4FIDA

Crystal structure of a heterotrimeric g-protein subunit from entamoeba histolytica, ehg-alpha-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
334
structure length
317
Chain Sequence
KPITVMLLGSGESGKSTIAKQLKILFGGGFPEQERATHKSSICSNVVTCMRTLIEQSAILNHPMKYQPKSKEFTTEDPVTLPFSPELVGDVEALWADEGIQATYEESAKFQLPDCAKYLFENVKRIAMEDYVPTEEDLIHNRTKTTGIHEYDFVVKDIPFHLIDVGGQRSERKWVSFFSDVDCAIFVTSLAEYDMKLYGNTSRLTESIAVFKDIMTNEFLKGAVKLIFLNKMDLFEEKLTKVPLNTIFPEYTGGDNAVMGAQYIQQLFTGKLQTEEMNIEKVYTNPTNATDGSNIKRVFMLAVDVIMKNMAANGKMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterotrimeric G-protein Signaling Is Critical to Pathogenic Processes in Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Signaling protein
molecule keywords G protein alpha subunit
total genus 85
structure length 317
sequence length 334
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4fidA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fidA01
1UBGA 1E1RA 3MLEA 4G3XA 3CH5A 4B6EA 2CL6X 3KJGA 1CJMA 2OBMA 3WHLA 1U94A 1U0JA 3T34A 2G9NA 3JZAA 4QKQA 4QJ4A 5C1BA 3FDIA 5FPKA 1X6VA 1A4RA 1X8KA 4P4SB 3VMFA 4DT1A 1QDEA 2WIBA 3WBKA 2QBYB 4XTRA 2FNAA 2REBA 2FU5C 1OLOA 3UPUA 1DVRA 1T8TA 3VR1A 3CWQA 1U0LA 4CT4B 1G8PA 2JLSA 1TU4A 2C2HA 1VIAA 3T1QA 2VP9A 3P4YA 2A5FA 3K9NA 1TL7C 4NH0A 2BCJQ 3UIEA 5JJLA 4B43A 1FOEB 1QG4A 1XPRA 4B35A 3MWLA 1HV8A 4AYTA 1TNDA 4DUGD 1KI1A 4F91B 1W48A 1EWQA 4DLRA 5EP3A 2A9KA 2QSYA 2WAXA 2HLDA 3Q72A 1R7RA 3BB1A 3ETLA 5GJBA 2ZRDA 4HAWA 5A0FA 3AKDA 1E98A 4UNPA 3W34A 3FKSD 1D2EA 3PENA 2V3CC 4HUQB 1E99A 1ZUIA 2J0VA 1H8ED 1N6RA 4UKDA 5FBWB 3IO3A 3FKSA 3OIVA 2YKGA 1DO0A 1D8TA 2QI9C 4I1UA 4JLBA 4JKIA 4ACAA 4OQNA 1OH8A 3QF4B 2OUKA 2QMOA 4TT3A 5K8LA 5ELXA 1KI4A 1P2UA 1BIFA 3KXLA 5FOTA 3VR3A 2GWHA 3RWMB 1OPXA 3F5FA 4M53A 5GVRA 2ZI9A 3TNFA 3NC0C 1KI6A 1VHTA 2P6NA 4URVR 4CF7A 3VNUA 2VHJA 3AF2A 1N0UA 1DAMA 3CRVA 1KHTA 3EG5A 4AC9A 3SHWA 4EPXA 4I4LA 5TB5A 3AF3A 4DJTA 1Z22A 1NJFA 1XXHA 2I4IA 2ZE6A 2IWRA 4RZ2A 4G5SA 3K0FB 1KZ7B 4NCNA 4CGZA 1BS1A 4Q7LA 1KSFX 2W6JA 4Q00A 3SJZA 4PAQA 3I32A 3H1TA 3HPRA 3EA0A 1Z2AA 3QKSB 1IY1A 2NO1A 1XD2A 5HE9A 1NBMD 2AWOA 5L3VA 4IDPA 3LW7A 1OH6A 1GVNB 2IT1A 4QRHA 2XITA 5FI1B 1Y3AA 2AKAB 2WWHA 3TVDA 1R10A 3G5UA 4JLVA 3B1YA 5JZVA 3FB4A 4CRWB 1LS6A 4PC1A 1EK0A 2H16A 1FQJA 3I8XA 4E5UA 1WB9A 1RYHA 1GIAA 2QQ0A 3IDQA 4LYAA 5FOSA 4A8JB 1MRSA 4Q48A 3SFZA 1WXQA 4DCUA 1DAIA 4UXIA 2PLFA 3BXZA 1QHSA 1ZUHA 4JLPA 1ONBA 2O8EA 2JLYA 2JDIA 4ZCMA 5FL3A 4QGAA 1GFIA 5CDFA 3SI7A 1NN0A 3K0EA 4BFYA 4F93B 2YC4C 4ARZB 3KXIA 1XWIA 5TMPA 3E5HA 5C18A 3ZZ0A 1M7BA 2XJ4A 3ZVRA 2IXEA 4XSHA 3IIKA 4M8NE 4F4IA 2NZJA 3K70B 1KIMA 1J8YF 5HZHA 5JJIA 3SR0A 1K8RA 1N0VC 1KI3A 1XEXA 2WOJA 3TIFA 4U7DA 4DCSA 3ICQB 2RHMA 2CJWA 2IX3A 2ZSFA 3GLGE 1PV4A 4KCGA 1MKYA 3B5JA 2Q9CA 1F6BA 3UG7A 3GPLA 1L8QA 4ZDIA 5HKKD 2WZQA 4MRNA 3T06B 3M6AA 1GL7A 4R2HA 3QKRA 1Q1BA 3QY0A 5CYOA 3G0HA 3BIFA 4QNRA 3AP3A 4IXMA 2AXNA 3X1DA 4Z51A 4AY2A 3FVQA 2ZYUX 1M1YE 3BERA 3WNBA 4DZZA 4IVPA 4JKYA 5TV2A 3R9XA 4TYWA 2WJHA 1EG7A 4MH0R 3GJ6A 1XX6A 4UXJA 3VFDA 4DCVA 5C4GB 2O8CB 2PCLA 3MFYA 4WBSA 1UADA 1AS2A 1KDTA 4HZUA 2IEZA 5KU1A 4B34A 4BFSA 3B1VA 4X8LA 2VH5R 2JJ2A 3GLFE 5FL7D 4Q4HA 2C9CA 2QEQA 4A8JA 3U5ZB 3NVAA 2FGJA 4B76A 5KOYA 4FWIB 1WBDA 3HWSA 2C96A 2RCNA 4JL5A 3N2IA 3VR5A 2QTFA 2RAPA 4QBFA 1F3OA 1KMQA 5LB4A 1M74A 1JBKA 3EIEA 4V03A 1XMVA 1H65A 1OB2A 2FV8A 3KB1A 1KO5A 1IBRA 1NVXQ 1JECA 3QXSA 1SULA 3Q5EA 2ZREA 3H0KA 2RGGA 3VKWA 2QE7D 3LD9A 3U7EB 2BC9A 4LHYA 2DWOA 1Q44A 2MSCB 4C2TA 1CJTC 1EFHA 2AD5A 1U8YA 1XCMA 2AFIE 3R8FA 3AGQA 5D3QA 1BMFA 4HLCA 1US8B 2Z5FA 5H70A 2EU8A 5JS7A 3NDPA 4YC7A 4L15A 5BN3A 2RGNA 3Q5DA 4RZUA 2BVNA 1XDBA 5BWMA 4WXPA 2BEKA 4RD3A 2OEPA 4LJ6A 3C41J 2IUSA 1G3IA 2WV9A 2A5YB 3MG9A 4JBYA 4Y0VA 4Q9LA 1NY5A 2EYUA 3AP1A 2GBLA 1R4AA 2JCSA 3MWYW 4EJSB 5FOXA 3M4YA 1E9CA 1MT0A 3N5CA 3RS5A 3X1ZA 4LPKA 5DYGA 4RKEA 3A4MA 3QKRB 3UWKA 1AZTA 2V6IA 1IHUA 2QMHA 3DVLA 1M2OB 1L7VC 4GNKA 3JZMA 2J0UB 2ORWA 4Q7MB 4ILEA 1G6HA 1RIFA 4TLCA 2O0KA 4KBFA 1Z6AA 3CRRA 2ONJA 5CLLA 1ZCAA 2O8CA 4EAQA 5FR2A 4C0AC 1FZQA 1NN1A 1YE8A 2DCUA 5KSOA 5FPHA 2WKPA 3U3OA 5KNCA 4Q7KA 4E03A 4V0KA 2I1QA 2VP0A 2EFDB 3ZZTA 4G5QA 3B9PA 4XJXA 1M34E 4C3ZA 1ODFA 4JT2A 1JPNA 4IEIA 4TZ0A 1ZW6A 1GAJA 3SBDA 4A0RA 4DSUA 1W2HA 1OFHA 1DBSA 2ZSAA 3PCRB 1J70A 3PV0A 2AX4A 2MSEB 4LI0A 1II8A 2FDCA 2QRZA 1D9ZA 3K70C 3LRPA 1NLYA 3QEOA 4GFDA 3RVBA 3GJ7A 4DDVA 3HJNA 2MSDB 1W36C 2FFQA 1R5NA 1X3SA 1ZNZA 3ASYA 4MGZR 2JLWA 3UKDA 2R6CA 4DBLC 4XVRA 1ZM9A 4OHZA 2ZJBA 1JB1A 2UVQA 3U7FB 5ANRB 3RC8A 2CJWB 1US8A 3H4MA 3PG5A 3AVYA 3CF2A 4MA4A 3QG5A 5EZ5A 1UDXA 3AVVA 3HPQA 1W1WA 1W47A 2OFWA 2C99A 3K9LA 5F98A 5GJWC 1TQDA 3IEVA 4PAOA 3LH5A 2FFHA 1XU4A 4IOLA 2ZSEA 4YMWA 1S2MA 2FZ4A 3KJHA 3EXAA 4DCNA 4BQSA 4EQ6B 3GJ3A 2QTVB 1CULC 2ZQ5A 4X8HA 2GF0A 1BYUA 1KKLA 3OE7D 3I3SR 1WA5A 2WJYA 3U61B 1AS0A 2AD1A 3RHFA 4A4DA 4XVUA 1OF1A 4LJ8A 4Q1CA 2ZAOA 1NF3A 1NLZA 4GZLA 4B2PA 4EPYA 1E2HA 3Q85A 4RCYA 5JRJA 4GP6A 2ZJ8A 1I2DA 3K1JA 3VAAA 3CF0A 3GLIE 3CRMA 4Y0AA 4D26A 4KBGA 4K46A 3SNHA 2MMGA 4V0OA 2A2ZA 1SVMA 2A7QA 4F38A 3DOEA 3OESA 3AVXA 3K09A 