4FIDA

Crystal structure of a heterotrimeric g-protein subunit from entamoeba histolytica, ehg-alpha-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
334
structure length
317
Chain Sequence
b'KPITVMLLGSGESGKSTIAKQLKILFGGGFPEQERATHKSSICSNVVTCMRTLIEQSAILNHPMKYQPKSKEFTTEDPVTLPFSPELVGDVEALWADEGIQATYEESAKFQLPDCAKYLFENVKRIAMEDYVPTEEDLIHNRTKTTGIHEYDFVVKDIPFHLIDVGGQRSERKWVSFFSDVDCAIFVTSLAEYDMKLYGNTSRLTESIAVFKDIMTNEFLKGAVKLIFLNKMDLFEEKLTKVPLNTIFPEYTGGDNAVMGAQYIQQLFTGKLQTEEMNIEKVYTNPTNATDGSNIKRVFMLAVDVIMKNMAANGKMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G protein alpha subunit
molecule tags Signaling protein
source organism Entamoeba histolytica
publication title Heterotrimeric G-protein Signaling Is Critical to Pathogenic Processes in Entamoeba histolytica.
pubmed doi rcsb
total genus 85
structure length 317
sequence length 334
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4fidA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fidA01
1RJ9B 2IS4A 4KXFB 3U3MA 1P2SA 3P20A 3RSOA 1KK0A 4BFUA 521PA 5KTYA 4OQMA 3QBVA 1HT2E 4EJSB 2GEDA 1M7HA 2VPPA 1JJ7A 5J4KA 1D5CA 1OXXK 2WKPA 4TT3A 5TB5A 1HE1C 4ZDKA 621PA 5AJWA 3OF5A 4IDQA 2XX3A 2HV8A 3DM5A 3PUWA 4TMWA 1SZPA 1Q57A 4PC2A 1VYVA 3RWOA 4YMTA 4JS0A 2J0SA 4URUR 5FI1B 4ZO4A 4DUGA 1ODFA 2CLCX 2EQBA 1G7RA 2PT7A 2R2AA 4DCNA 2FNAA 1ZU5A 2FWRA 4KFUA 1G5PA 1YVDA 3FYHA 4JT2A 2AKYA 1S4QA 2ECKA 5JECA 3GLIB 2FEMA 3NXSA 4CT4B 3T1VA 2O8FB 2N42A 4ESVA 4OHXA 3T35A 2ZAOA 4KI0A 1XEXB 3ASYA 2H18A 4AKGA 4KBGA 4QG7A 1ZNYA 2WHXA 3B1VA 5L3VA 3A4NA 4K46A 4RFVA 4CEIB 4L8GA 1LFDB 3AVPA 1QG4A 1XZPA 5IF9A 1YRBA 4D4LA 5KYKA 4CZ2A 2RMKA 4GSYA 1OXTA 1LS6A 4URZR 2VP4A 4HB0A 4JBYA 3GP8A 1GITA 4DXAA 1XJCA 3U3KA 5LD2C 3REFA 4HI0E 1G3UA 4D80A 2ZJ5A 4D6PA 2J0QA 2J0UB 3L2OB 4KSBA 2X19A 3TRFA 2QUZA 4LHYA 1KO5A 3ZVNA 1G17A 4PFSA 2IUUA 1CR1A 4TMZA 4MQBA 3DM9B 3PEVA 3U7EB 1BMFA 1JECA 1Z08A 2GRJA 4WAUA 1HYQA 3I8XA 4JLAA 1Z2AA 2IYXA 1XJ0A 1KAOA 2RKOA 2QMEA 4DIEA 4JL6A 1QVAA 5EE3A 4X8MA 3RS0A 4TYPA 4FCTA 1Z2CA 2AK3A 2DYKA 1JPNA 1EFRD 4ZI3A 4TTQA 4BWYA 5CDFE 4F38A 2FSGA 2BVNA 4V0NA 4PC6A 3QXCA 1BMFD 5KSOA 1W44A 3A1WA 1DE0A 4ACAA 3U4QB 4B32A 3W8RA 4DWJA 1COWA 2DB3A 2IYVA 1T3HA 3GD7A 1TQ6A 1U8YA 2QGZA 3Q7QA 5JFGA 1CRQA 2O8DA 2V6IA 1NG1A 