CCLT 2YXYA 4PLLA 9ATCB 4WTOB 3P8DA 3HU2A 4D6WA 1UEBA 3M0TA 5M9OA 4D8DA 2KXCA 1AHJB 1YP5A 1TU0B 4M78D 1J3TA 3OW2A 4J9FA 3UDCA 4MDXA 1WX6A 4A4HA 1AEYA 2O9SA 1M1FA 3C12A 3OQ5A 1SSHA 1X43A 3WVDB 2G6FX 1YJWA 3V7CA 1IREB 1RABB 3G4SA 2FRYA 5FTJA 1I5LA 2EGEA 2HMAA 4PJLA 2LP5A 2HQHA 4MMLA 4AFSC 2FL7A 4FYWB 3CCLA 1CKBA 3FPRA 5KYYA 5GANf 1E32A 1SHGA 1VQ4Q 1KFZA 1X69A 1M27C 2KE9A 2OX7A 1ACMB 3M0RA 2K5LA 1VYTA 2LQWA 3H8ZA 3V8KA 1YIJT 4M75D 1W70A 4C0FA 1QKXA 4PFZA 4E7ZA 2JMAA 2JN0A 3RDVA 5ECAA 2L2PA 1WFWA 2K9GA 4PJMA 1VQ4T 4PJOD 1U5SA 1WPYA 1ZSZC 2VUBA 4LDXA 1RAIB 3CC7A 5KYXA 2DFUA 5GAMf 2YUQA 2RJFA 1KQ1A 4OMOA 1QWEA 2NUTA 1XQHA 2A7YA 3X28B 1M1KR 3CMAT 3RERA 4M77D 4XU3A 3CCUA 1GCQC 4JRKA 1VQ6T 5KYNA 3OSSC 3CC7Q 2P0KA 5GMKe 4E7JA 2COWA 2VASA 4KGXB 1D09B 4V2SA 1VQPT 4A4EA 3M53A 3BE3A 4J7IA 3VS0A 2YUNA 4ZGJB 4J9DA 2PZ1A 2F5TX 2C0TA 3CCUT 3CD6Q 1PCXA 1SRLA 2B86A 3OW2S 5HK3A 4E7KA 3DLMA 1Q81U 4HT9A 2J6OA 3M0PA 1KC8U 1DJ7B 3JCMP 3RESA 2JJ9A 2K5FA 2CKKA 3L42A 2GNCA 2MOXA 2BE9B 5J26A 2R58A 1LNXA 2EYYA 2DAQA 2AK5A 2DJZA 1I07A 3JCMd 1M1GA 3QHSA 1U1SA 2OTLQ 4QQDA 2R5AA 3P8HA 3SWNA 1YHQT 4DQ2A 3GOXA 1VIFA 5C6SA 1WHLA 2DVJA 3VS3A 2XIDA 2RO0A 4C8QC 4QT7A 3OA6A 3UA6A 1ZUYA 4M4ZA 2BIVA 5DY9A 3M9QA 4IIMA 5IHNA 2FG0A 2LX7A 1A0NB 4KGZB 1T0HA 5IH2A 4R0KA 3OBYA 4JRQA 1YHQQ 1NLPC 4OMMA 2KYBA 1QVPA 3SD4A 2X3WD 2GBQA 4IUUA 2RJDA 4M75A 3CBOA 1M2VB 3OYGA 2XD0A 2QDLA 1AZEA 3I55A 1WLPB 1E6GA 1YJWT 1QP3A 5GANd 1VQKT 4M7DB 4E7HA 4PL6A 3JB9F 5I2SA 1RAHB 4PJOF 6AT1B 2JVVA 2QYZA 1Y7XA 1R7RA 3M54A 2DA9A 3PMIA 4LDUA 4RV0A 4C0ZA 2GTJA 1MNDA 2CS7A 3H0HA 2VV5A 4M75F 4XTYA 3RMSA 4OB3B 3E2UA 2KGTA 3H6ZA 1KQ2A 3P8BB 1SPKA 3ME9A 2IG0A 2BZ8A 2Q1DX 1MMGA 1M2OA 2CP7A 1D3BA 2QGGA 2E12A 2KRSA 4IIOA 1OU8A 3S3OA 2CDTA 2O4XA 1PRLC 3QJYA 4DBQA 1BCMA 1ZC1A 3OYAA 4TVRA 3JB9H 2BKDN 1YJWQ 2DEUA 2F2WA 4JPBW 2PUOB 3SDZA 4C5GA 5KYUA 4JLGA 1PD1A 4IUQA 3LYIA 3A8HB 4KH0B 1I4K1 2QA4T 3QXEB 4C5HA 3TU4K 1Y96A 1G2BA 4M77G 2DKGA 2W0ZA 4RTYA 2HBWA 1WQWA 5GAMh 3ZJTA 2SEMA 2YUJA 4C8QB 3O5ZA 5CKHA 1D1BA 5CQYA 2CUBA 4OB1B 2LCLA 2RH2A 1U1TA 1B07A 1Y57A 4L5GA 1BB9A 2EKOA 4M7AB 1OX9A 2EVRA 5IT9E 4M77E 2VXEA 1GFCA 2L3RA 2MWOA 2DBKA 5J3BA 3QG1A 3SHWA 3VYHB 2JM8A 3JV3A 3M55A 1OU9A 1K73U 2KNBB 2ENMA 4KDIA 3KUFA 1CZ5A 4LUDA 4B9WA 2EBPA 4HVVA 1NJIR 2RI3A 2HEQA 4FL6A 1M8VA 2X51A 5GLFA 3TREA 3FPTA 4EIKA 1NBEB 2DX1A 4M7AG 5GANg 1GXIE 4PJJA 3S3MA 3VS5A 5I21A 1OV3A 1M1KC 3E9GA 5CVIA 1Z9ZA 3X20B 1UGPB 2EIFA 1ZSZB 2LNHB 2DRKA 1M2VA 1X6OA 2DK3A 4AFUC 5J39A 4P5NA 4BE1A 1OPLA 2J05A 2V8KA 1IB8A 1KD1R 4BI4A 3LH5A 2ZPIB 5DLQE 1EX4A 4XU1A 5A0DA 2YUOA 3QO3A 3CQTA 1H3HA 3CD6A 4Z8AA 3MEVA 4JLIA 4F14A 5CQXA 2EYZA 3M58A 1KQSP 2DYBA 4OGEA 1BI2A 3A98A 2ZPBB 2KYMA 2RB6A 4LDWA 4MMKA 2VGMA 3MB5A 1YCSB 3GLXA 2B8AA 3ER0A 2JMCA 2LT1A 3OYFA 3FIFA 4XTWA 2FVUA 1QP2A 3OS0A 1SSFA 3RIRA 4C8QG 3L2UA 1K9MU 1H8KA 3OYJA 3CCSA 4OB2B 1V29B 5AT1B 4J8OA 4KRTA 4KH1B 2KDSA 1KC8R 2VXFA 4PJNA 4RG2A 2E70A 2EFIA 2HKNA 2CREA 4LDYA 1C0MA 1MMDA 2WSCE 2P4RA 4J83A 2OTJQ 4QW2A 1M90C 3TCJA 1BU1A 4PNOA 1S72A 2ZAEA 2Y4XA 3PIOA 3BDUA 2DTIA 4FT2A 1JXMA 4ZN1A 4RMOA 3G6ET 1NE8A 2LJ3A 1EIFA 2QTXA 1TTHB 3MEAA 5GAOl 4BUGA 3ZBDA 5GJWB 4FM4B 4M77A 4OP0A 3MPUB 3JCMX 3I56Q 1K76A 1O9SA 2EYXA 1VQ8T 3QQ8A 3MJXA 5CK9A 3G6EA 2Q1AX 3MEWA 2QI2A 5CKFA 3EFRA 3E9FA 4AG1C 2ECZA 3QYHB 4C92B 3TVTA 1S72T 1Q81C 4FT4A 3M4YA 1RAAB 2DJQA 2RK1A 1PKTA 1KQSA 1VYVA 3QJ6A 4XTUA 4C5EA 3CCSQ 4HCBA 4LD6A 4UC4A 1Q86C 2D9TA 1YWOA 4F17A 1K9AA 3EGDA 3UATA 4JUVA 1OYXA 4J9HA 3CXCA 4VUBA 5FWBA 1G3WA 1WNLA 1AD5A 3VJPA 4M7DC 2DZCA 4OMNA 1K0XA 2L8DA 2E5KA 4JRIA 5FW9A 2QEXA 4JS4A 5KYXB 4AQ7A 1WHJA 1K8AC 5CAIA 1YBYA 4Y28E 1ARKA 4IUVA 3LGLA 3O8VA 2DBMA 2LC4A 5KYWB 1G3TA 2JTMA 1QVGP 4F7UE 4NL3A 2FO0A 2PNIA 1BI1A 4C5IA 3HL8A 4C92A 2QQAA 4J9IA 3ZL7C 5LL6S 5LJ3g 2FZKB 1SG5A 3THKA 2EJ9A 2L0AA 4F16A 1MUZA 2YRDA 5C18A 3A8MB 1R0BG 1MMAA 4FYYB 4PLIA 1GFDA 1ZBXA 3UF4A 2DPPB 3EGDB 3JCMh 2ZPEB 1X2KA
chains in the Genus database with same CATH topology
3L42A 3BDLA 1VQLT 1NPPA 4BY6C 3J7AF 3OYCA 2CYZB 3A8LB 3DB3A 4C0DC 4EMKB 2D6FA 5J26A 2R58A 1KHIA 1LNXA 4Z02A 4JJNK 2DAQA 1YIJA 2DJZA 3JCMd 1M1GA 3QHSA 4OVAA 4J5YA 1U1SA 2EJFA 3T9NA 4QQDA 2R5AA 3JRZA 3P8HA 3SWNA 1YHQT 4M7AA 4DQ2A 3GOXA 4C8QE 1VIFA 4J6XA 5C6SA 4BI8B 4DOVA 3OYDA 3CCET 1XNIA 2M0OA 2XDPA 2CZ6B 4YTLA 3HFOA 1W2BA 2XIDA 2RO0A 2DD4A 4NOYA 4C8QC 4M7AD 4CI0C 3QZ5B 1VQNA 4F7UA 5LJ5e 3OA6A 4MZPA 4QVZA 2BIVA 5DY9A 4OF1A 3M9QA 2RHYA 2DXCA 3CC4A 4MDWA 1XTDA 3G71A 1VQ5A 2LW6A 4PJOA 2CZ7B 4C92G 2LT4A 5GANe 5HK0A 3OS1A 5GAMd 3OBYA 4LD9K 4JRQA 3VUBA 2K3XA 2ZZDA 5KH6A 4M7DD 1WGSA 3I56A 4RG8A 3GP8A 5C1BA 3A8OB 4C8QF 5GMKj 5CCXA 4EPCA 2XDDA 4JDSA 1QVPA 2LQ8A 3SD4A 5LJ5f 2B25A 2RHIA 4GY5A 3OYLA 4IUUA 1R8OB 3RUXA 1K9MC 2RJDA 4M75A 3C95A 3CBOA 2I2LA 3CCMT 1UGSB 3SWNC 3OYGA 2XD0A 4OMFB 3I55A 1KD1C 2RJCA 2GCXA 3VKIA 1YCYA 1QVFA 4M77C 1YJWT 4LDVA 2XHCA 4M75B 1RI0A 1QP3A 4A4GA 2P4TA 5GANd 1VQKT 1PSEA 3FDRA 1YITA 4M7DB 4M78B 1M5Q1 1WJQA 2RI5A 2EQMA 4PL6A 5FU6C 4A54A 3V8JA 4E7HA 3VV0A 3E1SA 4BI3A 3JB9F 5I2SA 3HU3A 3DB4A 1ZHIA 3PIPA 1QVGA 2Q1CX 5GMKi 5A0GA 4PJOF 2KK4A 2OTJA 4XU0A 2X4YA 2FYKA 1U8RA 2JVVA 3CCRT 1WLFA 3QZ9B 3X24B 3HRTA 2RK2A 4QQGA 1VQ7T 5ERGB 1Y7XA 