4FCWA 4JIMA 3L8YA 3IBYA 5FFMA 3T1VA 2OCPA 2ZI5A 4DB2A 4P4UA 2GCOA 3Q8XB 2R6AA 2ZUDA 4DLZA 2FZLA 4FI3C 1XEXB 1FL9A 5JLJA 5JJKA 2X19A 1A5TA 1KO7A 3GLHB 4KAXA 2ASEA 1MRNA 1OIXA 4I81A 4D82A 2OBNA 2GEDA 3P4XA 3RAPR 3BFXA 2KSQA 2W83A 4OJQA 2ZPTX 3TSOA 3ZQJA 3ECCA 4AURA 2OAP1 4IJMA 1N5IA 4NMMA 2H1LA 2XNDD 3KKPA 1SVKA 4JBWA 3BC1A 2WWIA 1E2FA 3PUZA 1EESA 3RS0A 4BASA 3IGFA 1H8HD 2AK2A 2BMEA 2MMCA 1F5NA 2G6BA 3LBIA 1SKYE 2IYQA 5IRCD 4MDFA 1N5LA 3EA5A 1LW7A 2JLVA 4PC6A 3F0TA 5CIWA 2G1KA 4YMSA 4BEJA 4U02A 4JVSB 1RRPA 4GRAA 3IO5A 4HZUB 4TMZA 2B8WA 4MRVA 4A2QA 2IWHA 2ZJZA 1S0UA 3PQCA 1ZM2A 2AXPA 5HE8A 1MH1A 3IHLA 1A82A 2PEYA 4Q5IA 1YR8A 4Q19A 4LOAA 5J47A 1XFAA 1AKEA 2W2TA 3MRSA 1SZPA 4G1UC 2GXQA 2ORVA 2QPTA 4D0GA 4BZXA 3U7GA 1VG9B 3BFKA 3QIAA 4TSFD 2VLIA 1XTJA 2YZ2A 4RD0A 5G3YA 3TGPA 3KQUA 4QXAA 4V0LA 5AUQA 3DMNA 4DDUA 1UF9A 3B78A 2GAOA 5E3HA 2PCJA 4LJ7A 2HCBA 4G0NA 2GVZC 3PUXA 1YZLA 4ACBA 4A8JC 4EPRA 4Q4JB 2IXFA 4FCTA 5C46F 3IPXA 5DLQC 2IS2A 2RGBA 4B3CA 1E2EA 5JI2E 4TYPA 2DPXA 4IDNA 4OHXA 2D74A 3EASA 3AM1A 5JWHA 4LCBA 1OKKA 2ZS9A 4E07A 1OXSC 4ZV4A 2IS1A 1S9DA 1G5TA 3AUXA 3IIJA 3MSXA 4BEBA 3W9YA 1G3RA 2ORIA 3AP2A 2BDTA 4HB0A 5TY0A 1SVLA 3GP8A 2O8FA 1GL6A 3V4RA 4EFLA 2ZYTX 1XMIA 1RRCA 5JCZA 3QXHA 2A3RA 1Z47A 2DFKB 3AB3A 4HI0E 4D6PA 2UZIR 5CITA 4AKIA 2YWEA 3K0CC 1YR6A 1PJRA 4KSBA 2C95A 1L4YA 2CHVA 2KJQA 2ZI6A 4UJ3A 1I4LD 2V4ZA 4PC2A 3WP0A 2NMVA 2YHSA 4XWKA 4URYR 4HB4A 3FYHA 4XVQA 2YINC 1QHIA 2IL1A 3MMPA 3NIBA 3QENA 1DAHA 1Q3HA 1JQLB 1DAEA 4BFUA 1E2MA 2OG2A 4G01B 4AYWA 4PC7A 1GKYA 4UJ5A 4EFNA 4CT5A 2P2LA 1QVAA 4LWZA 2BHRA 1AQUA 4BLOA 4LYJA 2CHQA 1FMJA 3QVUA 2YOGA 821PA 2QAGA 5KNDA 3TUJC 2H8KA 2GCOB 2VF7A 1UEJA 1N5KA 4LSGA 1SXJC 4G5OA 3SZRA 3W6OA 1NJGA 1VHLA 4QBHA 4FXPA 3EC1A 1KDRA 4ZDJA 5B58C 4D4MA 1O87A 4XWAA 1R0XA 2D2FA 1VIYA 2DFLA 2QP4A 1G9XA 1KKMA 3DO6A 3KUCA 1PVOA 1T3LA 5AK0A 2BIFA 3TJZA 3QBTA 1P9NA 2ERXA 2QP9X 1SKYB 1TPZA 3KKNA 3C7KA 4B71A 2AN9A 1NIPA 3CONA 4FD2A 3MGCA 4WZBE 5P21A 3S1AB 1VYUA 1GUAA 4A0GA 4OBEA 3WRYC 2B6HA 4L5BA 2W6JD 4LK2A 1LV7A 1IOZA 1XEWY 3LXXA 1TEVA 3K0CA 2C77A 5EQTA 3UMRA 3EIQA 4NHOA 2RKOA 4FW9A 4PQYA 1BO6A 1I2MA 2EQBA 4TMKA 2ONKA 3FFAA 1E9AA 1OFTA 2P0EA 2VPPA 3TRFA 2W58A 1YZQA 5CM9C 1U8ZA 2R65A 4LC0A 4Q47A 3EWAA 3D31A 6Q21A 3AVTA 1CS4C 1KK0A 4OI4A 3RDPA 4CEIB 4Z8XA 5FBVB 2KB0A 3LBNA 3PUYA 3TUZC 3BH0A 2CXXA 1KJWA 2W0SA 2NPIA 4QFMA 1XJ0A 1E2DA 3OE7A 3IEUA 2FOLA 4DLWA 2J46A 3KFVA 4GMDA 3R20A 5EJEA 3MUFA 2XXAB 1G64A 1NVWQ 2CLDX 4RD4A 3QSYA 2KBFA 3EAQA 4LJ9A 4ON9A 1FW6A 1X1SA 3PEYA 1FPMA 2AFHE 2QUZA 4ZPXA 3AEZA 2REOA 2ZUCA 4DSTA 1SGWA 1E9DA 4YLGA 4PHHA 2IF2A 1D5CA 4XTCS 621PA 1K5GA 1ZMXA 1E1RD 4FCVA 4OK3A 4PHFA 1XTSA 1CJVC 2ZE5A 5DH9A 4US0R 2E9SA 2XSZA 2ZSBA 5H68A 2OO7A 1DOAA 2CCKA 5EUQB 2OCBA 3BAFA 3OEEA 4XOIA 4BLRA 2HT1A 4OL0A 3D6TB 4ASUD 5KHOC 5KNBA 5JECA 1NN3A 3KX2A 4C2UA 3CO5A 4DCTA 4TLEA 5EZ6B 2CLSA 2C03A 4JLJA 1J90A 1QRAA 5EE3A 3OHMA 2CHGA 5UKDA 4N1AA 4K8OA 4TL7A 4H1VA 2QZ4A 5G41A 3SJAA 3U6KA 4WAUA 1M8PA 1QHYA 3IQXA 2BM1A 1OXXK 2O8DB 2Y8EA 3EC2A 2WSMA 3TUIC 3RC3A 5E7IA 3BH7A 4KFTA 3QF7A 2JJ2D 4I99A 4MGIR 2PH1A 3KQHA 3I5XA 3TW8B 4LBWA 2CE2X 3L2OB 5G40A 1PUIA 1KSHA 4TWZA 5DI9A 4NU0A 1E1QD 1KSJA 1ZP6A 4EIWA 2YV5A 4BPBA 1E2QA 4W7SA 3FOZA 1NRJB 3C5CA 3P1JA 3K9GA 2ZYWX 3KXKA 4AKEA 4Q4JA 2C9YA 2NZ8A 1JXMA 1E6CA 2GJKA 4TMXA 1YRBA 5C4MA 1S4QA 4R9UC 4DLTA 5EXXA 3TK1A 4NONA 4LUCA 2AKYA 1U9IA 4TQ9A 1CEEA 3TAHA 5AJYA 2GJ8A 4CZ2A 3FHTA 2WBLC 4IW3B 3FMOB 5D3MA 2ERYA 2ZR0A 1EWRA 3SHFA 1VCOA 4IKEA 4G5RA 2F3RA 4Q4LA 1RPZA 4L4UA 4JLNA 4FN5A 2IYSA 2YNMA 4HAZA 2ZS7A 1OH7A 1N25A 4JVNA 4DHEA 3TSZA 5J4KA 3N2EA 2EWWA 1AQYA 1CJUC 2RB4A 2R6FA 4DDWA 4A15A 1R5OA 1P60A 1P9RA 2OCYC 3THYA 4C0JA 3NH6A 3GJ4A 1NVUQ 4BFVA 3THWA 1Z0FA 1NL3A 2PEZA 1NVVR 1QBKC 2O0HA 3CX7A 2C98A 2QPAA 1PLJA 2J0SA 3OIYA 1VPLA 2JATA 2PZFA 1OKKD 3LQRA 1XCPA 2R6GA 4U00A 1QVRA 1Q1EA 1KO1A 2ZRKA 4RCZA 3X1WA 3ADDA 3T35A 4LGMA 1OB5A 4HYYA 1HT1E 3KJIA 2VP4A 4M9XA 1G6OA 1G1MA 1TX4B 2Q0HA 2VRWA 2F55A 4O3MA 2ZU0C 4R98A 4MGKR 4JYBA 1JR3D 3DEFA 3LO5A 4Q1FA 1HEIA 5E95A 1KAGA 2D4HA 1IONA 4LC1A 4LV6A 2X8AA 3LAWA 2IK8A 5F2EA 1FTSA 3ZLJA 3V00A 1GZSA 4BRUA 5BYJA 1CR2A 4FMDB 2OFOA 3KB2A 4B48A 2EFCB 1Z6XA 4B3FX 1AGPA 3BH6A 4P0TA 3FFBA 3CPJB 4DLUA 2JLXA 1AIPA 3A6PC 1P61B 2V9PA 2DFNA 2NO7A 1NG1A 4WVFA 4NYJR 3EPJA 1Z6GA 1WCV1 4DT1B 2HCJB 2JLQA 4DUGA 2JASA 1FNNA 1KO8A 1QF9A 1R8QA 3OAAA 1G18A 1TF5A 1DS6A 1CIPA 2VHCA 3KDSE 5KPDA 1VMAA 2D62A 4IHQA 4TL9A 2ZEJA 4I1OA 5GVSA 1VG0B 1W4AA 2G0TA 3THYB 4IFEA 4MGYR 2GHIA 3EZ2A 3D3QA 1LF5A 3THWB 2FF7A 2ZS8A 3CWZA 2CNWA 3QUSA 5L3QA 2XAUA 2RH5A 3LNCA 4KYUA 5JBQA 2OESA 4QM7A 3NBZC 2QROA 1U9IC 1JXOA 3WBJA 1HT2E 1T3SA 3NG1A 3WMEA 2CBZA 5KO2A 1NP6A 1XBTA 1J8MF 4DLXA 4QJ5A 2OSBA 2PJRA 5SZHB 4N0DA 2IYTA 2VSOA 1TU3A 4M1OA 3EPLA 3C5HA 3Q7PA 1UM8A 2A30A 1YQTA 2JAQA 4MYTA 1AKYA 2KBEA 3DZDA 4ARZA 4D4JA 2DR3A 1TUIA 4IEEA 1NG9A 1J2JA 2HEIA 3WNCA 4BFXA 4DEYA 4LY6A 4D80A 1N0WA 4WIAA 1AJEA 3U60B 2V6JA 1P9WA 2QNRA 2WWXA 3GLHA 3HU3A 4MUAA 5G53C 4DC9A 1W7AA 1KI2A 1Q1QA 4A36A 2WAYA 4NYJQ 2R62A 2IYLD 4BGDA 2GILA 1W2GA 2XOKA 2FH5B 