4KUDK 1O54A 1R7RA 2R57A 1B34A 3BQBA 2DXBA 3M54A 2XG8D 4C8QA 3PMIA 4LDUA 4RV0A 2M1HA 4A4KA 3LWIA 2PVDB 1YJ9T 4QQ6A 4C0ZA 3CC2A 5GMKh 2CS7A 2RD1A 4XTZA 5FTNA 4XTYA 2VV5A 4M75F 5CKEA 2YRVA 3RMSA 4ELYC 4OB3B 3LWHA 2Q19X 3NFCA 3H6ZA 5FU7C 4PJOC 1K73C 4ARCA 2XI9A 3CEYA 3PGGA 1KQ2A 4M78G 3JCMf 3P8BB 1N9RA 3CPFA 1M9SA 3ME9A 2XKOC 3SB2A 3JCMW 2IG0A 4PJOE 1YJNT 2Q1DX 5B6CA 5GAOn 4HCCA 4CRIA 2GFUA 3CMET 1BI0A 4EMGA 1D3BA 4M78C 4C8QD 1VQMT 1VQ9T 2F5KA 3MP6A 1LOJA 4M75C 2MF2A 2E12A 5GAN6 2MAMA 1KHCA 2KSSA 3I55T 3S3OA 5GANj 1MGQA 2O4XA 3MP1A 3CCVT 3QJYA 1ZC1A 4L6V5 4ZTFA 3SWNB 3NTIA 4M75E 3OYAA 4TVRA 5FTLA 2K5IA 3OMCA 5IAYA 3JB9H 2BKDN 5I2MA 5CKDA 3DLLA 2OAUA 1M1KU 5LJ3d 2LDMA 2PUOB 4HA8A 1BI3A 4XU2A 3SDZA 4RCBA 4ZTJA 4C5GA 3OYEA 1X75C 3CCVA 3ZJUA 4JLGA 1TH7A 1IZ6A 2KQWA 2Y4YA 4IUQA 4XQ3A 4M7DF 3HKSA 2E6ZA 5LJ5j 4HKEA 3HPWA 4EDUA 3V8LA 3LYIA 3PT9A 4RCCA 5KE3A 3A8HB 2CZ0B 4XTVA 1I4K1 4OGCA 3G71T 3CC4T 5LJ5g 3TEEA 2E6NA 3QXEB 4C5HA 3CMEA 2QA4T 1QVGS 1H3ZA 3TU4K 1Y96A 1Q86U 4M77G 2KMTA 2OTJT 2DKGA 2V8JA 1WQWA 4ZN3A 2DIGA 2H3JA 5GAMh 4QVDA 4HT8A 1QW1A 2EQUA 2LCCA 2RJEA 3ZJTA 2X4WA 2YUJA 3CBPA 2DD5A 4C8QB 2QDYB 5LJ5h 1KQSS 3BY7A 5FROA 5CKHA 5GAOp 2QA4A 1VQKA 2PQWA 2EAYA 1OZ3A 2X4JA 3M57A 4DOWA 4M7DG 4WF2A 3QIIA 5CQYA 1LJOA 2QQ9A 2EQJA 2LCLA 4OB1B 4XTXA 4M7DE 2ZPGB 2RH2A 1JRIA 2MM2A 3J80E 3C94A 4EMKA 1UGRB 2JNGA 4ZGEB 1CZ4A 2HAXA 1U1TA 1WJSA 4IURA 2MMPA 1O75A 4Q5WA 3VUZA 4EMKC 2MM0A 4C0DB 4L5GA 3JCMc 5GAN8 5EG2A 2EKOA 4J7FA 3VU3C 5LJ3e 4M7AB 3OY9A 2K2VA 3TIWA 5IT9E 4M77E 1W2BS 4F7UF 1XOVA 2VXEA 5A0LA 3S6WA 2QQSA 2CZ1B 2L3RA 4MZMA 3CCJA 2M9UA 2MWOA 2JTFA 2NLUA 1OI1A 1QCSA 1NZ9A 1VQ9A 1I8FA 5GAOr 1VQMA 5CD1A 2ZPFB 2M16A 2RA2A 4E7IA 3CBMA 3FB9A 3QG1A 5J3BA 1MHNA 3VYHB 1QDNA 1VQNT 3M59A 1H641 4M7AE 3HRSA 3RKYA 3DKMA 4ARIA 2XU8A 2E65A 4PKCC 3JB9D 2XK0A 1VQPA 3GIBA 2ZPHB 1OZ2A 3OB9A 3OMGA 3M55A 2PVOB 1WJRA 2LX9A 4E7LA 1K73U 4KDIA 3KUFA 1CZ5A 3M56A 3JB9G 4B9WA 3SFMA 4M77F 4O5VA 2E5QA 5CR2A 4GLKA 1YJ9A 2K4YA 2RI3A 4M7DA 4F7UB 4FL6A 1M8VA 1I9GA 1M90U 3CMAT 4KO8A 5GLFA 4OB0B 3TREA 5GAN4 3FPTA 5GAN3 5LJ3f 3OS2A 4BB7A 2GF7A 2D0QB 3OYNA 3UWNA 5A2QE 3L2WA 3CD6T 3EAEA 1HXDA 5GAN2 2LTOA 1NJIU 3ASKA 4M7AG 3QQ7A 3C4SA 3QBYA 2VYTA 2ZCFB 4KUIA 5GANg 4C92D 1GXIE 1Y07A 2KAFA 2YLBA 5LJ3j 3CCEA 1NJIC 2E1HA 3S3MA 5I21A 1M1KC 1BKBA 2EJGA 4ELZC 5GAOq 1N8RC 3OS5A 3E9GA 5CVIA 3X20B 3S3NA 1UGPB 2EIFA 2PWYA 5KCOA 3V7SA 1X6OA 2DK3A 4M78E 2VGNA 2HNIA 5IN1A 4BACA 5FLXE 5J39A 3JCMJ 3QUIA 5DYGA 4P5NA 5EPPA 4BE1A 1BIAA 3BW1A 3QYGB 5D6XA 1CR5A 2V8KA 3MO8A 4E47A 2PU9B 4BI4A 2OTLA 2ZPIB 5GAN7 4RKUE 3OYKA 5DLOA 3A5ZB 1VQ6A 4ATOA 5FTKA 4FU6A 3CCJT 5DLQE 3PNWC 2DO3A 3CMAA 4XU1A 5A0DA 4BDYA 4KLNA 5KE2A 3QO3A 4JRPA 2JV2A 1B34B 3OYMA 3MEUA 2E64A 4M78F 4XK8E 1VIEA 3PTAA 2JOYA 3CD6A 3MEVA 1D3BB 2RHUA 4EMHA 4JLIA 5GAMe 2DZ9A 5CQXA 2PJHB 1RL2A 3PMTA 4R55A 2RM4A 3QKJA 1KD1U 2C06A 3HU1A 1N6AA 3M58A 3JCMg 1HK9A 2PVGB 2DTOA 3CPWS 4OGEA 4FSXA 3MHXA 4N4IA 1BI2A 3OBWA 2IVWA 5D6YA 2KVQG 2QEXT 4C92E 1VQ7A 2ZPBB 5GMKl 2XICA 4F7UG 3ZEHA 3OYHA 3CCRA 2RB6A 1Q7YU 3X25B 4LDWA 4MMKA 2VGMA 3WXMB 1QVFS 3MB5A 3GLXA 2B8AA 4O6JA 3ER0A 4J6WA 4C92C 2LT1A 2WSEE 4M75G 2V8IA 3OYFA 4MZTA 3E19A 2ZGWA 5LJ3h 3FIFA 4XTWA 2FVUA 1QP2A 3OS0A 1X01A 2Y90A 3PFSA 1SSFA 3RIRA 4C8QG 2O01E 1NPRA 3KBGA 3L2UA 4X9DA 3MCAB 5HY6A 1K9MU 3OYJA 3CCSA 2YHTA 3GNFB 3L2QA 3CCMA 4M7AC 4OB2B 4PJOG 1V29B 2RI2A 2K57A 4BE2A 3JB9J 4C92F 4J8OA 3AHUA 3F70A 3X26B 2KDSA 1UGQB 2VXFA 3FLGA 4RG2A 1VQ4A 2E70A 4NL2A 5GMKm 2EFIA 2JUFA 3V7RA 3JSCA 1Q7YC 4KBMB 1W4SA 2XDBA 4N0AA 3FPUA 4ZGDB 2RHXA 4BE0A 1ZQ1A 4LDYA 2X35A 2CGHA 4N0AC 2WSCE 3EFSA 2K3YA 2Q18X 4J83A 3L1AA 4QW2A 1JJ2S 1G3SA 2R5MA 1M90C 3TCJA 1VQ5T 2HBPA 3R6OA 4PNOA 5CO7A 5GAMg 3LX7A 1S72A 2DEQA 3UT1A 1Y71A 2Y4XA 3PIOA 3JB9I 3CF2A 2QXFA 3BDUA 1YI2A 3BFMA 3KXTA 1YJNA 5CKBA 4BD3A 4NS5A 2DTIA 3QSUA 2QQRA 2WSFE 4FT2A 1WQ7A 3HRUA 3L2RA 4IUPA 4ZN1A 3CCQT 4RMOA 4ME7A 1G3YA 1NE8A 3G6ET 3WVEB 3CCLT 1EIFA 2QTXA 3M4GA 4X9CA 1YHQA 3OYIA 5GAOl 3MEAA 3CC2T 4PLLA 4L59A 3JAME 4BUGA 2O4XB 3P8DA 3ZBDA 4KT0E 4D6WA 3HU2A 4FM4B 4M77A 1UEBA 5M9OA 3ZJVA 5FTMA 4OP0A 2EWNA 1N8RU 1AHJB 1N9SA 3L2VA 3VYGA 3JCMX 5KCHA 4M78D 2RHZA 3JCMQ 4CQNA 2EYQA 3OW2A 1JJ2A 2BUDA 1O9SA 1VQ8T 3QQ8A 3UDCA 3JCMe 3I56T 4MDXA 5CK9A 3G6EA 1KC8C 2GFAA 2Q1AX 3MEWA 3QC8A 4A4HA 4B9XA 2QI2A 3Q1JA 5CKFA 1BIBA 3EFRA 5FRMA 2DXTA 3E9FA 1M1FA 1VQOT 3C12A 3QYHB 4FIBA 3OQ5A 3WVDB 4C92B 1YJWA 3RKWA 3CXCS 3HFNA 4DA4A 3OSVA 4Y91A 1S72T 3V7CA 4KULA 1Q81C 4FT4A 4QVCA 2DXUA 3NTKA 3A8GB 1IREB 3M4YA 3GPLA 2L5QA 3G4SA 5L8RE 4N4HA 5FTJA 2QQBA 2RK1A 5FU7B 1N27A 1KQSA 1I5LA 4PJOB 3OYYA 4KODA 4AS1A 4MMLA 3QJ6A 4XTUA 4C5EA 2FL7A 1KG1A 4HCBA 5GAOm 3CCLA 3FPRA 2LRQA 1FWZA 3FEOA 4LD6A 4UC4A 2VC8A 5GANf 3UPUA 5CIUA 1Q86C 2D9TA 1E32A 4JS5A 1Y96B 2DIQA 2FHDA 3URGA 1VUBA 4BDZA 4JUVA 1OYXA 3HHTB 3RKXA 2A3LA 2MI6A 3HP9A 5GANh 3CXCA 2K5LA 4VUBA 3H8ZA 3V8KA 2CKKA 1G3WA 2P0QA 3INZA 1YIJT 3MP8A 1WNLA 4M75D 3JCMV 4A53A 2G3RA 5FU6B 4C0FA 3VJPA 2YLCA 4M7DC 3JCMb 4II1A 2DZCA 4M78A 1YITT 3N5BB 2DTHA 2JN0A 5EQJB 2HD0A 4M77B 1JBMA 1VQ8A 3LHDA 3NTHA 3LGAA 1P92A 1BYMA 1VQ4T 2L8DA 3FRNA 2P0PA 4JRIA 3CPWA 4N4GA 4A4FA 4PJOD 2QEXA 2JZ2A 2GQVA 4JS4A 1FX7A 1WPYA 3QDRB 3CCST 2AHJB 4AQ7A 2MWPA 2DVEA 1PSFA 2VUBA 1VQLA 2EQKA 3LGFA 5FRNA 3LH0A 4LDXA 1K8AC 1FXXA 2PUKB 2LQKA 5CAIA 3CC7A 3HSBA 1YBYA 4Y28E 1S3SA 4IUVA 3FJPA 3LGLA 3CCQA 3O8VA 2LC4A 5GAMf 3META 2YVLA 2LVMA 1G3TA 2RJFA 1KQ1A 2KY9A 2JTMA 5DM7R 1Q82U 3X28B 3RERA 1YI2T 1XQHA 2A7YA 3L2ZA 4IUTA 2FB7A 4F7UE 3M5AA 3G7ZA 4HCZA 2HQXA 4M77D 4XU3A 5LJ5d 4JRKA 3CCUA 2F69A 1VQ6T 3OSSC 4NL3A 2OTLT 3RMQA 4C0GA 2P0KA 4XAXB 5GMKe 1BI1A 4C5IA 4E7JA 5CCAA 5DYIA 3HL8A 4C92A 2QQAA 1I81A 3FC3A 2E10A 3LW5E 4IKFA 2WACA 5LL6S 4M7AF 4J6YA 5LJ3g 4R56A 1G5VA 4V2SA 1VQPT 4A4EA 1K8AU 2EJ9A 3G4ST 3M53A 4J7IA 4ZGJB 3OYBA 2L89A 1JB0E 3GF5A 5D6WA 5HKCA 2F5TX 3QWZA 5CCBA 1UB4A 3CCUT 3OW2S 3GNGA 5C18A 3ZFJA 4X34A 3J81E 4BY6B 5GAMj 3A8MB 1VQOA 4KDLA 5HK3A 4E7KA 1Q82C 5AYFA 3DLMA 1Q81U 2E41A 4PLIA 2LNVA 2HQEA 4HT9A 1ZBXA 5C0MA 2DPPB 1KC8U 1M4ZA 3ZGZA 2X4XA 3LLRA 5GAN5 1DJ7B 3JCMh 3QPHA 3RESA 3JCMP 2ZPEB 3CC7T 2K5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIB A;  2KY9 A; 
#chains in the Genus database with same CATH topology
 3BDL A;  2CYZ B;  3DB3 A;  1K9M R;  1LCK A;  2CUD A;  3EG0 A;  1PM3 A;  3CC4 Q;  1NEB A;  4DOV A;  3OYD A;  4J9C A;  3CXC P;  4CI0 C;  2KRO A;  4QVZ A;  2PTK A;  3G71 A;  1KIK A;  2LW6 A;  4C92 G;  2FPE A;  3OS1 A;  4LD9 K;  5C1B A;  3A8O B;  5CCX A;  1QWF A;  2J06 A;  4GBQ A;  4ESR A;  3C95 A;  2I2L A;  3CCM T;  3SWN C;  1MV3 A;  4OMF B;  2RJC A;  1TSF A;  2KI7 A;  2XHC A;  4LDV A;  1RI0 A;  5KYY B;  4HCK A;  4A4G A;  1PSE A;  2IIM A;  4M78 B;  5FU6 C;  3VV0 A;  3E1S A;  1ZHI A;  1QVG A;  4E6R A;  1Q82 R;  4XU0 A;  3I5S A;  5EC7 A;  3CCR T;  3X24 B;  3PVQ A;  3HRT A;  1VQ7 T;  4KUD K;  1B34 A;  1ZUK A;  2XG8 D;  2L3Q A;  4PFP A;  2M1H A;  3CC2 A;  2F2X A;  1WHK A;  2RD1 A;  3PVL A;  2YRV A;  3LWH A;  4ELY C;  3EHQ A;  3NFC A;  2ABL A;  2XI9 A;  4HXJ A;  3PGG A;  2RQV A;  4M78 G;  4DEX A;  1N9R A;  1M9S A;  2XKO C;  3SB2 A;  4HCC A;  4AG2 C;  1VQ7 Q;  1BI0 A;  4EMG A;  2CP5 A;  2O9V A;  2F5K A;  2MF2 A;  2MAM A;  4LN2 A;  1KHC A;  3CCV T;  2FPF A;  1BBZ A;  4L6V 5;  3NTI A;  5FTL A;  1QKW A;  2C0O A;  5I2M A;  5CKD A;  2OAU A;  2EW3 A;  2AKK A;  4RCB A;  3OYE A;  1X75 C;  1IZ6 A;  4XQ3 A;  2I0N A;  3PT9 A;  3G71 T;  1UDL A;  4XTV A;  3UPU A;  3CMA Q;  1WXT A;  1VQ6 Q;  4QVD A;  1QW1 A;  1TG0 A;  1FMV A;  1D1C A;  2O88 A;  3BY7 A;  1VQK A;  3M0Q A;  2NYS A;  2X4J A;  1GBQ A;  4J9E A;  2EQJ A;  4M7D E;  1CSK A;  4IUR A;  1OQK A;  1O75 A;  2MM0 A;  1C6V X;  3EH1 A;  5EG2 A;  3VU3 C;  4J7F A;  5LJ3 e;  3OY9 A;  3PE0 A;  3EFO A;  1QCN A;  1X27 A;  1W2B S;  1XOV A;  1Y0M A;  2JTF A;  1OI1 A;  5GAO r;  1KSW A;  1VQM A;  1I5O B;  3CBM A;  3A1P A;  1AT1 B;  4M7A E;  1H64 1;  3RKY A;  3DKM A;  4PKC C;  2ZPH B;  2AIR B;  2OI3 A;  1V76 A;  4J9G A;  3M56 A;  4FYX B;  4O5V A;  2E5Q A;  2KXD A;  3EG2 A;  2K4Y A;  4LE9 A;  1VQP Q;  5GAN 4;  3H0F A;  1M3C A;  5GAN 3;  2ROT A;  3OS2 A;  4Z89 A;  2CSI A;  4BB7 A;  1S72 Q;  3OYN A;  5A2Q E;  3CD6 T;  1HXD A;  2QEX Q;  1PC0 A;  2VWF A;  2BZX A;  3C4S A;  1HJD A;  1NEG A;  2KAF A;  2YLB A;  3CCE A;  1NJI C;  1BKB A;  2EJG A;  2PWY A;  2HNI A;  5IN1 A;  4JZ3 A;  2RQU A;  2YSQ A;  5FLX E;  4K11 A;  3VRZ A;  5DYG A;  5EPP A;  1PD0 A;  1IGU A;  4E47 A;  2PU9 B;  3OYK A;  1VQ6 A;  2HSP A;  2DYI A;  1OEB A;  4AT1 B;  2CH4 A;  2LJ1 A;  4BDY A;  4KLN A;  5KE2 A;  4JRP A;  1B34 B;  3MEU A;  2DL4 A;  1UG1 A;  4JJC A;  2E64 A;  4XK8 E;  1VIE A;  3PTA A;  1D3B B;  2LQN A;  1OOT A;  1GCP A;  2DZ9 A;  2JTE A;  2P84 A;  3TSW A;  3PMT A;  4R55 A;  2C06 A;  1E7O A;  1N6A A;  1NG2 A;  4FSX A;  3MHX A;  4N4I A;  2JT4 A;  2KVQ G;  2QEX T;  1VQ7 A;  5GMK l;  3VS6 A;  4QKU A;  2XIC A;  4F7U G;  3ZEH A;  3OYH A;  3CCR A;  3X25 B;  1QVF S;  3WXM B;  2HDA A;  1LVK A;  2WSE E;  2FZC B;  3ULR B;  2LCS A;  3E19 A;  5LJ3 h;  3VS7 A;  1AWX A;  4E2F B;  2Y90 A;  2HKQ B;  1S1N A;  2O01 E;  1NPR A;  3MCA B;  5HY6 A;  4PFO A;  3L2Q A;  2H8H A;  2FPD A;  4DEY A;  3CCM A;  4CC4 B;  2RI2 A;  4BE2 A;  2K57 A;  4C92 F;  3X26 B;  1X6B A;  1UGQ B;  5GMK m;  3V7R A;  4KBM B;  1Q95 G;  2V1Q A;  1ZQ1 A;  3L1A A;  3VS1 A;  2CP0 A;  2EGC A;  2DEQ A;  3CF2 A;  1YI2 A;  4BD3 A;  2WSF E;  1T0J A;  1WQ7 A;  1PWT A;  2O31 A;  4OMP A;  2YWW A;  4ME7 A;  5I22 A;  3CCQ Q;  2M51 A;  1TUC A;  3REA B;  4KT0 E;  3ZJV A;  5FTM A;  2EWN A;  1N8R U;  2HL5 C;  1N9S A;  3L2V A;  2A28 A;  1AWO A;  3JCM Q;  2RHZ A;  2QA4 Q;  1UGV A;  3I5R A;  1VQM Q;  2BUD A;  1I0C A;  1KC8 C;  3QC8 A;  3EG3 A;  3Q1J A;  1RAC B;  5FRM A;  1K73 R;  2DXT A;  4FIB A;  5IHI A;  3HFN A;  4LNP A;  4DA4 A;  3OSV A;  4Y91 A;  4KUL A;  5D7U A;  1RLQ C;  4QVC A;  5L8R E;  4N4H A;  2QQB A;  4RTX A;  4KOD A;  2X9H A;  1EFN A;  1FWZ A;  1HYO A;  2E3I A;  5CIU A;  4JS5 A;  1Y96 B;  1VUB A;  2ATC B;  2JS0 A;  3EG9 A;  3RKX A;  1B3Q A;  1ZUU A;  2P0Q A;  1W1F A;  3INZ A;  1D0Y A;  2FRW A;  3MP8 A;  2G3R A;  4FW1 A;  2YLC A;  3JCM b;  4M78 A;  3VS2 A;  3N5B B;  2DTH A;  5EQJ B;  2HD0 A;  3LHD A;  3LGA A;  1P92 A;  3FRN A;  1OUL A;  3CPW A;  1FX7 A;  2EYW A;  1ZBJ A;  2AHJ B;  1VQL A;  3LH0 A;  1SF9 A;  2LQK A;  1QVF P;  1RAF B;  3FJP A;  3MET A;  2NUZ A;  1AWJ A;  2KY9 A;  