1ZC3A 4M1KA 3QVVA 5A5GA 1OYYA 4M2LA 2FJUA 3AVOA 3AF0A 1GKIA 4US1R 4I1VA 1XXHB 2XZOA 2VIIA 4OJKA 4KLNA 2VHTA 4HAUA 2ODEA 1LNZA 1J7KA 1UJ2A 5DHFA 5KSPA 3VKHA 4BECA 5H8WA 2ZANA 2CVFA 4S2EA 1SHZA 4RD2A 2WIAA 3WXMA 1T9HA 2GKSA 4QG7A 1P2TA 1BH2A 1CRQA 1ZIOA 4C0QC 4A2WA 1G41A 5AWFC 2QGZA 3O8BA 5JHGB 5HZKA 3CIOA 4UXHA 4LYFA 2QMUA 1WE2A 1W0JD 2QT0A 4V0NA 1OIWA 3AUYA 2ZJYA 4M9QA 1V5WA 3SJCA 1GRQA 4LRWA 1K6MA 3OEED 4NCIA 1N6KA 2WVJA 4TMWA 3A1SA 1UKEA 1UEIA 3I8SA 4IDHA 2O8EB 4IOMA 4Q4HB 3ZVNA 2CL7X 3TLXA 4EPVA 1KK2A 2F3TA 2F43A 2QM7A 4M9SA 3LX8A 1CTQA 1Q3TA 2J9RA 2N42A 1FUUA 3AKCA 2O5VA 1QHXA 1W0KA 3KQKA 2WICA 4KJZA 3I62A 2A5JA 1HQCA 5K8UA 3KQNA 4TLAA 2DBYA 4HEJA 5KDLA 3QNUA 2QT1A 3PEWA 2H5EA 4A82A 2IHYA 4PANA 4W5WA 1LTQA 2ZE7A 3WYAA 4QHYA 3AQ4A 2J87A 1W36D 1TAGA 2GRJA 3CBQA 4S35A 4V02A 3ZH9B 2VBCA 2LWIA 4NBSA 2FA9A 1LY1A 3ZDQA 3F8TA 1OXTA 3ASZA 4BLQA 5BYKA 4Q03A 4Q9IA 1EGAA 1T0HB 4LJ4A 2H18A 3ADKA 1UPTA 4P31A 5JSZA 3T5DA 2O8FB 1ZNYA 5A4JA 1ZVQA 3K0AA 2RGAA 2F9MA 1UBFA 2GAAA 2QM8A 3CR7A 4L8GA 4UNRA 2IUTA 4EFMA 4V0ME 1ESNA 1SVSA 3BS4A 4XD7A 3R7WA 3I5YA 3VKGA 3P27A 3BRWD 3KKOA 1BYIA 1RFLA 1ZNXA 3I92A 2OLKA 4TQUS 4C0HA 4KFSA 1SXJE 1VG8A 2IYYA 3LLUA 4IDQA 4GI7A 5SZIA 4WZAE 3VQTA 5JRZA 3U6BA 1KMHB 3ZD7A 3E2IA 1G3MA 1W4RA 1Z5ZA 5CJPA 4UQOA 4EPWA 1W49A 4LHZA 3V4FA 5AUNB 1XEFA 1C9KA 2QAGC 3REGA 4JBXA 3DOFA 1T5LA 1Z0IA 5K8IA 3CNNA 3RLFA 1WBBA 2J3EA 1IJFA 1PZNA 1R5BA 1M7GA 1COWD 4A92A 3C15C 2IA5A 2DY1A 4D2IA 2G1JA 2WSSD 2IYXA 2ZITA 4O2LA 3SS8A 2BMFA 4HUQA 1G5RA 3KL4A 4TMTA 3WYGA 1E0KA 2DHRA 4M1YA 3A1WA 2QTHA 1NSTA 2D7DA 2XB2A 3OZXA 3B13B 3HP1A 4DVGA 2AL7A 2R9VA 3HR8A 2ZU6A 5CJ2A 1E2PA 4TLDA 2EYQA 2QGNA 5DE3A 4TL6A 2X77A 3C8UA 2V54A 3GEIA 4EJSA 3VNVA 3MAAC 2GJ9A 4WA7A 1DELA 2PJZA 5KYKA 5BXQC 3U7HB 3LWNA 1YZKA 1NBMA 1FP6A 3FMPB 4TTPA 3K70D 4MDEA 4PX9A 3W6PA 2DYKA 2QA5A 3L0SA 3I73A 2D7CA 5KDOA 1NN5A 1GILA 3W3ZB 5C2JB 2P6UA 2GTPA 2WKRA 1R0ZA 1UFQA 3T1TA 1NI3A 1G21E 2R6DA 1PLLA 3SC3A 4JJZA 421PA 2Z43A 1R8SA 4OYHA 4QGHA 4WXRA 3SOPA 2VSFA 2BKEA 5J4YA 2FSIA 2FMXA 3CRQA 1KMHA 4CEIA 1ZINA 3ZYCA 4AG6A 4PO1A 4HLUC 2QAJA 1ZU5A 3UMSA 3CKLA 3GLFB 1MO4A 2OXRA 3GMTA 5KSYA 4H9GA 2VSXA 1TMKA 3WMFA 2V1XA 1KTVA 4BFWA 1L4UA 4GT1A 4ZI3A 3TMKA 1KJYA 1S96A 2VO1A 2XEXA 5EP4A 4PXAA 1JNYA 1G8FA 1UBEA 4MQBA 4OHWA 2GF9A 3VX4A 5HCNA 1TF2A 1AN0A 3U3MA 1KZGB 4Q1EA 1HA3A 2QP3A 1NMZA 4Z54A 3BGWA 1KK1A 3KTAB 5AR1A 2YVUA 4KFRA 2GESA 4MITA 1G8HA 2GZAA 2PL3A 3RRMA 2CMKA 3VR6A 3VHXA 1VYVA 4D81A 1ZU4A 3NEJA 3JVUA 2NO6A 4DSNA 4MRSA 2GCPA 5TARA 2ZRGA 2J7PA 3GD7A 4LHVA 1IXSB 1RKBA 2A5DA 2ZTSA 1P4SA 1J99A 3Q9LA 3NC1C 5HCIA 1DARA 1GITA 4P33A 1X8JA 1EFCA 1IN7A 4RKFA 4JSTA 2JEOA 3QBVA 3D7MA 2ZR9A 1I4DD 3FPAA 4KFUA 4QGFA 3QE0A 3TR0A 1FX0B 1P5ZB 3RS3A 3CR8A 3GCGA 3LV8A 2W2VA 3NBYC 5BN5A 4DB4A 1UKYA 4BLTA 3THXA 1IN5A 1XCGB 4KYIB 4KHZA 3A36A 1E9BA 1H8HA 4IFBA 2FFBA 1XB2A 2CK3A 2ZE8A 3BWDD 4JS0A 3M1IA 2X2EA 2ODNA 3DDCA 5JFGA 1ANKA 4XSGA 4Q1AA 2J0QA 3QKUA 2GXAA 5EP1A 1Z08A 2EFEB 2GETA 3HYTA 3MWJA 2IBMA 4PO9A 2V55B 2ZRCA 1G20E 3RRZA 1E3MA 3O8CA 1E2LA 5J4HA 4LZZA 4F7WA 3LY5A 2HJGA 2OLJA 3GFOA 721PA 2DFTA 2PX0A 3H84A 5TDHA 4NL4H 1NNEA 1OYWA 2FX3A 2QE7A 2XZLA 2W0MA 3E70C 1G7TA 1JR3E 1E4YA 2D3WA 1OHHD 2WMOB 3B2EA 1COWA 2FSHA 5BW8A 3O8RA 3AV0B 1H8EA 3UK6A 1KI6B 2DWPA 2QG6A 2ZRAA 3LBHA 4BZPA 1AK2A 3BOSA 2D06A 4PHGA 1SXJD 2KI5A 2BEJA 4R2IA 3VR2A 1I4TD 2A78A 2GBLC 1CP2A 1SXJA 2PZEA 1V43A 4PPFA 4CEHB 1A1VA 1AS3A 3GFPA 2WTUA 4HATA 4B44A 5JSZB 2Z6VA 3K0FA 1IJEA 1MO6A 3QG1A 1NIJA 2PMDA 3ADCA 2CNWD 3A4NA 1W0JA 4TZ6A 1NMXA 4GOJA 3GLIB 4C7OA 3Q3JB 4JMPA 5FOWA 5JI3E 4B47A 1A2KC 4A0FA 3R9IA 4FMCF 1G16A 3L8ZA 3BBPA 5EXPA 1NY6A 1E9SA 4B3BA 2ZJ5A 4NP6A 4Q18A 1G4AE 5CK4A 3RSLA 2IUUA 1GOTA 4OK6A 2UKDA 3CZPA 3B7GA 5J4LA 3K09C 4RFSB 3THXB 1E2NA 5L3QB 1VECA 2GZDA 2J0UA 4ZDWA 3OEHA 3A1UA 2ZJOA 4JLAA 1D6JA 4C0BA 1UKZA 2WWYA 3ZS8A 3GLGA 3GJXC 1R0YA 4M22A 2IXGA 2CCGA 4M1WA 4LJAA 2B21A 3A8TA 1KY3A 1OFIA 1P73A 1YJ5A 3AKYA 1EX7A 2HXSA 4KO8A 1ZJ6A 2P3SA 2YWGA 5L3SA 3BK7A 4YDHB 1W46A 3M0EA 1VTKA 4CDGA 1XXHE 3UXMA 3GJ0A 1JEEA 3W6NA 3NBFA 2GEUA 3QPUA 3FMIA 4NZYA 1N6NA 4DLSA 1XPUA 3ICEA 1W5SA 1JEDA 2CE7A 4EUNA 3U3KA 2VP6A 4DWJA 1E0JA 2HXYA 1Q21A 2J41A 5EE5B 4AWXA 4URUR 1W5TA 4BWYA 5IHPA 5J4VA 2EFHB 3CRW1 4PC3A 1DE0A 1FUKA 2ANCA 1EFUA 1SQ5A 1WMSA 1T0JB 4RY2A 5LDDC 5JEEA 2PX3A 3KUDA 2VA8A 1VCMA 5EXSA 5EXTA 3QQ5A 121PA 1A2BA 3L0IB 2VYFA 2WOOA 2X2FA 3L0OA 5FPSA 4B74A 4II7A 3W5JA 1SVOA 2CCJA 4A0HA 4M4SA 4JLOA 1ZD1A 4F92B 4OHYA 1TQ6A 4OKSA 2Q6TA 4TYQA 3B1XA 4P4SA 4PFSA 2O52A 1XD9A 4RZ3A 4A2PA 4Q9JA 5G3ZA 1E0AA 2JJ1A 2ZRIA 3BB3A 5GADl 1W4BA 3ONWA 1ZC4A 1CBUA 2FE4A 2N1BA 1UDWA 1CU1A 4JLDA 2Z83A 5HTKA 1EFTA 2PBRA 5E7MA 2FFAA 2BM0A 2ZRLA 3NHAA 3EX7C 1GNQA 2ZRJA 4ASUA 3AVWA 3KJEA 2HT6A 4TLBA 4KITB 3TBKA 2YWFA 4PSKA 5FUYA 4IVRA 4FINA 4O25A 2RMKA 2XZPA 5GJCA 1GL9B 1ZUNB 4ZCIA 3I4LA 4POAA 1KAOA 1TQ2A 2F9LA 3SFVA 3HYRA 2GK7A 3CNLA 2V7QA 3GLGB 4B3XA 4JLKA 1E94E 1ESMA 3KKQA 1YR7A 4OQXA 3U3RA 4GMXA 1ZYUA 2WM9B 1HTWA 3RWOA 2GEVA 4N0EA 1Z07A 3ZS9A 5DI3A 4M1TA 3ND8A 1QZXA 2JLZA 5DO9A 1P62B 4OQLA 1KDOA 1SHKA 2SHKA 4WW0A 4Q1BA 5FBRB 5CM8B 3SQWA 4QHSA 4P3YA 3T15A 2NGRA 5DN6A 4NDZA 4IVQA 4Q4AA 2ZRBA 3ZVLA 1EFRD 3G82C 3B85A 5FTJA 2EVWX 4H1UA 4DRZA 1TQ4A 1SXJB 4CEHA 3RANA 3MCAA 2C5LA 1YVDA 3RSOA 1HYQA 3FGNA 1EFRA 2REXB 5IT5A 1YZGA 2B92A 1KY2A 2JGNA 3KZ1E 1S3SA 1U8AA 3C16C 1E79A 1N6HA 1Z06A 2FG5A 3EPKA 2IW3A 1P6XA 1X86B 2G77B 3KFXA 5H1YA 1GKUB 3UG6A 1Z83A 1E0SA 4JLMA 4QC2A 3LVRE 4TL8A 5GJVC 3K53A 2ZSDA 5CB6A 2RHDA 3PEUA 1RRFA 1YR9A 2GXSA 3R7WB 4RD6A 1XD2B 4PSVA 1GWNA 1Z6YA 1E2JA 1R2QA 2JJ8A 2QORA 1VCIA 2RGNC 4NYMR 4PHTA 5KTYA 1CXZA 5L8VA 2J7PD 3LFUA 1JALA 4ERNA 1GNRA 1KO4A 4B73A 3PUVA 2TMKA 2QL6A 3F3YA 2OV2A 3SYKA 1JQJC 5FTKA 1KYIA 5LBIA 3T1OA 2V1UA 4FIDA 1ZRHA 2ATXA 1OFUX 4DIEA 1XZQA 3ZD6A 3CUEF 3RRNA 2OT3B 3SJBA 3W5IA 1Z3IX 3NDBB 4HLQB 3QPWA 1A7JA 1CR1A 2AK3A 4TYNA 1F60A 1G7SA 4QHTA 4B3GA 4Z8YA 2Q9AA 4US2R 4RJLA 2G88A 1VDZA 3DPUA 1IQPA 2HJVA 2OXCA 1Z8FA 1ZD8A 2BMDA 4HB3A 2ZETA 4TQAA 3ZQ6A 4JL6A 4NYIR 4Q66C 2FEOA 2ZJ2A 1KI7A 1N3BA 4ESHA 3QEJA 1LF0A 1E96A 5AJWA 4W5HA 2A5GA 5FR1A 1KDPA 4M1SA 4W5JA 2H92A 4B32A 4Q4AB 2IEYA 2ZROA 1RRGA 3IHWA 4HDOB 5KPJA 1AGRA 1E69A 3U3JA 3EIHA 3UATA 4PZZA 3CH4B 4NTZA 5JWRA 2HDNB 2J45A 3BORA 3RS4A 3OFNA 3VHLB 2IF0A 4DSOA 1G19A 4UNQA 5LB2A 4NKRA 1LVGA 4XD7D 4O2RA 4A6PA 4JZKA 1HQYE 1U81A 3B1ZA 5EP2A 5M04A 1Z29A 2O8DA 2C8VA 1QHHB 3OAAD 3TQCA 3WNDA 1R6BX 2WJIA 1U99A 3FE2A 4QGGA 4KU4A 1K5DA 5IK2D 1Z2CA 2CEAA 4TYYA 4RD1A 1G4UR 4C30A 3K8YA 3RS2A 1G291 4QL3A 4LJ5A 1FNMA 4LHWA 2HLDD 5LD2B 5IK2A 4LHXA 5JWOA 1G8GA 1SVIA 1ZCBA 5DGXA 4TT3D 2LKDA 3OIUA 2J59A 4LV5B 5FBQB 3ZJYA 1XD8A 3UWOA 2GCNA 3Q7QA 2V8OA 4C0KA 3QXXA 2BBWA 2J7KA 1X8LA 4QNMA 3U4QB 1RE0A 1ZIPA 2NTYC 3GFTA 4L16A 4BFZA 3AVQA 3QPVA 4ZO4A 3FHCB 5DI3B 3WHKA 4DXAA 4HUTA 5E4FA 1E9FA 2PT5A 4KODA 1G3QA 5FOUA 1CRPA 3TH5A 2ODBA 3CPEA 3LXRA 5CYPA 4EJSC 4QBGB 5E7JA 1T6NA 2OAQ1 2QAGB 2WPDD 3CZQA 1JR3A 5FTLA 5HKKA 4F4JA 4YMUA 4JJKA 2FEMA 3SYNA 5AUPB 3J81k 2ZRFA 2ZYVX 3PEVA 1EXMA 3KTAA 4TTQA 4TN1A 5KDDA 3PITA 3BD9A 3R9WA 4AK9A 2IYWA 3PXGA 4FMBB 1DG1G 3TE6A 1L2TA 1R0WA 2VQSA 5DN6D 1E2GA 1YZNA 2HF9A 2WJJA 3DMDA 5FUVA 3W8NA 1G17A 5DIFA 3T5GA 4PZYA 4X8MA 4ZI2A 4Q7JB 3LVQE 1DAKA 3S1AA 1XNJA 4FMDF 4DKXA 3U44B 1VYTA 4L9SA 1OV4A 4PPQA 1S1MA 2IC5A 5AJZA 3KKMA 4IOJA 2Z0MA 4X8OA 2RGCA 2L0XA 1OJLA 2IS6A 2JDID 3O8DA 3ND9A 1NMYA 3PUWA 3TQFA 1OH5A 3ZVMA 3X2SA 4KSCA 3NTUA 2WWGA 1N6LA 1UBCA 4GOXA 1QHGA 1B0UA 4HB2A 1LS1A 3IKJA 1XTRA 5FI0B 1E32A 3OIWA 4EPTA 1RVDA 3CPHA 3IPYA 1U98A 4UNNA 2QN6A 3A58B 2EFGA 1Q0UA 1WRBA 2B7CA 4LJYA 1DAFA 2FPMA 2VF8A 2DB3A 2D2EA 3B8HA 3VR4A 1YKSA 2YOHA 2HF8A 2VP2A 3FMFA 3MJRA 3U2QA 1P72A 4LDJA 3U4QA 3I61A 5JEDA 1TTTA 2BMJA 3X1YA 1XRJA 1WF3A 2W6IA 4Q1DA 1RW4A 4A6XA 2ZI3A 2KE5A 2P67A 1JI0A 3I72A 3SN6A 1MABB 3NEYA 5JHHB 1W36B 4LBZA 1ZM3A 1KJZA 2DWQA 3RS7A 2HV8A 3LDAA 1M6NA 1OSNA 4NCKA 5J5CA 4QJ3A 3EZFA 3EZ6A 5IF9A 3LQQA 1D2MA 1NSFA 4A1FA 4PQRA 3BJIC 5IDVA 1MR3F 1OT3A 2PMKA 221PA 2IYUA 3RYTC 4DLYA 5JMTA 4OI1A 3NHBA 1HE1C 1ZD9A 2R8RA 3GLIA 1WP9A 2NOAA 4FWTA 2VP5A 2ECKA 2OBLA 1GSIA 3H86A 4HDCA 4ZIRB 3I1FA 1ZM4A 3P32A 1T91A 3OFND 4RFVA 2Q21A 1CJKC 4MYUA 2P5SA 3KQLA 3GJ5A 4PR0A 1C4OA 4EKDA 2B7BA 4LV8B 3C14C 2WWWA 4ESVA 1QG2A 2V7QD 4OQMA 2I3BA 3THOA 2LCFA 2YWHA 4IDOA 3L43A 2GZHA 1U0HC 4E09A 3CF6R 1XEWX 4JSYA 5FPYA 1Q22A 3A4LA 5J40A 5DHAA 1II9A 3ZGXA 4DDTA 4HAYA 4F4CA 2VHUA 4B3DA 2QQEA 1DAGA 5B30A 3CNOA 2NQ2C 2FGKA 3NWJA 4PPNA 1TADA 3T12A 3VU9B 3D8BA 4LYHA 2FN4A 2WSSA 5L3SB 5FUWA 1Z0JA 1KNQA 1PUJA 2ZRNA 1M7HA 4ABYA 1RYFA 4TSFA 1KOFA 2P5TB 3HU2A 1XJQA 2H57A 4C4PA 1UAAA 1JJVA 4V0MA 1VKJA 4LPSA 1AZSC 5F9FA 3QF4A 4MRPA 5DNYB 1Q20A 5F9HA 1HE8B 3B6EA 1G3UA 4ZKEA 3TAUA 2XGJA 4OQFA 2XSZD 3GQBA 3K0SA 1ELOA 1PLKA 3QXJA 4L9WA 3R8CA 2BJWA 2CL0X 2G0NA 3AVPA 4GOKA 1GP2A 4HAVA 3EW9A 1XMJA 3EPHA 1TUEA 2GXUA 4KVAA 2H7VA 1JR6A 1DO2A 4C7OB 4OI0A 5CK5A 4GP7A 2FPLA 2PZGA 5EE9A 1KK3A 2QENA 1S1CA 2QRNA 4AI6A 2NO9A 4TTRA 3PR1A 3RNLA 2GDJA 1E9RA 2OCAA 5AJVB 3AVUA 2PT7A 5HPYB 3CX6A 1SKQA 2C78A 2OE2A 1D2NA 5KSZA 1SVWA 5L3RA 4FMCB 3SYLA 1HUQA 3FWYA 2OFXA 2LKCA 2WKQA 3DKVA 2RGXA 5DSZA 5FL7A 5SZJA 3NKVA 1WDTA 2XTMA 2BBTA 3CLVA 3DKPA 2F43B 4MUBA 2KWIA 3PFIA 4MKHA 2QSZA 4ZDKA 1C1YA 1HY3A 1UKVY 3HU1A 3MWKA 4O0MA 4MYCA 3NBXX 4URWR 1GDDA 5KUTA 3HDTA 3FHOA 1OE0A 1NLFA 3AF4A 4PQFA 4JVMA 2ZM5A 1OHHA 2VEDA 3C4JA 4I1SA 521PA 4OK5A 3VU9A 3DM5A 2ZR7A 1XTIA 2Z4SA 1XZPA 2HYIC 4KXFB 2WMNB 5FUXA 2I1VB 1YRAA 4NE2A 2R44A 1E79D 5F3WB 2F1RA 2YYZA 4ZKDA 1S9HA 3ZIAA 4URXR 4D25A 2G83A 4Z1MA 4CYMA 3ADBA 1WQ1R 4CEJB 1Y63A 1Z0DA 2F1HA 3P26A 1NKSA 1B23P 1LFDB 1MO3A 3TVTA 2F1IA 4DIDA 1CR0A 1F2TB 4JVLA 4MKGA 4B6FA 1GG2A 3CX8A 3V9PA 2EW1A 3FKQA 1DEKA 3TW4A 3K0AB 5B64A 2JIZD 2Z4RA 4YXWD 1ZNWA 4P4TA 1MO5A 4GDFA 1NBME 1KI8A 1FMLA 2W00A 3QKSA 3BE4A 2FSGA 1D9XA 4BLPA 2O8BB 3DZ8A 2GJSA 2XNSA 1GRRA 2C04A 5JCPA 1KGDA 4NCJA 5TVKA 1II0A 1N5JA 4M21A 1W4CA 2FPKA 1XJCA 4ITRC 1ETUA 2FWRA 4AD8A 3W3AA 1NVVQ 1XP8A 5FOVA 3TKLA 3BB4A 2ZI4A 4G5GA 4P32A 1CKEA 3WYFA 2BWJA 4WOPA 1IXRC 4PPGA 5BQ5A 3SBEA 4GSYA 2G3YA 1IN8A 3A37A 3VTKA 1YU9A 4D0NA 2IYVA 3NH9A 1G7CA 4MRRA 2CK3D 2JLRA 5TXGA 3SEAA 4HDQB 4ZCLA 