1Q82 U;  1YI2 T;  4IUT A;  3AHU A;  3G7Z A;  1JQQ A;  2HQX A;  5LJ5 d;  1QLY A;  3RMQ A;  5IXB A;  2ED1 A;  4XAX B;  2ESW A;  1G8X A;  5DYI A;  2E10 A;  3LW5 E;  2WAC A;  4J6Y A;  4R56 A;  1G5V A;  1K8A U;  3NPF A;  2CP2 A;  3OYB A;  2L89 A;  5D6W A;  1UJY A;  1WIE A;  3GNG A;  2GGR A;  2YUP A;  3J81 E;  4BY6 B;  3C0C A;  1Q82 C;  4FYV B;  5AYF A;  2NUP B;  5C0M A;  3ZGZ A;  4AFQ C;  2DL3 A;  5GAN 5;  3QPH A;  1T3S A;  2V1R A;  1YIJ A;  1ZSZ A;  2DNU A;  1VQL T;  1NPP A;  4BY6 C;  3J7A F;  3OYC A;  4FW2 A;  4C0D C;  2C0I A;  4EMK B;  2D6F A;  4JJN K;  2DM1 A;  3QWX X;  3CCM Q;  2EPD A;  1WXU A;  4JJD A;  4OVA A;  2EJF A;  2DE0 X;  2QG9 B;  3I9Q A;  4J6X A;  1UHF A;  3NHN A;  2M0O A;  2XDP A;  2H3E B;  3HFO A;  3RR6 A;  1KJW A;  3QZ5 B;  4F7U A;  1HD3 A;  4LXC A;  4MZP A;  4ZNX A;  4OF1 A;  2RHY A;  2DXC A;  1M3A A;  1XTD A;  4MDW A;  4DBR A;  3G6E Q;  4PJO A;  1VQK Q;  2CZ7 B;  1OX8 A;  5HK0 A;  1WDX A;  5GAM d;  2K3X A;  2ZZD A;  1WGS A;  4RG8 A;  3GP8 A;  4C8Q F;  3CPW P;  2KT8 A;  5LJ5 f;  2RHI A;  4GY5 A;  3OYL A;  2EQI A;  3VS4 A;  1K9M C;  4KGV B;  1PG5 B;  2KT1 A;  2RQR A;  1KD1 C;  1QVF A;  4M77 C;  2P4T A;  3FDR A;  1M5Q 1;  1WJQ A;  2RI5 A;  4A54 A;  2B25 A;  3V8J A;  1N8R R;  5GMK i;  4B6M A;  3CCJ Q;  1OPK A;  1WLF A;  2RK2 A;  4QQG A;  3CME Q;  1VQO Q;  2DXB A;  3G4S Q;  2RN8 A;  4C8Q A;  1RI9 A;  3LWI A;  2DER A;  2K6D A;  4QQ6 A;  1Q81 R;  1FYN A;  5GMK h;  1PHT A;  5FTN A;  5CKE A;  2GQI A;  2Q19 X;  2AZV A;  5FU7 C;  4PJO C;  2QGF B;  1ZLM A;  3JCM f;  2IPO B;  3CPF A;  3JCM W;  5GAO n;  3CME T;  1NLO C;  1VQM T;  3G1J A;  3MP6 A;  1LOJ A;  4M75 C;  1K4U S;  3I55 T;  2KSS A;  1MGQ A;  1U3O A;  4ZTF A;  3EG1 A;  2F2V A;  3OMC A;  2HSE B;  5FWC A;  3DLL A;  1ZA2 B;  1M1K U;  1VQ5 Q;  2LDM A;  2CP3 A;  1TXQ A;  4ZTJ A;  1IHV A;  3ZJU A;  1TH7 A;  2RQT A;  2Y4Y A;  4M7D F;  3FJ5 A;  5LJ5 j;  1RAD B;  3HPW A;  3V8L A;  5KE3 A;  3HTR A;  4OGC A;  5LJ5 g;  3TEE A;  2E6N A;  3CME A;  1QVG S;  1TUG B;  1Q86 U;  2KMT A;  1WZO A;  4ZN3 A;  2FZG B;  2DIG A;  2EQU A;  2RJE A;  2X4W A;  3CBP A;  2DD5 A;  1KQS S;  5FRO A;  5GAO p;  2QA4 A;  2PQW A;  2DET A;  1IXD A;  2EAY A;  1WA7 A;  1PNJ A;  3M57 A;  4DOW A;  4AMC A;  3QII A;  1Q86 R;  1LJO A;  4XTX A;  1GL5 A;  2DL7 A;  3R6N A;  2ZPG B;  2MM2 A;  1Z9Q A;  4RTU A;  1UGR B;  2JNG A;  2HAX A;  1TOV A;  1R0C B;  2V26 A;  4C0D B;  3JCM c;  5GAN 8;  2K3B A;  1V1C A;  2D8H A;  2M9U A;  1QCS A;  1JO8 A;  5CD1 A;  2ZPF B;  4RTZ A;  2RA2 A;  3FB9 A;  1MHN A;  2K7A A;  1YIJ Q;  3HRS A;  2E65 A;  2NUT B;  3JB9 D;  2XK0 A;  1VQP A;  3GIB A;  2PVO B;  1WJR A;  2CT3 A;  2F1L A;  3JB9 G;  1T3L A;  3SFM A;  5CR2 A;  3CC2 Q;  4GLK A;  4F7U B;  1W6X A;  5KYW A;  3CCL Q;  1M90 U;  2AKL A;  3AT1 B;  2GF7 A;  2D0Q B;  3L2W A;  1QQJ A;  2XMF A;  3EAE A;  5GAN 2;  3TSZ A;  2VYT A;  4C92 D;  1Y07 A;  3M0U A;  1LPL A;  2RF0 A;  2D8J A;  5LJ3 j;  1U06 A;  5GAO q;  3OS5 A;  5L23 A;  1WI7 A;  4FSS A;  2KEA A;  2VB6 A;  2YRC A;  3JCM J;  3QUI A;  1AVZ C;  1SKU B;  1BIA A;  3QYG B;  1JJ2 P;  4AFZ C;  3KFV A;  2OTL A;  4ATO A;  5FTK A;  4FU6 A;  3CMA A;  2JV2 A;  4ANJ A;  3OYM A;  4M78 F;  2JOY A;  2RHU A;  5GAM e;  2PJH B;  1KD1 U;  2RM4 A;  3NGP A;  1YIT Q;  1HK9 A;  2PVG B;  1VQL Q;  3OBW A;  2IVW A;  5D6Y A;  2JM9 A;  2AT1 B;  4C92 E;  1SHF A;  1Q7Y R;  2RPN A;  2QK0 A;  4HVU A;  1I1J A;  3CCU Q;  2QAZ A;  1SEM A;  2HZY A;  2ZGW A;  1EZZ B;  4HVW A;  4JJB A;  1ABO A;  1X01 A;  3PFS A;  4X9D A;  2NWM A;  3JB9 J;  3F70 A;  3FLG A;  1M3B A;  2JUF A;  2D0N A;  3JSC A;  2E4H A;  4N0A A;  3FPU A;  3EGU A;  2RHX A;  4BE0 A;  2X35 A;  2CGH A;  2OJ2 A;  2VKN A;  3EFS A;  4N0A C;  2K3Y A;  2Q18 X;  2DIL A;  1VQ5 T;  1G3S A;  2A36 A;  2DRM A;  5GAM g;  5CO7 A;  3UT1 A;  3JB9 I;  3EGX A;  2QQR A;  3L2R A;  4IUP A;  1QMC A;  1IO6 A;  1AOJ A;  1M30 A;  3WVE B;  2COY A;  3M4G A;  2HCK A;  4X9C A;  1YHQ A;  3OYI A;  4GLM A;  3CC2 T;  3MKD A;  2A0F B;  4L59 A;  3JAM E;  2O4X B;  2CSQ A;  3VYG A;  5KCH A;  4CQN A;  4CC2 A;  2EYQ A;  1JJ2 A;  1D0X A;  3JCM e;  3I56 T;  2GFA A;  3EHR A;  4B9X A;  1E6H A;  4Y92 A;  1BIB A;  3H9N A;  1VQO T;  2K79 A;  3RKW A;  3CXC S;  3H0I A;  3NTK A;  2DXU A;  1QCO A;  1YNZ A;  3A8G B;  3GPL A;  2L5Q A;  5FU7 B;  1N27 A;  4PJO B;  3OYY A;  4AS1 A;  1RUW A;  2YT6 A;  1KG1 A;  5GAO m;  2LRQ A;  1KK7 A;  3FEO A;  2VC8 A;  1YFN A;  2DIQ A;  2FHD A;  3URG A;  5IHK A;  4BDZ A;  3HHT B;  2A3L A;  2MI6 A;  3HP9 A;  5GAN h;  1VQN Q;  2KBT A;  3JCM V;  1TWB A;  4A53 A;  5FU6 B;  4II1 A;  3G71 Q;  1YIT T;  1B7T A;  4M77 B;  1JBM A;  1VQ8 A;  3NTH A;  3QWY A;  1BYM A;  1FMK A;  2DF6 A;  2P0P A;  4N4G A;  4A4F A;  2JZ2 A;  2GQV A;  3CCV Q;  3QDR B;  2W10 A;  3CCS T;  2L3P A;  2MWP A;  2DVE A;  1PSF A;  3GBQ A;  2EQK A;  3LGF A;  5FRN A;  1PKS A;  1TS9 A;  1FXX A;  1UE9 A;  2PUK B;  4E7S A;  3HSB A;  1S3S A;  3CCQ A;  2CH4 W;  2YVL A;  2LVM A;  3H41 A;  3D7S B;  4DBH A;  5DM7 R;  3L2Z A;  4ZGD B;  2FB7 A;  1YJN Q;  3M5A A;  4HCZ A;  1NM7 A;  1WHH A;  2F69 A;  5IXF A;  1RLP C;  4DBF A;  2OTL T;  4C0G A;  5CCA A;  1MNE A;  2DMO A;  1I81 A;  3FC3 A;  1BCO A;  4IKF