3GLFA 4BE7B 3TR5A 8OHMA 2IS4A 2W2XA 2ZVQX 2ZIAA 1QHNA 3EZ9A 1E9EA 3GEHA 4GPTA 1KI9A 2ZUBA 1HURA 1N6PA 2ZXUA 1Q57A 4M9ZA 2ZRMA 3N70A 4JYCA 1MABA 1W44A 1JJ7A 2J5XA 3K9HA 3P20A 2F1JA 4HSEA 3X1XA 5LD2C 4YMTA 4NCHA 2QPOA 3CM0A 2AR7A 1P2VA 1IXZA 1S8FA 3WY9A 1YZTA 1Z6TA 1IN4A 4JT4A 4HZIA 1X1RA 4C9BA 4HLUA 2JA1A 3LA6A 1AM4D 2CLCX 4CEJA 2WJVA 2NIPA 3IQWA 1G7RA 3L0PA 4PO8A 4YDSA 2OILA 1DPFA 1F2TA 3DL0A 3AH8A 1CR4A 5CDFE 1IY0A 3UANA 4A9AA 2ODWA 1GTVA 4KLZA 1NKTA 2JJ1D 1FQKA 2BV3A 1BKDR 2BOVA 2PLRA 2QU8A 4M0LA 1CLUA 4CIDA 3L82B 3EZ7A 2F7SA 5BN4A 3A1VA 3AGPA 3REFA 4YQFA 4AYXA 3IIMA 4OHVA 2ATVA 1G5PA 1QHHA 1E2IA 1FP7A 2CVHA 2YC2C 4QOSA 3SDZA 2VTKA 2IYRA 4RSGA 1F2UB 4K81B 4HAXA 1IY2A 1DTSA 1G8YA 4MKIA 4OI2A 4MKFA 4D4LA 3PIRA 4UNSA 2E1RA 1Z0AA 3MD0A 1VG1A 1OIVA 3ZZUA 2W6ID 2BBSA 4Q9KA 2WPDA 4BUJA 4LBVA 4PAMA 1Z63A 2VHQA 1P2SA 3RRYA 4YONB 4GL2A 3B9QA 1VCNA 2EWVA 4DLVA 2Q9BA 1O3YA 1IAQA 2Q3MA 2R2AA 3DHWC 4HLDA 2C9OA 2WWFA 2BJVA 3AF1A 3OF5A 3QKTA 1P3JA 1OXVA 2O0JA 2RGDA 3SQXA 5FH9A 3WRXC 2UZ3A 4CVNA 5LPNA 1XTKA 3BFVA 5AJXA 2OHFA 1P75A 3RABA 4B2LA 4IRUB 3WP1B 4QM6A 3LLMA 1MV5A 1RJ9B 3B82A 2XOKD 3ZIAD 4B75A 2AWNA 3QOFA 4Z1MD 3SU8A 1IM2A 2K5UA 3O47A 2B8TA 4B33A 1ZBDA 5DISB 4B2IA 3CB4A 1BMFD 1YZUA 5EUMA 1E4VA 1CF4A 4J0QA 1S3GA 2NG1A 4KVGA 4DEXA 5K8TA 2NPFA 4AIIA 1FX0A 4C0SA 3LX5A 2P65A 1RC8A 1TF7A 3U44A 2GK6A 1MOZA 1Q1ZA 1OXUA 2OM2A 4EDHA 2BBOA 4M1MA 5FPTA 5DYIA 4Q02A 1Z0KA 2ZRPA 2P6RA 3NXSA 2XTNA 1T3HA 1KNXA 4PSAA 1JAHA 2XJ9A 3VX3A 4R71A 2AHOA 1U90A 4AG5A 1AA9A 3T61A 4N3NA 3E1SA 5B57C 4NPHA 1F2UA 4D4KA 1IN6A 4KV9A 3WMGA 3FTQA 4BRWA 2ZJAA 5FTNA 1GRNA 3EWSA 2NO0A 4XWOA 3H2YA 1FTNA 1JPJA 2VL7A 4XH9B 4IXNA 2XXAA 4PTLA 4GBMA 1GM5A 4C0LA 3HR7A 4CW7A 1II8B 4WZ6A 3B1WA 4BFTA 3CW2A 4XIGS 2GVDC 2QY9A 3GLHE 1ZAKA 1W0KD 2GA8A 1XPOA 4D0LB 2Q3HA 1P7CA 4U5XA 2IYZA 5SZKB 1Q12A 1RZ3A 1ZM7A 1U2RA 1FFHA 1T8UA 2E87A 3PJRA 2IHBA 4LX0A 3MJHA 1E1QA 1Z28A 2RGEA 1LB1B 5FBLB 1T4GA 5AUOB 2HYDA 4LBYA 4AKGA 5EE1A 5D3MB 2XNDA 4NYMQ 5FTMA 2GNOA 1XF9A 2QBYA 4AKHA 2XX3A 1F48A 1TEXA 3OEHD 1RJ9A 2O8BA 3EARA 2X1VA 4E22A 3IILA 1XTQA 4BLSA 3QJYA 3QXCA 4TMVA 2XTZA 1EX6A 2XB4A 3IBGA 2GJAA 4EQ6A 2YJTD 2CDNA 2H17A 5CLQA 1KSGA 2F6RA 3W90A 4RZXA 1YHNA 4IOKA 1DG3A 2WHXA 4QBIA 4Q9HA 1BOFA 2WJGA 4ZIRA 4RFSA 2QMEA 1N6OA 5CIQA 1N2CE 3JVVA 3SE0A 3GJ8A 4GZMA 4JL8A 5HR5A 2ZVPX 2OZEA 2ZAMA 3IUYA 5CB8A 4Q21A 3W8RA 2HUPA 3AKEA 2J1LA 4NYIQ 4URZR 4YMVA 5EE0A 1DADA 4W9MC 2JLUA 1N6IA 2Q3FA 5JS8A 1JAIA 3B60A 4MYHA 3UMFA 2ZRHA 3LW8A 1T5IA 4PZLA 3TSWA 4BZQA 2BCGY 2ZI7A 1XMSA 2ANBA 1HH4A 2BKUA 2YOFA 3QI2A 4KI0A 4R7ZA 3DM9B 3GEEA 4RVCA 3A1TA 1OW3B 5B2ZA 1E2KA 1GNPA 4Q01A 3PVSA 2JIZA 4YXWA 2N46A 2FSFA
chains in the Genus database with same CATH superfamily
4JROA 3IFSA 1O94D 2W2KB 3EIWA 3WYBA 1ESDA 2JJQA 4B6EA 1PJZA 2OBMA 1DXHA 2Z57A 3GYGA 1U3GA 3NORA 4LZLA 4KREA 1O95A 1NBHA 4EYOA 3FCOA 2HTFA 3OU2A 1R0CA 5ENVA 4QJ4A 5C1BA 1X8XA 3VTAA 5HXAA 1X6VA 3OE5A 4I6EA 1XE3A 4DT1A 1DXOA 3KT3A 2BFDB 4EF4A 5LP1A 1G66A 1OLOA 2P4EA 2OHXA 2BGJA 3E8XA 5LXTB 4QDJA 3CNEA 1U0LA 1WG8A 2WQ7A 4EG6A 3DE7X 1IY9A 1TU4A 2C2HA 4ZOLA 2G40A 2VP9A 2Z09A 2ZBUA 4NH0A 5AHRA 4HS4A 1DWOA 2JI4A 4QYTA 5TGTA 5A5VA 5JXHA 2C3YA 2VAWA 1QG4A 3UQYS 4DQKA 1NZDA 3MPUA 1XPRA 4KKXB 4OQ4A 3ZDZB 4B35A 3QKWA 3AVWA 1HV8A 5LMNB 1TNDA 4HGPA 1KS2A 2GUGA 4Z3OA 5LWQA 4KNVA 2HPVA 1I4WA 1IDOA 1PT8A 4Z4EA 4KRGA 2FPWA 4RMHA 3V1KA 2WAXA 3QYPA 4XYBA 2OWDA 3Q72A 3CEMA 4D92A 3FMGA 4D0RA 1C3LA 3ETLA 4ID3A 5GJBA 4J1TC 4HAWA 5A0FA 3AKDA 2XOXA 3GGGA 4UNPA 2ONYA 5DM1A 4ZT5A 1IU9A 4KO2S 2DBZA 4U7PB 3JTEA 4OAPA 5GAJA 3UJ3X 4J75A 4AX4A 1Q5PA 5ALQA 5CEEA 1VHQA 3QV2A 2F48A 2P0YA 2V3CC 2J0VA 5DZSA 4OATA 2QYOA 1ZONA 4N5IX 2O3UA 2PBFA 2MSWA 1E6UA 1RNLA 3DVAA 3IO3A 3KS9A 3VKUA 2QJOA 2WDPA 2A1TS 1DO0A 2QI9C 4JLBA 4JKIA 3O3CA 3U19A 1JR2A 4AT1A 3SIPA 3PPIA 1NW7A 4J0CA 3KXLA 1BIFA 1BMTA 2GWHA 4NS4A 1NONA 1OPXA 3TRIA 5GVRA 4M53A 3T3MB 2D0DA 3GQBB 1XYVA 1RLJA 3FPCA 4Y2HA 1KI6A 3VNUA 4QPJC 2LCIA 3Q7SA 1SB8A 4YRMA 3AF2A 3IBSA 2CLHB 5HCUA 4MQLA 3CRVA 3EG5A 1DL5A 1EBFA 3D6MA 3HJAA 3KT0A 3SHWA 3A04A 3CT4A 3I9OA 4DMCA 4ZAZA 1HSOA 3AF3A 1ODIA 5EWLA 2E49A 3KVNA 4M1ZA 1NJFA 4RLHA 3WK9A 1XXHA 1L5HA 3QBJA 3RC1A 4ER7A 3P5SA 3EDCA 3S8YA 3BBLA 5HKAA 3OJ0A 1ZLYA 2BE7A 4NCNA 4UEOA 2BFDA 4K7JA 1L5NA 3S8MA 1KSFX 3F6BX 3MTGA 1LDGA 1B8OA 1RDFA 4MIKA 1BW9A 3EA0A 3ESRA 3A05A 4AP9A 5KNDH 5EMNA 1URPA 2QYSA 1NBMD 2AWOA 2B7LA 4IDPA 2GZRA 1OH6A 4HNRA 1JAXA 1L4GA 2IT1A 5DXAA 1Y8RA 2XITA 3F6CA 4QT4A 2O5RA 2XCQA 2OM6A 3A4VA 2BLLA 1LS6A 1AZWA 5CM2Z 4R8RA 2VNSA 1FQJA 4Q12A 5AKHA 4E5UA 5AI4A 3SICE 4KR0A 4A8JB 3IDQA 4BKOA 3K05A 2PPLA 2ODPA 4H0FA 1WXQA 1QQ7A 4UXIA 1RI1A 1XDDA 4ENRA 1Y1PA 4LNAA 4RKQA 2AEEA 4JLPA 1WD7A 3CLTC 5T3YA 5KVVA 5JMOA 1I0ZA 3VZDA 1NN0A 3K0EA 3PD1A 4CIBA 3A70A 5U4QA 3TTWA 1N57A 5EWJB 3STXA 5AVSA 1LK7A 2B69A 1XWIA 3FNFA 1SRQA 3JQGA 4D57A 2ABWA 1PFWA 2P30A 3L05A 1AF7A 1HPLA 4C7BA 4ALMA 4E2WA 1CDOA 3DVAB 1P5HA 4FGWA 3WIVA 3FOWA 4CG2A 3NATA 1E2UA 2NZJA 5BV1A 4EQZA 5JYBA 1KIMA 3KXPA 1J8YF 1P2BA 1QQTA 3O38A 4HBGA 2NYVA 4JI7B 2WOJA 1Z38A 1R6DA 2RHMA 4CKZA 5DM60 5C8ZA 1GTRA 3MRTA 2CJWA 1NWCA 1Z6ZA 2RAVA 3P2YA 2YNMC 3ZDFA 3WGJA 2OHOA 2V74B 3UK2A 1V35A 4DPKA 5KYYA 3DLIA 3R3HA 2IVFA 1Z4OA 3LPMA 4MRNA 1ULTA 4DIKA 1GL7A 4TSKA 4R2HA 1Q1BA 3G0HA 5HMMA 4KDRA 3ZPXA 4YRRA 3DDHA 3AI7A 3FLAA 4H60A 2CV2A 3AP3A 4IXMA 3OPNA 1PNRA 2AXNA 3R1IA 3LLCA 4NBLA 2FTKE 3X1DA 3T9EA 4Z51A 1H5UA 1KRXA 3BERA 4TYWA 3EFHA 3W9UA 4IVPA 5TV2A 3W7AA 4DZZA 3GZTB 4MH0R 5ICMA 3L92A 4HFJA 3ZGNA 5KKAA 1EFAA 3QMPA 4MNTA 1QQAA 4OGWA 1I7NA 4RU1A 1TK3A 2IEZA 3KQPA 3PPWA 2JGIA 4NFSA 1XKXA 2SKCA 2JJ2A 2V0GA 1ORHA 2QMYA 3ASUA 3IMFA 4U6NA 4O2AA 1T6BY 2QEQA 3O94A 4A8JA 3NVAA 3QZUA 2OO5A 4RUKA 1UJ6A 2Q6KA 4KBYA 1QK5A 2C96A 3I04M 3NDRA 4EJMA 4KNYA 4MQ6A 4J07A 1YA6A 3REOA 1M74A 3FM9A 3NHSA 4V03A 4FE7A 3A06A 5IAOA 2G9RA 3PNYA 4CM5A 2HIHA 3D4PA 3PGA1 1JECA 2IFTA 1EYZA 2I2CA 4D8VA 2ZREA 2EC5A 1YDWA 3H0KA 2RGGA 3JQGB 5HBGA 3U7EB 2C3OA 3GG9A 2BC9A 3HUDA 1SXHA 1ZGHA 2R5WA 4LHYA 4PCAA 4E51A 4C21A 2EJUA 1CJTC 3R09A 3W78A 5C7YA 2AUMA 2ZWVA 2FMHA 2UYYA 1L9XA 1EK2A 1BMFA 2R1TB 3FWPA 3HDHA 3IVAA 3KR9A 4HLCA 4N4AA 4UBOA 4A27A 1BFDA 4DV7B 3LGAA 2QG4A 3RU9A 4HNVA 3VO2A 5BP7A 4Y2VA 1R8XA 5BN3A 2RGNA 1LPPA 3Q5DA 4RZUA 4BNTA 3U56A 1XDBA 5BWMA 1G8JA 1G6Q1 1YS2X 4RD3A 2OEPA 4DSAA 2ZZMA 3L8MA 2WV9A 3FCEA 2A5YB 1E7QA 3H6HA 3NHUA 3L1HA 4JBYA 1R4AA 2J3JA 4GZ6A 4WLEA 1YJCA 4EJSB 3MS4A 4GYJA 2CUKA 2GHQA 4LPKA 3LHDA 3A4MA 3UWKA 2RHHA 4KXQA 1EDZA 1AZTA 2PDAA 3QWFA 2Q45A 2QU7A 5I3ZA 2WFMA 1G59A 1UBOS 2BM9A 3N6XA 5E8JA 2FEXA 3C6ZA 3JZMA 4DTIA 3DV9A 1G6HA 1RIFA 1RQGA 3G2JA 4WFJA 1C0LA 1LBHA 4YLYA 1XNQB 1Z6AA 3H1PA 4LECA 4FGSA 4EYEA 5DGTA 5IM5A 3R7AA 4EAQA 3IUQA 3T52A 1L5SA 5FR2A 5LDDC 1NN1A 1K63A 4QTXA 5I7AA 3O9ZA 3LX6A 1N7HA 1CQIA 3E3MA 3U3OA 4E03A 2JIOA 4G0OA 2I7TA 1YZHA 3ECSA 1TJ4A 3G89A 4MB6A 4W9RA 5AI9A 1BH6A 1P4GA 3BTVA 4R31A 1O94C 2YBEA 5CB4B 3CVWA 1P1CA 1JPNA 4TZ0A 4G36A 3RBAA 5LNK6 1GAJA 1YBFA 1X80B 4FCCA 4ZEXA 1V8ZA 3AM1A 4IDBA 1K4YA 1EVJA 2W4MA 1TA9A 4MQ5A 1ABFA 4QRIA 1V5FA 1J70A 4YP7A 3PV0A 1VJTA 4U6SA 1ODLA 2I34A 3LCRA 1Q2UA 4LISA 2V45A 2XNCA 1IJKA 1K5PA 1NLYA 4JXJA 4RQUA 4WJLA 1TM5E 1M2KA 2FFQA 3ASYA 3O74A 1U2PA 3B6KA 3JARB 3TLGB 2JLWA 1L9KA 2P2SA 4DBLC 1ZM9A 2ZTVA 5DKFA 1HNWB 1UFRA 1YVUA 3P2KA 3BZBA 4R7TA 1JTFA 1L1EA 4JJEA 3EHDA 1DZIA 3ETCA 5GZ6A 1K27A 5MDHA 1M2JA 3KLMX 2UAGA 4P92A 3H4MA 1WQ4A 1VLVA 1WPRA 4IO1A 5A3RA 1UDXA 1EINA 3K9LA 1W47A 3PFWO 4YX9A 1GADO 2WTEA 2ZXEA 5F98A 5GJWC 4TTAA 5TJ9A 1YL7A 3KAJA 1LZKA 5EMMA 1FDRA 1SBQA 1IBKB 4AJHA 3GRKA 3JVDA 4NDAA 1VBNA 3ZX4A 4DADA 3FTDA 1XLTC 2GPTA 1U7XA 2FZ4A 3EXAA 3OJCA 4HVTA 1XMXA 4YCAA 3TO5A 1CUXA 2AJCA 1P1JA 3HKDA 3PVCA 2ZQ5A 2EATA 2ZIXA 2NACA 2GF0A 5DGCA 5ALXA 5HK8A 3TWOA 4BFLA 1DFIA 1JE0A 2GPBA 2W2OA 3KD2A 3PDIA 4J90A 3I9JA 3NEAA 4O4JF 5AP9A 4D4IA 1KFCB 4D8UA 2ZAIA 3U61B 2AD1A 2H4XA 3TF5A 1IH8A 2B0JA 1HC7A 3GG2A 3AL2A 4PGAA 2XA1A 3KUKA 4CM6A 4E5PA 2Z8ZA 4LOHA 4LJ8A 1GQFA 4YXFA 1F7UA 1GZDA 3PNVA 4JH0A 3O90A 4P8RA 1E2HA 4RCYA 4BJ3A 5JRJA 4GPEA 3H9QA 3M3PA 5K3OA 3L0BA 2H54A 5KOHB 1SUDA 1NXWA 5GIPE 2MYUA 3GLIE 1U7UA 2NP6A 1K98A 5CLJA 1W2WB 1P45A 4KUGA 2B1GA 2VAVA 2VYND 1SVMA 3ROTA 3DEHA 2A7QA 2ODAA 3VH4A 5LLTA 4Y9SA 3HVHA 1Z0SA 1CUIA 4FCWA 3L1VA 4GLOA 4XJTA 2G70A 3IBYA 2XUHA 4N3GA 1BQEA 4PLCA 2ZI5A 3T3OA 1AGXA 3UJPA 4DB2A 3OFVA 2GYWA 4RVHA 1ZL0A 4K9OA 3R0JA 5LC1A 4ARIA 1YV9A 4K6MA 3QE9Y 3FUTA 3BICA 4W5OA 4FI3C 4LWPA 1FL9A 5ILOA 2IY9A 1MU0A 4M6WA 3RQIA 3OY7A 2Y2UA 1EMDA 1QO0A 2YQ5A 1OIXA 2QTWB 1V1RA 2NZXA 1IK6A 2OBNA 3KEGA 3NIGB 5K9ZA 2KSQA 2V03A 3IEPA 4F9TA 1CUDA 3ECCA 2OAP1 4RKRA 2OXIA 2XNDD 2I91A 3BC1A 4EG7A 1E2FA 1NC3A 2YVQA 4FYIA 5DCLA 4AP6A 5C8YF 4IIJF 2IBSA 4RVFA 4DQVA 1EESA 2FVYA 2J6IA 3MT0A 5HF9A 3GC6A 4IVNA 1EUQA 2B6NA 4CLOA 3IGFA 1RXUA 1BVUA 1J7JA 1H8HD 3MCZA 4YCDA 4DY4A 3IUEA 3LBIA 1SKYE 2IYQA 3ANXA 3IVRA 4BMPB 5BRNA 4EHBA 1RBMA 2FW7A 4YMSA 1IWPB 4PZUA 2BHNA 3II6X 4ND3A 4BVKA 1CQJB 2ONZA 3PS9A 4JODA 4JVSB 1VDMA 1VYHA 3EGDB 4OXQA 2B8WA 3AILA 5FIUA 1S0UA 3FYTA 3HL4A 1QJ4A 3OPYB 4B9EA 4S1WA 2AXPA 2C83A 4ND1A 2O7QA 4WGFA 5HE8A 3X0DA 2ZW9A 2PEYA 1BNCA 2IYEA 3F6EX 4G24A 2YMQA 5ELMA 3DFIA 1Q0PA 1KFKB 1XKTA 4YJ2B 1W1IA 5DM4A 3USES 3M33A 1VG9B 4O4LA 3BFKA 1OZAA 1U2QA 2XTJA 5E0OA 4EMSA 4LXIA 1YFJA 3KQUA 3WB2A 4CM8A 4ENVA 5D84A 4I8IA 5AUQA 2AQKA 5I7UA 4Z7NB 2Y4OA 1OX4B 4CL3A 4M37A 3ROEA 3MHPA 2ZIGA 4BFCA 1ZZEA 3NDJA 4LRSB 2YV3A 4ACBA 1SRRA 4FK8A 3WLLA 4A8JC 2OV3A 4KIUA 3UUGA 4Z4CA 3FIUA 4K0RA 3V34A 1C2TA 1PEKE 1PK8A 1MIOA 2C7GA 2D5AA 3F8SA 5BOSB 2RGBA 3I9LA 4B3CA 1USKA 3CCCA 4TYPA 3FYUB 2D74A 3ELDA 1ADJA 4OM7A 4QPPA 1PD1A 5MGBA 4JI4B 4LCBA 3RHSA 2OGTA 4ZV4A 1Q95A 1JZTA 4HAOA 2B5VA 4B79A 1G5TA 3EODA 3CKKA 3MSXA 4RYDA 1TE2A 3T7IA 1U5BB 5JYEA 8LDHA 4BJ5A 3A9SA 1HL7A 3BWCA 2OFPA 3H9EO 5CT4A 1DX6A 1R9MA 3N7TA 5TY0A 5EEGA 1SVLA 2O6HA 1PJQA 2O8FA 1RABA 2I6TA 2O4CA 3PQ2A 2NSDA 2VWGA 5L7WA 1QQ6A 2XA9A 4AB1A 1LI7A 5JCZA 1CZOA 3QXHA 2A3RA 1Z47A 2Z9BA 3P8ZA 4D6PA 3NVMB 1QFMA 4GM1A 2YWEA 2JFBA 4ZQHA 3TZHA 3BE8A 1NV8A 2VXYA 4XFKA 3NPMA 1WHTA 2KJQA 2DQZA 3AU9A 1MVOA 1UP6A 1IM5A 3ELYA 2V4ZA 1BXKA 4URYR 4KQKA 4CIVA 1C8KA 2UUCB 2QV7A 1ADYA 1QHIA 2IL1A 3MMPA 2COEA 3ZW7A 4DUZB 