A;  1CKA A;  4M7A F;  3NMZ C;  4Z88 A;  1JEG A;  3G4S T;  1JB0 E;  2NUP A;  3GF5 A;  5HKC A;  3QWZ A;  5CCB A;  1UB4 A;  2FEI A;  1UUE A;  3ZFJ A;  2KRM A;  4X34 A;  5GAM j;  4KDL A;  1VQO A;  5GJV B;  1BK2 A;  1X2Q A;  2E41 A;  2D1X A;  2LNV A;  1IRX A;  2HQE A;  1M4Z A;  2MCN A;  2X4X A;  3LLR A;  2EGA A;  4OML A;  1F1B B;  3CC7 T;  3IQL A;  3LX7 A;  1JXO A;  2L3S A;  3A8L B;  2E3H A;  1C1A A;  2KRN A;  1KHI A;  4Z02 A;  4J5Y A;  4M7A A;  3T9N A;  1VQ8 Q;  3JRZ A;  4C8Q E;  4BI8 B;  3CCE T;  1XNI A;  2CZ6 B;  4YTL A;  1W2B A;  3EGX B;  2DD4 A;  4NOY A;  4M7A D;  1YN8 A;  1VQN A;  5LJ5 e;  2LMJ A;  3CC4 A;  2J6K A;  1VQ5 A;  2LT4 A;  2LZ6 B;  5GAN e;  2M02 A;  1XJW B;  3VUB A;  5KH6 A;  4PK4 A;  4M7D D;  3I56 A;  4FCY A;  5HCK A;  5GMK j;  4EPC A;  2XDD A;  4JDS A;  2LQ8 A;  1R8O B;  2CT4 A;  1ZA1 B;  3RUX A;  1D1A A;  3SEM A;  1JU5 C;  1UGS B;  2GCX A;  3VKI A;  1YCY A;  1N5Z A;  4M75 B;  1YIT A;  2EQM A;  4BI3 A;  1HSQ A;  3HU3 A;  3DB4 A;  3PIP A;  2Q1C X;  4JZ4 A;  3EG9 B;  4RTW A;  5A0G A;  2OTJ A;  2KK4 A;  2X4Y A;  2FYK A;  1U8R A;  3QZ9 B;  1ZX6 A;  5ERG B;  7AT1 B;  1O54 A;  2R57 A;  3BQB A;  1WHG A;  2MPX C;  4A4K A;  2PVD B;  1YJ9 T;  2M0Y A;  4RTT A;  4XTZ A;  1H92 A;  1VYU A;  1M90 R;  1K73 C;  4ARC A;  3CEY A;  4F04 B;  2BZY A;  2A08 A;  1MV0 B;  4PJO E;  1YJN T;  5B6C A;  1IGQ A;  2GFU A;  4CRI A;  4M78 C;  4C8Q D;  2K2M A;  3EFO B;  1VQ9 T;  2MIO A;  4D8K A;  1GBR A;  5GAN 6;  4J9B A;  5GAN j;  3MP1 A;  3SWN B;  4M75 E;  1RAG B;  2K5I A;  5IAY A;  1GRI A;  5LJ3 d;  4HA8 A;  1BI3 A;  4XU2 A;  4LUE A;  3CCV A;  1GCQ A;  2KQW A;  1W2B P;  2JXB A;  3HKS A;  2E6Z A;  4OMQ A;  4HKE A;  4EDU A;  1AWW A;  4RCC A;  3TIW A;  2CZ0 B;  3CC4 T;  1SRM A;  1H3Z A;  2OTJ T;  2V8J A;  2H3J A;  4HT8 A;  2LCC A;  2A37 A;  5LJ5 h;  2QDY B;  1K8A R;  2SRC A;  2KR3 A;  1OZ3 A;  2JS2 A;  4M7D G;  4WF2 A;  1WYX A;  1NYF A;  1RAE B;  2QQ9 A;  2BTT A;  2X3X D;  1JRI A;  1VA7 A;  2LJ0 A;  3J80 E;  3I55 Q;  3C94 A;  1X6G A;  3EH2 A;  4EMK A;  4ZGE B;  1CZ4 A;  1WJS A;  2MK5 A;  8ATC B;  2DLP A;  2MMP A;  4Q5W A;  3VUZ A;  4EMK C;  4CC3 A;  1M8M A;  2K2V A;  4F7U F;  5A0L A;  2Z0W A;  3S6W A;  2QQS A;  2CZ1 B;  4MZM A;  2ED0 A;  3CCJ A;  2NLU A;  1NZ9 A;  2ROL A;  1VQ9 A;  1I8F A;  3TQ7 P;  2DL5 A;  2M16 A;  4ORZ A;  4E7I A;  2BE7 D;  1QDN A;  4RUG A;  1VQN T;  3M59 A;  4ARI A;  2XU8 A;  1OZ2 A;  3OB9 A;  3OMG A;  4E7L A;  2LX9 A;  2AZS A;  2YDL A;  4M77 F;  1YJ9 A;  1I9G A;  1WHM A;  4M7D A;  1ZSG A;  2J7I A;  4KO8 A;  2OAW A;  1FMW A;  4OB0 B;  3REB B;  5LJ3 f;  2QTV A;  2COZ A;  3UWN A;  2J6F A;  3U23 A;  2LTO A;  1NJI U;  3ASK A;  3QQ7 A;  3QBY A;  2ZCF B;  4KUI A;  1NYG A;  4WCI A;  1UTI A;  1K1Z A;  2E1H A;  4ELZ C;  1N8R C;  3S3N A;  1TUD A;  1UEC A;  3QDF A;  3RBB B;  5KCO A;  3V7S A;  2EKH A;  4M78 E;  2VGN A;  4BAC A;  1AZG B;  3BW1 A;  3OW2 P;  1WXB A;  5D6X A;  1CR5 A;  3MO8 A;  1UFF A;  5GAN 7;  4RKU E;  3CCR Q;  5DLO A;  3A5Z B;  3CCJ T;  3PNW C;  2DO3 A;  2VVK A;  2GTO A;  2DL8 A;  1VQ9 Q;  4EMH A;  1MMN A;  1RL2 A;  5KYU B;  3HU1 A;  3QKJ A;  1YI2 Q;  2QAS A;  1UHC A;  3JCM g;  2DTO A;  3CPW S;  2CP6 A;  4X1V A;  3VRY A;  1G83 A;  4A63 B;  1Q7Y U;  8AT1 B;  4O6J A;  2O2O A;  4J6W A;  4C92 C;  1YJ9 Q;  4M75 G;  2V8I A;  2HL3 A;  4MZT A;  3UA7 A;  3M0S A;  3I35 A;  2JW4 A;  3KBG A;  1UJ0 A;  2YHT A;  3GNF B;  4M7A C;  5I11 A;  4PJO G;  4RTV A;  3CCE Q;  1VQ4 A;  4NL2 A;  2RNA A;  1VOM A;  3RNJ A;  1QCF A;  1Q7Y C;  1W4S A;  1YWP A;  2XDB A;  2MYS A;  1IHW A;  1ABQ A;  1JJ2 S;  2R5M A;  2HBP A;  3R6O A;  1K0S A;  1Y71 A;  2QXF A;  1YJN A;  1PRM C;  3BFM A;  3KXT A;  5CKB A;  4NS5 A;  3QSU A;  3HRU A;  2RQW A;  3CCQ T;  2RMO A;  1G3Y A;  1D0Z A;  1R77 A;  4CC7 A;  3CCL T;  2YXY A;  4PLL A;  9ATC B;  4WTO B;  3P8D A;  3HU2 A;  4D6W A;  1UEB A;  3M0T A;  5M9O A;  4D8D A;  2KXC A;  1AHJ B;  1YP5 A;  1TU0 B;  4M78 D;  1J3T A;  3OW2 A;  4J9F A;  3UDC A;  4MDX A;  1WX6 A;  4A4H A;  1AEY A;  2O9S A;  1M1F A;  3C12 A;  3OQ5 A;  1SSH A;  1X43 A;  3WVD B;  2G6F X;  1YJW A;  3V7C A;  1IRE B;  1RAB B;  3G4S A;  2FRY A;  5FTJ A;  1I5L A;  2EGE A;  2HMA A;  4PJL A;  2LP5 A;  2HQH A;  4MML A;  4AFS C;  2FL7 A;  4FYW B;  3CCL A;  1CKB A;  3FPR A;  5KYY A;  5GAN f;  1E32 A;  1SHG A;  1VQ4 Q;  1KFZ A;  1X69 A;  1M27 C;  2KE9 A;  2OX7 A;  1ACM B;  3M0R A;  2K5L A;  1VYT A;  2LQW A;  3H8Z A;  3V8K A;  1YIJ T;  4M75 D;  1W70 A;  4C0F A;  1QKX A;  4PFZ A;  4E7Z A;  2JMA A;  2JN0 A;  3RDV A;  5ECA A;  2L2P A;  1WFW A;  2K9G A;  4PJM A;  1VQ4 T;  4PJO D;  1U5S A;  1WPY A;  1ZSZ C;  2VUB A;  4LDX A;  1RAI B;  3CC7 A;  5KYX A;  2DFU A;  5GAM f;  2YUQ A;  2RJF A;  1KQ1 A;  4OMO A;  1QWE A;  2NUT A;  1XQH A;  2A7Y A;  3X28 B;  1M1K R;  3CMA T;  3RER A;  4M77 D;  4XU3 A;  3CCU A;  1GCQ C;  4JRK A;  1VQ6 T;  5KYN A;  3OSS C;  3CC7 Q;  2P0K A;  5GMK e;  4E7J A;  2COW A;  2VAS A;  4KGX B;  1D09 B;  4V2S A;  1VQP T;  4A4E A;  3M53 A;  3BE3 A;  4J7I A;  3VS0 A;  2YUN A;  4ZGJ B;  4J9D A;  2PZ1 A;  2F5T X;  2C0T A;  3CCU T;  3CD6 Q;  1PCX A;  1SRL A;  2B86 A;  3OW2 S;  5HK3 A;  4E7K A;  3DLM A;  1Q81 U;  4HT9 A;  2J6O