1U11A 5EINA 4D9FA 3EGEA 1DAHA 1Q3HA 3ILXA 1QBGA 2PTGA 3PYMA 3T7SA 4X1IB 1E2MA 4XASA 1H0RA 1V8OA 2HKIA 2P2GA 3JQ6A 4BVLA 1V6AA 2G8LA 4GC5A 1AMOA 1T25A 1OVMA 4BU0A 3CZAA 3W5CA 1BHJA 3D8NA 3KQTA 2WR8A 1JA1A 1LPNA 2FK7A 2CHQA 1FMJA 1QTIA 5CFLA 2C31A 2QAGA 3GRCA 3OI7A 2HSDA 2E4WA 1F1BA 3GAMA 3EGWA 3ENVA 5FEUA 1VSVA 3L8DA 1UH5A 3EC1A 4EM6A 1EJ0A 4WZAB 4ZZIA 4CDMA 1ZSNA 5JC8A 2PR7A 5B58C 3ZZMA 2RH8A 1D4AA 1CW2B 1N92A 2YICA 2HRDA 4Q9NA 2XQJA 4XGRA 2FAXA 5CVJA 4EL5A 4LXHA 4HXFB 4CKEA 5ERYA 4LXQA 2BIFA 4X7BA 1YZ3A 1L7AA 4MSUA 4TTVA 5FLKA 4C4ZA 2QP9X 1TPZA 1HLDA 1UT6A 1V3QE 2QVGA 2ZSHA 2AN9A 4W7IA 3KV1A 3CONA 4BRZA 2CMDA 1QGED 4PLFA 1FSZA 3GZJA 1IMJA 2HQ1A 4RACA 4WZBE 4P3OA 1VYUA 4N7RA 3T3GA 3EZLA 1Y1TA 4OSEA 3GVIA 2Q1WA 5CW2A 5LYJF 3N8HA 3D7RA 4J0FA 3OOWA 1KY5A 3VJKA 4F5YA 3JVEA 1RM5A 3QU4A 4TV9A 2BHLA 1TEVA 4F9FA 3K0CA 7REQA 3OA0A 4R1NA 5EQTA 5BOVA 3ZGYA 4ZYTA 4PQYA 4EA7A 2RKOA 4FW9A 2PGXA 2XQGA 1I2MA 1FFDA 3FFAA 3AB7A 3N8IA 3N0XA 5KS2A 3GEDA 2UYGA 3RQSA 1EXWA 4QLBA 2W58A 1QV7A 3CSUA 3GZNB 5CM9C 5CA1F 5FWXB 4IIVA 4B87A 1BEZA 3PQ6A 1RYZA 5BNFA 4CM9D 3TXVA 1VP9A 2GSDA 1Q7GA 1QWOA 2GZSA 2ZVDA 3OJLA 3OZRA 2QS9A 1Y7LA 4MVJF 3ZD8A 6Q21A 3AVTA 5BY2A 2C8LA 4Z8XA 5FBVB 3VH1A 2BTEA 2WSBA 4IY1A 5CA1A 3LUCA 2ZUUA 3Q0IA 4OKNA 1KJWA 2ODQA 4KE9A 2W0SA 1LDEA 1QR2A 3R0IA 5K0GA 3MHTA 2QD4A 3IEUA 2XXAB 3AYZB 3MUFA 3DOCA 1Z33A 2CLDX 3I6MA 3KDPA 1DC8A 2Q9UA 1FW6A 3PEYA 2NNLD 5BVGA 2G9QA 3AEZA 4DSTA 3HZOA 3LKVA 3F49S 3WKAA 1U8CB 2PGOA 3T1HB 5FWNA 2ET6A 3SEFA 5KWIA 5AXCA 5BORA 3U1BA 4R1QA 1OAOA 4TRNA 1D5CA 621PA 4KOAA 4ZWNA 1MTZA 1BDIA 4OK3A 3SC6A 2B9VA 2D5BA 5AQEA 3U26A 2ZSBA 5ALYA 5H68A 1DOAA 4MWSA 1IUPA 1ML4A 4GBGA 3DXFA 5HF6A 2HBQA 1I13A 3S44A 4OL0A 4YGYA 5KNBA 5KHOC 3W5DA 1JJAA 1A9TA 3EE6A 1ODSA 1NN3A 1PT6A 1GLVA 3E1GA 1ZESA 3KX2A 4K1XA 3CO5A 3V8BA 2AQIA 5EZ6B 3BXEA 2HPAA 3RTAA 4JLJA 4R6WA 5EE3A 4IIEA 2PKQO 2ADMA 5LU8A 3WYNA 2H1OA 2UUBB 1IEVA 1DX4A 2V97A 3KB8A 2QZ4A 2WAOA 3KOUA 4K8OA 3HVRA 5DK4A 5D1NA 3D81A 4EA6A 1JFLA 3U6KA 4WAUA 1M8PA 1QHYA 4NE7A 1OXXK 4BJ1A 2OQRA 1XZ8A 3AHGA 3R5FA 4LQDA 5L4LA 3QF7A 5ARBA 4KDEA 1I7SB 4MGIR 3TI7A 1B76A 4HEA1 2V7XA 2FCAA 4RM2A 3KQHA 2DX7A 2BFEA 2CE2X 5G40A 1GCIA 4TWZA 2KQUA 5DI9A 3GLFB 1Z56C 1E1QD 4B83A 3L4KA 1JL3A 2A0UA 2W6OA 4MQMA 4DLNA 2LDBA 1ZMOA 3IT0A 1AO3A 4IGFA 4PBSA 4A73A 3K71B 1YBMA 2VBGA 3K9GA 3KXKA 2EKDA 3DYBA 1ZK1A 1EVIA 4I4CA 2C9YA 2NZ8A 4PQGA 4Q4JA 1E6CA 1K92A 1TTPB 5C4MA 1YRBA 2UZ1B 1WB5A 4PLVA 4R9UC 2P2ZA 4DLTA 1NUSA 1ZBQA 3OTWA 4KGZA 4NONA 3UWSA 2AKYA 3K1AB 3USZA 4RWZA 1I7LA 4B82A 3FHTA 1E3WB 4KZKA 4G2NA 1JPUA 3LQ4A 3H83A 3N0VA 4IW3B 4KJXA 4MWZA 5AO9A 3D3EA 4CFZA 3FGPA 1F9AA 3U37A 3N59A 3ZDDA 5GONB 1R4NB 1VL0A 3ZZ1A 1BXZA 3E5MA 4Z4GA 2P9BA 2F3RA 4ND2A 4GS5A 4JLNA 4FN5A 3CV3A 3FPEA 4IFIA 2XKKA 2IYSA 3HBLA 4HAZA 3O1IC 4JVNA 4JEUA 2C54A 4DV1B 1P1FA 2XDYA 2P5YA 4FT2A 5DF1A 4EJ6A 2A67A 2C9ZA 2AMVA 2G71A 2QXUA 3H1EA 4EG0A 2ZSKA 3CLKA 1R5OA 1P60A 1P9RA 8GPBA 2IZ1A 4G67A 3GJ4A 4LHEA 5IT0A 2X0JA 2GVNA 1VHWA 3FPGA 4E46A 2PEZA 4TT8A 3TDNA 2O0HA 1HZZA 2GNAA 4OXRA 3HUTA 5ARDA 1IEWA 2D3TA 3WB9A 3ZLVA 5B3JC 2C98A 1VXRA 2A0YA 1P91A 4JI8B 2J0SA 3GGDA 1E3QA 4R83A 4GXRA 1T1JA 1E6EA 1XCPA 3LQRA 3OHSX 3TG8A 1Q1EA 2W6PA 3S8EA 2AHRA 4QXQA 1PWEA 2JGEA 3CLSC 1C1DB 3BPSA 3WR5A 4EGJA 4I50B 1KAQA 2G09A 5F1OA 4TRRA 4OB8A 3ZBQA 4ZT4A 5K4AA 4AMBA 2PXHA 3B2QA 3FF4A 4EZEA 5FWYA 1G6OA 1G1MA 4WH0A 2Q0HA 4MA5A 3UENA 1IVSA 2DXIA 2AV6A 4BTVA 4DA6A 1JR3D 3RSCA 4CTOA 2VPXA 4ZQIA 3W6UA 4WESB 2EWMA 3M5WA 1HEIA 4JQCA 5E95A 2HJWA 3G0BA 3CKMA 1IBSA 2D4HA 3QVOA 4KGXA 4EHHA 1GYRA 3OQIA 5KINB 2X8AA 4BQQA 3H9GA 1WCYA 3D6UA 3H1AA 4QRDA 1IWOA 5F2EA 4RKWA 4C5CA 3CMCO 5BV8A 1U2DA 2RHOA 2YJGA 4NBTA 1FFCA 3E23A 3JQAA 3KDAA 4ZOLF 2YIDA 4KWCA 3SXUB 5KKNB 1AGPA 1OAOC 5ESXA 3RVRA 3TIVA 1MF7A 3BH6A 4P7JA 4EZBA 2UZ1A 4P0TA 5ITZA 5E1OA 4DLUA 2BMWA 5DTIA 2EKZA 1AIPA 1Z34A 2DTXA 2HF7A 4RHEA 2Q3DA 1P61B 3A6PC 1QIGA 4MV1A 4A5OA 4MXDA 4WVFA 5FULA 3GJYA 1EBBA 2GSWA 3UGTA 3EPJA 2LTAA 2NV2B 3HLKA 3OT1B 1HDRA 2JLQA 3SF0A 1M8FA 3KALA 4Y2TA 4C03A 5ABPA 3GCWA 2CDCA 2V58A 1KO8A 3V9AA 5AVYA 4BNVA 4KVFA 4GKAA 4P38A 3KD3A 1M6VB 1YRHA 3LECA 1H9BA 2HIMA 1QX4A 4DQ0A 2LIVA 1RI5A 2BI8A 3U4DA 3KDSE 3VOBA 1JBEA 2D62A 2OV1A 1YAHA 2X5XA 5A71A 3IEMA 1OD6A 4JK3A 1VG0B 3GRAA 1H2ZA 1OA1A 2G0TA 3MT7A 3PHBE 2Q29A 3K4PA 3UC9A 3ZWWA 2GHIA 2M6KA 4E5SA 2FF7A 3ESYA 1QE0A 2GI4A 3IEXA 1NHGA 4JITA 1QC5B 4CLRB 4ZREA 5JAPA 3LNCA 5JBQA 3QVTA 3WGMA 2QROA 1U9IC 1JXOA 4H3KB 1NQWA 4X71A 1KOLA 3UJHA 3WMEA 2CT8A 1PSDA 1MA0A 2CBZA 1T36B 4BZWA 5KO2A 1ZW1A 2P2CA 4I50A 3RSQA 5D87A 1F4LA 1V95A 2A9VA 3NT4A 4H4CA 1TM1E 1HYGA 5SZHB 3VVLA 3HNRA 2O7RA 2IYTA 5A9SB 2VSOA 5EIEA 1SUPA 3RIEA 3DBRA 1Q50A 2GM3A 1YQTA 2J33A 3FY4A 3T7CA 1E3TA 1AKYA 2KBEA 2DUNA 3TZQA 1RYMA 1B00A 2Z2JA 2ID7A 1RHJA 1TUIA 3LOQA 2HWYA 4BFXA 4PEVA 4W1RA 4WIAA 2YFKA 1YI0A 3EUWA 2JI7A 1Y3DE 3U60B 1DWPA 5ES3A 3JALA 2B20A 4V2UA 1P9WA 1YD7A 4RK7A 1Y0BA 3FCCA 2WAYA 2R62A 1RMTA 2V7WA 3RVJA 1A9RA 1ZC3A 2IP4A 4IS3A 3GFVA 5A5GA 2B4QA 5KX5A 4G0QA 2O14A 1A2QA 3AVOA 3RAJA 3DBVO 2VYCA 2EQAA 4NZZA 1JH9A 2HZ7A 3KPUA 