A;  3M0P A;  1KC8 U;  1DJ7 B;  3JCM P;  3RES A;  2JJ9 A;  2K5F A;  2CKK A;  3L42 A;  2GNC A;  2MOX A;  2BE9 B;  5J26 A;  2R58 A;  1LNX A;  2EYY A;  2DAQ A;  2AK5 A;  2DJZ A;  1I07 A;  3JCM d;  1M1G A;  3QHS A;  1U1S A;  2OTL Q;  4QQD A;  2R5A A;  3P8H A;  3SWN A;  1YHQ T;  4DQ2 A;  3GOX A;  1VIF A;  5C6S A;  1WHL A;  2DVJ A;  3VS3 A;  2XID A;  2RO0 A;  4C8Q C;  4QT7 A;  3OA6 A;  3UA6 A;  1ZUY A;  4M4Z A;  2BIV A;  5DY9 A;  3M9Q A;  4IIM A;  5IHN A;  2FG0 A;  2LX7 A;  1A0N B;  4KGZ B;  1T0H A;  5IH2 A;  4R0K A;  3OBY A;  4JRQ A;  1YHQ Q;  1NLP C;  4OMM A;  2KYB A;  1QVP A;  3SD4 A;  2X3W D;  2GBQ A;  4IUU A;  2RJD A;  4M75 A;  3CBO A;  1M2V B;  3OYG A;  2XD0 A;  2QDL A;  1AZE A;  3I55 A;  1WLP B;  1E6G A;  1YJW T;  1QP3 A;  5GAN d;  1VQK T;  4M7D B;  4E7H A;  4PL6 A;  3JB9 F;  5I2S A;  1RAH B;  4PJO F;  6AT1 B;  2JVV A;  2QYZ A;  1Y7X A;  1R7R A;  3M54 A;  2DA9 A;  3PMI A;  4LDU A;  4RV0 A;  4C0Z A;  2GTJ A;  1MND A;  2CS7 A;  3H0H A;  2VV5 A;  4M75 F;  4XTY A;  3RMS A;  4OB3 B;  3E2U A;  2KGT A;  3H6Z A;  1KQ2 A;  3P8B B;  1SPK A;  3ME9 A;  2IG0 A;  2BZ8 A;  2Q1D X;  1MMG A;  1M2O A;  2CP7 A;  1D3B A;  2QGG A;  2E12 A;  2KRS A;  4IIO A;  1OU8 A;  3S3O A;  2CDT A;  2O4X A;  1PRL C;  3QJY A;  4DBQ A;  1BCM A;  1ZC1 A;  3OYA A;  4TVR A;  3JB9 H;  2BKD N;  1YJW Q;  2DEU A;  2F2W A;  4JPB W;  2PUO B;  3SDZ A;  4C5G A;  5KYU A;  4JLG A;  1PD1 A;  4IUQ A;  3LYI A;  3A8H B;  4KH0 B;  1I4K 1;  2QA4 T;  3QXE B;  4C5H A;  3TU4 K;  1Y96 A;  1G2B A;  4M77 G;  2DKG A;  2W0Z A;  4RTY A;  2HBW A;  1WQW A;  5GAM h;  3ZJT A;  2SEM A;  2YUJ A;  4C8Q B;  3O5Z A;  5CKH A;  1D1B A;  5CQY A;  2CUB A;  4OB1 B;  2LCL A;  2RH2 A;  1U1T A;  1B07 A;  1Y57 A;  4L5G A;  1BB9 A;  2EKO A;  4M7A B;  1OX9 A;  2EVR A;  5IT9 E;  4M77 E;  2VXE A;  1GFC A;  2L3R A;  2MWO A;  2DBK A;  5J3B A;  3QG1 A;  3SHW A;  3VYH B;  2JM8 A;  3JV3 A;  3M55 A;  1OU9 A;  1K73 U;  2KNB B;  2ENM A;  4KDI A;  3KUF A;  1CZ5 A;  4LUD A;  4B9W A;  2EBP A;  4HVV A;  1NJI R;  2RI3 A;  2HEQ A;  4FL6 A;  1M8V A;  2X51 A;  5GLF A;  3TRE A;  3FPT A;  4EIK A;  1NBE B;  2DX1 A;  4M7A G;  5GAN g;  1GXI E;  4PJJ A;  3S3M A;  3VS5 A;  5I21 A;  1OV3 A;  1M1K C;  3E9G A;  5CVI A;  1Z9Z A;  3X20 B;  1UGP B;  2EIF A;  1ZSZ B;  2LNH B;  2DRK A;  1M2V A;  1X6O A;  2DK3 A;  4AFU C;  5J39 A;  4P5N A;  4BE1 A;  1OPL A;  2J05 A;  2V8K A;  1IB8 A;  1KD1 R;  4BI4 A;  3LH5 A;  2ZPI B;  5DLQ E;  1EX4 A;  4XU1 A;  5A0D A;  2YUO A;  3QO3 A;  3CQT A;  1H3H A;  3CD6 A;  4Z8A A;  3MEV A;  4JLI A;  4F14 A;  5CQX A;  2EYZ A;  3M58 A;  1KQS P;  2DYB A;  4OGE A;  1BI2 A;  3A98 A;  2ZPB B;  2KYM A;  2RB6 A;  4LDW A;  4MMK A;  2VGM A;  3MB5 A;  1YCS B;  3GLX A;  2B8A A;  3ER0 A;  2JMC A;  2LT1 A;  3OYF A;  3FIF A;  4XTW A;  2FVU A;  1QP2 A;  3OS0 A;  1SSF A;  3RIR A;  4C8Q G;  3L2U A;  1K9M U;  1H8K A;  3OYJ A;  3CCS A;  4OB2 B;  1V29 B;  5AT1 B;  4J8O A;  4KRT A;  4KH1 B;  2KDS A;  1KC8 R;  2VXF A;  4PJN A;  4RG2 A;  2E70 A;  2EFI A;  2HKN A;  2CRE A;  4LDY A;  1C0M A;  1MMD A;  2WSC E;  2P4R A;  4J83 A;  2OTJ Q;  4QW2 A;  1M90 C;  3TCJ A;  1BU1 A;  4PNO A;  1S72 A;  2ZAE A;  2Y4X A;  3PIO A;  3BDU A;  2DTI A;  4FT2 A;  1JXM A;  4ZN1 A;  4RMO A;  3G6E T;  1NE8 A;  2LJ3 A;  1EIF A;  2QTX A;  1TTH B;  3MEA A;  5GAO l;  4BUG A;  3ZBD A;  5GJW B;  4FM4 B;  4M77 A;  4OP0 A;  3MPU B;  3JCM X;  3I56 Q;  1K76 A;  1O9S A;  2EYX A;  1VQ8 T;  3QQ8 A;  3MJX A;  5CK9 A;  3G6E A;  2Q1A X;  3MEW A;  2QI2 A;  5CKF A;  3EFR A;  3E9F A;  4AG1 C;  2ECZ A;  3QYH B;  4C92 B;  3TVT A;  1S72 T;  1Q81 C;  4FT4 A;  3M4Y A;  1RAA B;  2DJQ A;  2RK1 A;  1PKT A;  1KQS A;  1VYV A;  3QJ6 A;  4XTU A;  4C5E A;  3CCS Q;  4HCB A;  4LD6 A;  4UC4 A;  1Q86 C;  2D9T A;  1YWO A;  4F17 A;  1K9A A;  3EGD A;  3UAT A;  4JUV A;  1OYX A;  4J9H A;  3CXC A;  4VUB A;  5FWB A;  1G3W A;  1WNL A;  1AD5 A;  3VJP A;  4M7D C;  2DZC A;  4OMN A;  1K0X A;  2L8D A;  2E5K A;  4JRI A;  5FW9 A;  2QEX A;  4JS4 A;  5KYX B;  4AQ7 A;  1WHJ A;  1K8A C;  5CAI A;  1YBY A;  4Y28 E;  1ARK A;  4IUV A;  3LGL A;  3O8V A;  2DBM A;  2LC4 A;  5KYW B;  1G3T A;  2JTM A;  1QVG P;  4F7U E;  4NL3 A;  2FO0 A;  2PNI A;  1BI1 A;  4C5I A;  3HL8 A;  4C92 A;  2QQA A;  4J9I A;  3ZL7 C;  5LL6 S;  5LJ3 g;  2FZK B;  1SG5 A;  3THK A;  2EJ9 A;  2L0A A;  4F16 A;  1MUZ A;  2YRD A;  5C18 A;  3A8M B;  1R0B G;  1MMA A;  4FYY B;  4PLI A;  1GFD A;  1ZBX A;  3UF4 A;  2DPP B;  3EGD B;  3JCM h;  2ZPE B;  1X2K A; 
#chains in the Genus database with same CATH homology