2VIIA 2XZOA 3QYAA 4HAUA 3FPHA 4XQEA 4MB0A 4OGFA 3VHQA 2JW5A 2X9VA 3UBMA 4LAFA 1VKNA 4A1OA 3V1UA 4B7AA 4FDAA 5JMWA 2ZANA 2CVFA 3WXMA 2QUIA 3CE9A 4RD2A 1CUAA 4WFQA 1M6VA 1T9HA 2GKSA 1U2TA 4C0QC 1JV2B 3ANYB 4B4WA 2FPRA 5JRDS 5K09A 3JQ9C 4FJ1A 4G1EB 2C5EA 3ZXSA 2I62A 3CIOA 3SHQA 2QMUA 2FWIA 3HN7A 3W8DA 4YCLA 3ESXA 3X1KA 2COKA 1E1KA 4NAUA 1W6RA 1TCUA 4XGQA 1M8KA 1V5WA 2DFDA 3EIOA 1J5XA 3FW1A 2HCFA 3L7DA 4S1OA 3ST7A 1TEZA 2FZ5A 2PGIA 3HSYA 4I66A 1CIVA 3VGPA 3MIIA 1RYEA 3HJGA 4Q4HB 2PR2A 4XQCA 3VAYA 2JAUA 4CFYA 2OO3A 2XXJA 4B6QA 2FPPB 4O6VA 2JCVA 2X1HA 3GPDG 4S0XA 4F2GA 1UJNA 2ZAYA 3FF1A 4QREA 1P80A 2GN6A 1L7XA 3RLIA 4HVCA 1XPJA 3EZNA 4AUMA 2J9RA 2GMWA 3HV0A 1PS8A 2O5VA 4FXOA 1CY2A 1UOPA 5E9JA 4GH5A 1Y1KE 1T0UA 1JP7A 3WKBA 1G63A 2JLCA 1DV2A 2QJWA 2A5JA 2C42A 5BSFA 1HQCA 3CLRD 5K8UA 1A71A 3KQNA 2ZYAA 5IULC 1T2DA 3UOGA 2GCEA 4X92A 3AUKA 4UU1A 1TTQB 2JCBA 5DOVA 3PEWA 4OREX 2ZCUA 4PANA 2DBVO 3I53A 2WD7A 3N86A 3QITA 3EVGA 3SX2A 1QR6A 2NXJA 3B1KA 3LDFA 5G0SA 2ZE7A 2ZK7A 3BSWA 3DLHA 3UHAA 1P0IA 3DZHA 2H9AA 1TAGA 2X7XA 1CHDA 4JBLA 1KMCA 4NBSA 3GW8A 3GP5A 5KYGA 4WBNA 2PA3A 4DV2B 4PYOA 4O2AF 2RIPA 4BLQA 5BYKA 2I22A 2ZB4A 3FTNA 2I2BA 2BSQA 3ADKA 2PV0A 1C7FA 1JIKA 1KZYC 1QZTA 1SCDA 3IAM1 3T5DA 4D0SA 2Q1UA 1A9XB 3VC7A 1E3JA 4JP5A 2O59A 4EFMA 1QIFA 1G5IA 2WNHA 3BS4A 4XD7A 2KM1A 3TN7A 3FYUC 5REQA 1AXGA 1ZNXA 4WUVA 4YCSA 2BGWA 1DC4A 1REQA 4KR9A 1RQRA 3NBUA 4Z9AA 3TRKA 1EP1B 4WZAE 1AO0A 2X5NA 3E9ZA 3U6BA 3C70A 1ZCFA 3NUGA 4PX3A 3WK5A 1S89A 1Z5ZA 4FVTA 4R9RA 3PFNA 3VNAA 3CG4A 3V4FA 3ZXXA 3CNQS 5KYUB 2G4CA 1MCZA 1Z0IA 2VHXA 2XI4A 5AW5A 2YJ6A 5HW0A 3BE5A 3Q8LA 1ZAYA 4NXNB 1PJ4A 4I50F 5DTRA 1M7GA 1X7ZA 2F64A 3S6JA 4COOA 1H2AS 2VDMB 3O2JA 2ZITA 3SS8A 2ZULA 5AOBA 1J1ZA 1WEHA 4UDXX 3IA2A 2YW9A 2DOKA 3DNPA 3KL4A 5CVUA 3FD8A 3H8JA 4A26A 4F21A 4DR5B 3WYGA 5EUCA 2DHRA 3EMKA 5A2QA 3AY3A 4GQBA 2CJYA 2PGAA 2QTHA 3ITKA 2D7DA 1DTWB 5EMLA 3ABZA 3RVPA 3CJRA 3V4ZA 2XUKA 5K3BA 2R1ZA 3H5TA 1RM0A 3HVIA 4LVCA 3WRYA 4PLHA 3UUFA 1E2PA 1FRQA 3K6JA 3OFJA 4LVNA 1SM4A 4WSOA 1W1UA 5IZCC 3MAAC 4TV8A 2X7HA 4KR6A 5JXIA 5KYKA 1GZ6A 1ZO8A 3AFNA 5H81A 1SXPA 4AWBA 3CSSA 3LE8A 5BXQC 4M0CA 1RXSA 3WXBA 4XARA 4WBNB 3U7HB 1WL8A 1FP6A 3UUEA 4OUKX 3W6PA 1GFSA 1D3AA 4NS1A 1K7XB 1CR6A 1V7QA 4MS1A 4MKRA 3WA6A 2HAEA 1LQ2A 1NM5A 1DKLA 2HRQA 5HJ2A 4DCJA 5HUJA 2G5CA 3W3ZB 5HVNA 4ES6A 2P6UA 4HS9A 4KE8A 5CA0B 1ZSVA 2HDWA 1YH3A 2X7JA 2R6DA 4IRXA 4UATA 2HMWA 3SC3A 421PA 2Z43A 1R8SA 1C0KA 4AJPA 2VUHB 3LFTA 2VSFA 5J4YA 4X9XA 5FO1A 2ZIFA 2XT6A 3PXXA 1XUOA 3GUYA 2JD0A 2HRRA 3H8VA 5AMXA 4XB6B 4KGDA 1OMOA 3ZYCA 1X1QA 4C4XA 5T4HA 3OD1A 3P7MA 4HXYA 5KYUA 4TXJA 4KH0A 3TL6A 2X9LA 1UXGA 4H9GA 1GTMA 1J33A 1TMKA 4RW0A 2V1XA 2C0CA 1KTVA 1QYCA 1L4UA 4BFWA 1B14A 1QYVA 2XUFA 1S96A 1X7ZB 2VO1A 1HF3A 2QRLA 4GRDA 1JNYA 1Q84A 2QAIA 4DWOA 1OXKB 3V6MA 1N8NA 1TF2A 2FKNA 5HCNA 3ZTTA 3U3MA 3L46A 5ALVA 2YVAA 1RRKA 4Q1EA 1NMZA 5CCXA 5E2BA 4CMIA 4Z54A 1LW6E 4ZHSA 1M6WA 3KTAB 2M6RA 1RHRA 3QVGA 1HI9A 1UJCA 3PJGA 4GD3Q 3L8EA 4KFRA 2GESA 1BDMA 1G8HA 1DQSA 3LGXA 4N41A 4D81A 3RUPA 3NEJA 1VMDA 3HDGA 3JVUA 4DSNA 1ZKDA 2V7TA 4CM4B 3LHSA 4CF6A 1G21A 2GD1O 5DVZA 3F5SA 3G68A 2ZBPA 1FDWA 4G63A 4DXDA 4ZT6A 3AO0B 2REQA 3ZU5A 1PIWA 1NX9A 1Q91A 1RAIA 1X7XA 5K7SA 4LS3A 4BP1A 4OXNA 1NPYA 1P44A 1GITA 1HYBA 4P33A 1V1MB 1G8AA 1X8JA 2O2EA 1U31A 1VC2A 4JSTA 1GXSA 2RJOA 3QBVA 4R8LA 5IDXA 1I4DD 1PR5A 2OCLA 4QGFA 1DC7A 5B1DA 4CE6A 4DHWA 4UVGA 1FXWF 1DBQA 3TR0A 1FX0B 1P5ZB 3O2NA 3REQB 5CT5A 5K3AA 2W2VA 2ZWIA 3RS3A 4MV7A 3H5LA 3PP8A 4D6YA 5BN5A 1N5MA 2C5SA 3ZJ4A 4DB4A 2E3JA 1K7FB 2PMCA 4CKCA 3CHYA 1TKAA 2CK3A 4MYDA 3TD9A 5JS2A 4QASA 4MWGA 1MEEA 3M6IA 3OX3A 3T5CA 1D1PA 2D8MA 1UP7A 3FNGA 1A04A 1E7MA 5HQTA 2RI0A 3A11A 3A0UA 2V5AA 2GETA 2P9ZA 1P7ZA 3RRZA 1BMQA 1U4OA 5JH7B 4OMDA 4KR7A 4NEHB 2N9UA 4CUKA 5CDTA 1I30A 1AHPA 3O8CA 1ND5A 3BAZA 3A7DA 4X20A 4F7WA 1MB0A 2HJGA 4BLUA 3PJEA 3GFOA 721PA 4NL4H 4KQ6A 2J9XB 3M9WA 3LG2A 1JHVA 2P79A 2WMOB 2D3WA 1OHHD 1EX1A 1NYTA 2VUUA 1JSCA 3B2EA 5HF5A 1JFTA 3L93A 2CLFB 2HA6A 4Q82A 5CEFA 1VRVA 1K3FA 1HOTA 3AV0B 5I3CA 4FFSA 1RADA 2GDZA 5L6MB 2E4YA 1KI6B 2DWPA 3H8WA 5IJ0A 3S2IA 2CNDA 2FPUA 2ZRAA 1UOQA 3FPLA 4NU5A 3BSSA 3BEOA 3DCIA 4PHGA 2RC5A 3PI7A 3NP7A 2R97A 1I3LA 4POOA 3MILA 1JI3A 4HNGA 3VR2A 1I4TD 1T4BA 1V7ZA 2Z30A 4FSHA 4DNQA 1L7OA 4KH1A 4DJFC 5JCJD 1CP2A 2C4VA 4PPFA 1A1VA 3S70A 5B2FA 2RIRA 2E5FA 2WTUA 1RHQA 3CPSA 3NAQA 4O4IA 5A6SB 5LP6A 4PQEA 4TSRA 1J2EA 1IJEA 2O3TA 3C5VA 3QG1A 3KHSA 1SEPA 1NUAA 1VMEA 2CNWD 4FMPA 1JG1A 2C1ZA 4TZ6A 5HBRA 3GROA 5A62A 4LF9B 3GRFA 3Q3JB 4GF5A 1I32A 1OLSA 4MGHA 3DT8A 1F7VA 1JYSA 2C07A 2PJUA 5EKTA 1EM8B 1Q0LA 1JG3A 1WVGA 4L08A 1YBHA 3L8ZA 4B7ZA 1SXIA 1A76A 1E9SA 2AS0A 3EMBA 2ZJ5A 5JJ5A 2F8TA 3M6LA 2VPIA 2VYVA 3D5QA 3RSLA 3IV6A 1GOTA 4U0JA 1J9ZA 1DX9A 1PRYA 2UKDA 3BXXA 4ME6A 1V9SA 2X0IA 3DYVA 1TO2E 4RFSB 4JC4A 2BR3A 2HA7A 3GT3A 1LX6A 3P96A 4ZDWA 1BHQ1 1G4HA 1YMQA 4HLNA 5HIKA 1T9AA 1Z2PX 4K9MA 1EU1A 1YZVA 4C0BA 1E60A 5JR3A 4IPTA 3VNVA 4GI5A 4WNYA 3ZS8A 5DNUA 2O9JA 1H3FA 1TZCA 3CLSD 4NATA 5KWEA 1FXUA 2A6PA 1E63A 2VKTA 2CCGA 3K35A 4KO3S 3IV9A 1S2OA 1OFIA