 3L42 A;  3BDL A;  1VQL T;  1NPP A;  4BY6 C;  3J7A F;  3OYC A;  2CYZ B;  3A8L B;  3DB3 A;  4C0D C;  4EMK B;  2D6F A;  5J26 A;  2R58 A;  1KHI A;  1LNX A;  4Z02 A;  4JJN K;  2DAQ A;  1YIJ A;  2DJZ A;  3JCM d;  1M1G A;  3QHS A;  4OVA A;  4J5Y A;  1U1S A;  2EJF A;  3T9N A;  4QQD A;  2R5A A;  3JRZ A;  3P8H A;  3SWN A;  1YHQ T;  4M7A A;  4DQ2 A;  3GOX A;  4C8Q E;  1VIF A;  4J6X A;  5C6S A;  4BI8 B;  4DOV A;  3OYD A;  3CCE T;  1XNI A;  2M0O A;  2XDP A;  2CZ6 B;  4YTL A;  3HFO A;  1W2B A;  2XID A;  2RO0 A;  2DD4 A;  4NOY A;  4C8Q C;  4M7A D;  4CI0 C;  3QZ5 B;  1VQN A;  4F7U A;  5LJ5 e;  3OA6 A;  4MZP A;  4QVZ A;  2BIV A;  5DY9 A;  4OF1 A;  3M9Q A;  2RHY A;  2DXC A;  3CC4 A;  4MDW A;  1XTD A;  3G71 A;  1VQ5 A;  2LW6 A;  4PJO A;  2CZ7 B;  4C92 G;  2LT4 A;  5GAN e;  5HK0 A;  3OS1 A;  5GAM d;  3OBY A;  4LD9 K;  4JRQ A;  3VUB A;  2K3X A;  2ZZD A;  5KH6 A;  4M7D D;  1WGS A;  3I56 A;  4RG8 A;  3GP8 A;  5C1B A;  3A8O B;  4C8Q F;  5GMK j;  5CCX A;  4EPC A;  2XDD A;  4JDS A;  1QVP A;  2LQ8 A;  3SD4 A;  5LJ5 f;  2B25 A;  2RHI A;  4GY5 A;  3OYL A;  4IUU A;  1R8O B;  3RUX A;  1K9M C;  2RJD A;  4M75 A;  3C95 A;  3CBO A;  2I2L A;  3CCM T;  1UGS B;  3SWN C;  3OYG A;  2XD0 A;  4OMF B;  3I55 A;  1KD1 C;  2RJC A;  2GCX A;  3VKI A;  1YCY A;  1QVF A;  4M77 C;  1YJW T;  4LDV A;  2XHC A;  4M75 B;  1RI0 A;  1QP3 A;  4A4G A;  2P4T A;  5GAN d;  1VQK T;  1PSE A;  3FDR A;  1YIT A;  4M7D B;  4M78 B;  1M5Q 1;  1WJQ A;  2RI5 A;  2EQM A;  4PL6 A;  5FU6 C;  4A54 A;  3V8J A;  4E7H A;  3VV0 A;  3E1S A;  4BI3 A;  3JB9 F;  5I2S A;  3HU3 A;  3DB4 A;  1ZHI A;  3PIP A;  1QVG A;  2Q1C X;  5GMK i;  5A0G A;  4PJO F;  2KK4 A;  2OTJ A;  4XU0 A;  2X4Y A;  2FYK A;  1U8R A;  2JVV A;  3CCR T;  1WLF A;  3QZ9 B;  3X24 B;  3HRT A;  2RK2 A;  4QQG A;  1VQ7 T;  5ERG B;  1Y7X A;  4KUD K;  1O54 A;  1R7R A;  2R57 A;  1B34 A;  3BQB A;  2DXB A;  3M54 A;  2XG8 D;  4C8Q A;  3PMI A;  4LDU A;  4RV0 A;  2M1H A;  4A4K A;  3LWI A;  2PVD B;  1YJ9 T;  4QQ6 A;  4C0Z A;  3CC2 A;  5GMK h;  2CS7 A;  2RD1 A;  4XTZ A;  5FTN A;  4XTY A;  2VV5 A;  4M75 F;  5CKE A;  2YRV A;  3RMS A;  4ELY C;  4OB3 B;  3LWH A;  2Q19 X;  3NFC A;  3H6Z A;  5FU7 C;  4PJO C;  1K73 C;  4ARC A;  2XI9 A;  3CEY A;  3PGG A;  1KQ2 A;  4M78 G;  3JCM f;  3P8B B;  1N9R A;  3CPF A;  1M9S A;  3ME9 A;  2XKO C;  3SB2 A;  3JCM W;  2IG0 A;  4PJO E;  1YJN T;  2Q1D X;  5B6C A;  5GAO n;  4HCC A;  4CRI A;  2GFU A;  3CME T;  1BI0 A;  4EMG A;  1D3B A;  4M78 C;  4C8Q D;  1VQM T;  1VQ9 T;  2F5K A;  3MP6 A;  1LOJ A;  4M75 C;  2MF2 A;  2E12 A;  5GAN 6;  2MAM A;  1KHC A;  2KSS A;  3I55 T;  3S3O A;  5GAN j;  1MGQ A;  2O4X A;  3MP1 A;  3CCV T;  3QJY A;  1ZC1 A;  4L6V 5;  4ZTF A;  3SWN B;  3NTI A;  4M75 E;  3OYA A;  4TVR A;  5FTL A;  2K5I A;  3OMC A;  5IAY A;  3JB9 H;  2BKD N;  5I2M A;  5CKD A;  3DLL A;  2OAU A;  1M1K U;  5LJ3 d;  2LDM A;  2PUO B;  4HA8 A;  1BI3 A;  4XU2 A;  3SDZ A;  4RCB A;  4ZTJ A;  4C5G A;  3OYE A;  1X75 C;  3CCV A;  3ZJU A;  4JLG A;  1TH7 A;  1IZ6 A;  2KQW A;  2Y4Y A;  4IUQ A;  4XQ3 A;  4M7D F;  3HKS A;  2E6Z A;  5LJ5 j;  4HKE A;  3HPW A;  4EDU A;  3V8L A;  3LYI A;  3PT9 A;  4RCC A;  5KE3 A;  3A8H B;  2CZ0 B;  4XTV A;  1I4K 1;  4OGC A;  3G71 T;  3CC4 T;  5LJ5 g;  3TEE A;  2E6N A;  3QXE B;  4C5H A;  3CME A;  2QA4 T;  1QVG S;  1H3Z A;  3TU4 K;  1Y96 A;  1Q86 U;  4M77 G;  2KMT A;  2OTJ T;  2DKG A;  2V8J A;  1WQW A;  4ZN3 A;  2DIG A;  2H3J A;  5GAM h;  4QVD A;  4HT8 A;  1QW1 A;  2EQU A;  2LCC A;  2RJE A;  3ZJT A;  2X4W A;  2YUJ A;  3CBP A;  2DD5 A;  4C8Q B;  2QDY B;  5LJ5 h;  1KQS S;  3BY7 A;  5FRO A;  5CKH A;  5GAO p;  2QA4 A;  1VQK A;  2PQW A;  2EAY A;  1OZ3 A;  2X4J A;  3M57 A;  4DOW A;  4M7D G;  4WF2 A;  3QII A;  5CQY A;  1LJO A;  2QQ9 A;  2EQJ A;  2LCL A;  4OB1 B;  4XTX A;  4M7D E;  2ZPG B;  2RH2 A;  1JRI A;  2MM2 A;  3J80 E;  3C94 A;  4EMK A;  1UGR B;  2JNG A;  4ZGE B;  1CZ4 A;  2HAX A;  1U1T A;  1WJS A;  4IUR A;  2MMP A;  1O75 A;  4Q5W A;  3VUZ A;  4EMK C;  2MM0 A;  4C0D B;  4L5G A;  3JCM c;  5GAN 8;  5EG2 A;  2EKO A;  4J7F A;  3VU3 C;  5LJ3 e;  4M7A B;  3OY9 A;  2K2V A;  3TIW A;  5IT9 E;  4M77 E;  1W2B S;  4F7U F;  1XOV A;  2VXE A;  5A0L A;  3S6W A;  2QQS A;  2CZ1 B;  2L3R A;  4MZM A;  3CCJ A;  2M9U A;  2MWO A;  2JTF A;  2NLU A;  1OI1 A;  1QCS A;  1NZ9 A;  1VQ9 A;  1I8F A;  5GAO r;  1VQM A;  5CD1 A;  2ZPF B;  2M16 A;  2RA2 A;  4E7I A;  3CBM A;  3FB9 A;  3QG1 A;  5J3B A;  1MHN A;  3VYH B;  1QDN A;  1VQN T;  3M59 A;  1H64 1;  4M7A E;  3HRS A;  3RKY A;  3DKM A;  4ARI A;  2XU8 A;  2E65 A;  4PKC C;  3JB9 D;  2XK0 A;  1VQP A;  3GIB A;  2ZPH B;  1OZ2 A;  3OB9 A;  3OMG A;  3M55 A;  2PVO B;  1WJR A;  2LX9 A;  4E7L A;  1K73 U;  4KDI A;  3KUF A;  1CZ5 A;  3M56 A;  3JB9 G;  4B9W A;  3SFM A;  4M77 F;  4O5V A;  2E5Q A;  5CR2 A;  4GLK A;  1YJ9 A;  2K4Y A;  2RI3 A;  4M7D A;  4F7U B;  4FL6 A;  1M8V A;  1I9G A;  1M90 U;  3CMA T;  4KO8 A;  5GLF A;  4OB0 B;  3TRE A;  5GAN 4;  3FPT A;  5GAN 3;  5LJ3 f;  3OS2 A;  4BB7 A;  2GF7 A;  2D0Q B;  3OYN A;  3UWN A;  5A2Q E;  3L2W A;  3CD6 T;  3EAE A;  1HXD A;  5GAN 2;  2LTO A;  1NJI U;  3ASK A;  4M7A G;  3QQ7 A;  3C4S A;  3QBY A;  2VYT A;  2ZCF B;  4KUI A;  5GAN g;  4C92 D;  1GXI E;  1Y07 A;  2KAF A;  2YLB A;  5LJ3 j;  3CCE A;  1NJI C;  2E1H A;  3S3M A;  5I21 A;  1M1K C;  1BKB A;  2EJG A;  4ELZ C;  5GAO q;  1N8R C;  3OS5 A;  3E9G A;  5CVI A;  3X20 B;  3S3N A;  1UGP B;  2EIF A;  2PWY A;  5KCO A;  3V7S A;  1X6O A;  2DK3 A;  4M78 E;  2VGN A;  2HNI A;  5IN1 A;  4BAC A;  5FLX E;  5J39 A;  3JCM J;  3QUI A;  5DYG A;  4P5N A;  5EPP A;  4BE1 A;  1BIA A;  3BW1 A;  3QYG B;  5D6X A;  1CR5 A;  2V8K A;  3MO8 A;  4E47 A;  2PU9 B;  4BI4 A;  2OTL A;  2ZPI B;  5GAN 7;  4RKU E;  3OYK A;  5DLO A;  3A5Z B;  1VQ6 A;  4ATO A;  5FTK A;  4FU6 A;  3CCJ T;  5DLQ E;  3PNW C;  2DO3 A;  3CMA A;  4XU1 A;  5A0D A;  4BDY A;  4KLN A;  5KE2 A;  3QO3 A;  4JRP A;  2JV2 A;  1B34 B;  3OYM A;  3MEU A;  2E64 A;  4M78 F;  4XK8 E;  1VIE A;  3PTA A;  2JOY A;  3CD6 A;  3MEV A;  1D3B B;  2RHU A;  4EMH A;  4JLI A;  5GAM e;  2DZ9 A;  5CQX A;  2PJH B;  1RL2 A;  3PMT A;  4R55 A;  2RM4 A;  3QKJ A;  1KD1 U;  2C06 A;  3HU1 A;  1N6A A;  3M58 A;  3JCM g;  1HK9 A;  2PVG B;  2DTO A;  3CPW S;  4OGE A;  4FSX A;  3MHX A;  4N4I A;  1BI2 A;  3OBW A;  2IVW A;  5D6Y A;  2KVQ G;  2QEX T;  4C92 E;  1VQ7 A;  2ZPB B;  5GMK l;  2XIC A;  4F7U G;  3ZEH A;  3OYH A;  3CCR A;  2RB6 A;  1Q7Y U;  3X25 B;  4LDW A;  4MMK A;  2VGM A;  3WXM B;  1QVF S;  3MB5 A;  3GLX A;  2B8A A;  4O6J A;  3ER0 A;  4J6W A;  4C92 C;  2LT1 A;  2WSE E;  4M75 G;  2V8I A;  3OYF A;  4MZT A;  3E19 A;  2ZGW A;  5LJ3 h;  3FIF A;  4XTW A;  2FVU A;  1QP2 A;  3OS0 A;  1X01 A;  2Y90 A;  3PFS A;  1SSF A;  3RIR A;  4C8Q G;  2O01 E;  1NPR A;  3KBG A;  3L2U A;  4X9D A;  3MCA B;  5HY6 A;  1K9M U;  3OYJ A;  3CCS A;  2YHT A;  3GNF B;  3L2Q A;  3CCM A;  4M7A C;  4OB2 B;  4PJO G;  1V29 B;  2RI2 A;  2K57 A;  4BE2 A;  3JB9 J;  4C92 F;  4J8O A;  3AHU A;  3F70 A;  3X26 B;  2KDS A;  1UGQ B;  2VXF A;  3FLG A;  4RG2 A;  1VQ4 A;  2E70 A;  4NL2 A;  5GMK m;  2EFI A;  2JUF A;  3V7R A;  3JSC A;  1Q7Y C;  4KBM B;  1W4S A;  2XDB A;  4N0A A;  3FPU A;  4ZGD B;  2RHX A;  4BE0 A;  1ZQ1 A;  4LDY A;  2X35 A;  2CGH A;  4N0A C;  2WSC E;  3EFS A;  2K3Y A;  2Q18 X;  4J83 A;  3L1A A;  4QW2 A;  1JJ2 S;  1G3S A;  2R5M A;  1M90 C;  3TCJ A;  1VQ5 T;  2HBP A;  3R6O A;  4PNO A;  5CO7 A;  5GAM g;  3LX7 A;  1S72 A;  2DEQ A;  3UT1 A;  1Y71 A;  2Y4X A;  3PIO A;  3JB9 I;  3CF2 A;  2QXF A;  3BDU A;  1YI2 A;  3BFM A;  3KXT A;  1YJN A;  5CKB A;  4BD3 A;  4NS5 A;  2DTI A;  3QSU A;  2QQR A;  2WSF E;  4FT2 A;  1WQ7 A;  3HRU A;  3L2R A;  4IUP A;  4ZN1 A;  3CCQ T;  4RMO A;  4ME7 A;  1G3Y A;  1NE8 A;  3G6E T;  3WVE B;  3CCL T;  1EIF A;  2QTX A;  3M4G A;  4X9C A;  1YHQ A;  3OYI A;  5GAO l;  3MEA A;  3CC2 T;  4PLL A;  4L59 A;  3JAM E;  4BUG A;  2O4X B;  3P8D A;  3ZBD A;  4KT0 E;  4D6W A;  3HU2 A;  4FM4 B;  4M77 A;  1UEB A;  5M9O A;  3ZJV A;  5FTM A;  4OP0 A;  2EWN A;  1N8R U;  1AHJ B;  1N9S A;  3L2V A;  3VYG A;  3JCM X;  5KCH A;  4M78 D;  2RHZ A;  3JCM Q;  4CQN A;  2EYQ A;  3OW2 A;  1JJ2 A;  2BUD A;  1O9S A;  1VQ8 T;  3QQ8 A;  3UDC A;  3JCM e;  3I56 T;  4MDX A;  5CK9 A;  3G6E A;  1KC8 C;  2GFA A;  2Q1A X;  3MEW A;  3QC8 A;  4A4H A;  4B9X A;  2QI2 A;  3Q1J A;  5CKF A;  1BIB A;  3EFR A;  5FRM A;  2DXT A;  3E9F A;  1M1F A;  1VQO T;  3C12 A;  3QYH B;  4FIB A;  3OQ5 A;  3WVD B;  4C92 B;  1YJW A;  3RKW A;  3CXC S;  3HFN A;  4DA4 A;  3OSV A;  4Y91 A;  1S72 T;  3V7C A;  4KUL A;  1Q81 C;  4FT4 A;  4QVC A;  2DXU A;  3NTK A;  3A8G B;  1IRE B;  3M4Y A;  3GPL A;  2L5Q A;  3G4S A;  5L8R E;  4N4H A;  5FTJ A;  2QQB A;  2RK1 A;  5FU7 B;  1N27 A;  1KQS A;  1I5L A;  4PJO B;  3OYY A;  4KOD A;  4AS1 A;  4MML A;  3QJ6 A;  4XTU A;  4C5E A;  2FL7 A;  1KG1 A;  4HCB A;  5GAO m;  3CCL A;  3FPR A;  2LRQ A;  1FWZ A;  3FEO A;  4LD6 A;  4UC4 A;  2VC8 A;  5GAN f;  3UPU A;  5CIU A;  1Q86 C;  2D9T A;  1E32 A;  4JS5 A;  1Y96 B;  2DIQ A;  2FHD A;  3URG A;  1VUB A;  4BDZ A;  4JUV A;  1OYX A;  3HHT B;  3RKX A;  2A3L A;  2MI6 A;  3HP9 A;  5GAN h;  3CXC A;  2K5L A;  4VUB A;  3H8Z A;  3V8K A;  2CKK A;  1G3W A;  2P0Q A;  3INZ A;  1YIJ T;  3MP8 A;  1WNL A;  4M75 D;  3JCM V;  4A53 A;  2G3R A;  5FU6 B;  4C0F A;  3VJP A;  2YLC A;  4M7D C;  3JCM b;  4II1 A;  2DZC A;  4M78 A;  1YIT T;  3N5B B;  2DTH A;  2JN0 A;  5EQJ B;  2HD0 A;  4M77 B;  1JBM A;  1VQ8 A;  3LHD A;  3NTH A;  3LGA A;  1P92 A;  1BYM A;  1VQ4 T;  2L8D A;  3FRN A;  2P0P A;  4JRI A;  3CPW A;  4N4G A;  4A4F A;  4PJO D;  2QEX A;  2JZ2 A;  2GQV A;  4JS4 A;  1FX7 A;  1WPY A;  3QDR B;  3CCS T;  2AHJ B;  4AQ7 A;  2MWP A;  2DVE A;  1PSF A;  2VUB A;  1VQL A;  2EQK A;  3LGF A;  5FRN A;  3LH0 A;  4LDX A;  1K8A C;  1FXX A;  2PUK B;  2LQK A;  5CAI A;  3CC7 A;  3HSB A;  1YBY A;  4Y28 E;  1S3S A;  4IUV A;  3FJP A;  3LGL A;  3CCQ A;  3O8V A;  2LC4 A;  5GAM f;  3MET A;  2YVL A;  2LVM A;  1G3T A;  2RJF A;  1KQ1 A;  2KY9 A;  2JTM A;  5DM7 R;  1Q82 U;  3X28 B;  3RER A;  1YI2 T;  1XQH A;  2A7Y A;  3L2Z A;  4IUT A;  2FB7 A;  4F7U E;  3M5A A;  3G7Z A;  4HCZ A;  2HQX A;  4M77 D;  4XU3 A;  5LJ5 d;  4JRK A;  3CCU A;  2F69 A;  1VQ6 T;  3OSS C;  4NL3 A;  2OTL T;  3RMQ A;  4C0G A;  2P0K A;  4XAX B;  5GMK e;  1BI1 A;  4C5I A;  4E7J A;  5CCA A;  5DYI A;  3HL8 A;  4C92 A;  2QQA A;  1I81 A;  3FC3 A;  2E10 A;  3LW5 E;  4IKF A;  2WAC A;  5LL6 S;  4M7A F;  4J6Y A;  5LJ3 g;  4R56 A;  1G5V A;  4V2S A;  1VQP T;  4A4E A;  1K8A U;  2EJ9 A;  3G4S T;  3M53 A;  4J7I A;  4ZGJ B;  3OYB A;  2L89 A;  1JB0 E;  3GF5 A;  5D6W A;  5HKC A;  2F5T X;  3QWZ A;  5CCB A;  1UB4 A;  3CCU T;  3OW2 S;  3GNG A;  5C18 A;  3ZFJ A;  4X34 A;  3J81 E;  4BY6 B;  5GAM j;  3A8M B;  1VQO A;  4KDL A;  5HK3 A;  4E7K A;  1Q82 C;  5AYF A;  3DLM A;  1Q81 U;  2E41 A;  4PLI A;  2LNV A;  2HQE A;  4HT9 A;  1ZBX A;  5C0M A;  2DPP B;  1KC8 U;  1M4Z A;  3ZGZ A;  2X4X A;  3LLR A;  5GAN 5;  1DJ7 B;  3JCM h;  3QPH A;  3RES A;  3JCM P;  2ZPE B;  3CC7 T;  2K5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...