2AN9A 2ZXUA 3B5JA 4R2IA 1NLZA 1VG9B 2X2EA 3CPHA 4LV5B 4KLNA 3P27A 4PZLA 4PHHA 3RDPA 3IO3A 4GL2A 5FBRB 1UFQA 2GWHA 4Q47A 2H7VA 1UKEA 4TMTA 1AA9A 4B43A 3A37A 2JLYA 1SVSA 3R9IA 3Q5DA 1WF3A 4KYUA 2J7PD 1OIWA 4G5GA 1T6NA 4TTRA 4C0LA 2NOAA 4Q1EA 5KNDA 3K70C 4Q1DA 3IHLA 2GNOA 4PSVA 4B35A 1QG2A 4A2QA 2AL7A 4AIIA 4QJ3A 5TXGA 2PT5A 1F2TB 3CZQA 4HLQB 3BD9A 5F3WB 3PENA 2RGCA 3EPKA 2VSXA 3OIYA 3S1AA 2A5GA 2AK2A 2BWJA 5K8UA 1AM4D 1NNEA 5BXQC 1AQYA 2AWNA 3V4RA 2DWQA 1X8JA 4ASUD 1CXZA 4AKEA 1M8PA 3U7FB 1W0KD 1SVKA 2EFEB 5FOWA 1PUIA 4PAQA 2O8FA 1E79A 1G8GA 2QMUA 3B6EA 1XD8A 3LY5A 1KDTA 4Q00A 2LWIA 4URYR 2J0VA 1UDXA 4TMVA 1DEKA 1E69A 3PUVA 2BDTA 4OYHA 1QHNA 2JLSA 2E1RA 4RZUA 3PVSA 2QRNA 4OHZA 4BE7B 4M53A 3R9XA 4DDTA 4MYTA 3GLIA 2BHRA 1G4UR 1N3BA 1W0KA 3QY0A 2WWXA 4QC2A 3QKSA 1CR0A 1TX4B 2ZRBA 3T1OA 2ZRKA 2OAP1 3SN6A 3FHOA 2OCYC 3QUSA 4V03A 4Q66C 4A0FA 1GNQA 3FFBA 5FL7A 1E98A 1XMSA 3C15C 2IYYA 3T34A 2J0UA 1Z22A 3MRSA 4GT1A 3X2SA 3F8TA 5FPKA 3GLFA 1E2IA 2YWFA 3CF0A 1CP2A 2BMDA 4MA4A 3FWYA 5JEEA 1CR4A 4C7OA 1LY1A 3CPJB 2LCFA 3K0CA 1OH8A 1GILA 2BBWA 4TYQA 3SJBA 4TLDA 3WMEA 1IAQA 4YXWA 1ZYUA 1VCMA 3KQUA 2FDCA 2JEOA 2V7QA 1YR6A 4BRUA 4NDZA 4ZDJA 2CVHA 2BJVA 3B9QA 3A1VA 3K1JA 5CK4A 4E5UA 1ZNXA 2GZDA 4Z8YA 2IF0A 2AHOA 2CBZA 3CH4B 1K8RA 2ATXA 5CLQA 3GFTA 4BUJA 4EFMA 3E70C 4C2TA 3TGPA 1P2TA 1KJZA 2OO7A 5KOYA 1K5DA 1SVLA 2D3WA 5KSZA 4RY2A 3BC1A 1G21E 2ZRIA 2V9PA 1UBFA 5EP2A 1R7RA 4QJ4A 1SXJD 3A4MA 4YXWD 3ZH9B 4QHYA 4WA7A 1O87A 2NO0A 3CW2A 4JLDA 4XIGS 4G5QA 1NIJA 3TSWA 3U3OA 1YZKA 5JI2E 1P2UA 3W90A 1N5LA 1TEVA 4BLOA 5J4LA 2AFIE 3UXMA 3CRQA 4B74A 3GEHA 1VMAA 4IOKA 4FMBB 3CF6R 5JLJA 5KNBA 1UKYA 1NBMA 2JIZA 2XTMA 1DVRA 1OIVA 3LX8A 4PPQA 3JVUA 3K0FB 1G8FA 1RRCA 4MYHA 2IWHA 2F1RA 2V4ZA 3L8ZA 3B1YA 3RNLA 3IHWA 5EXXA 2CHVA 2J7KA 4U7DA 3CKLA 1DOAA 4YC7A 4Q4AB 3ONWA 1RRGA 1SULA 4OQNA 2ZYVX 3SNHA 2ODEA 2W2VA 3BB4A 4IOLA 1N0WA 4KSCA 3HR8A 2BCGY 2PZGA 2YVUA 2GCOA 3MJHA 5IRCD 2WJJA 2I3BA 1MOZA 4NCKA 2HEIA 3TLXA 3EA5A 121PA 1NN5A 4JLJA 4NE2A 2R62A 1E2JA 1KO7A 4WZAE 1W36D 3LVRE 4E03A 4DLWA 1Z6YA 2ZJOA 4P4SA 1EFHA 3VTKA 1IN7A 5LB2A 1ZCBA 3QKUA 4C9BA 4MKGA 2A3RA 4Q9KA 3ZZUA 3CB4A 5FH9A 1TTTA 1T5LA 1XRJA 1ZUIA 5JHGB 1FOEB 4GP7A 1CJUC 4C0JA 1HH4A 4FN5A 1GAJA 4AWXA 4ERNA 5IDVA 4B75A 3OAAA 2P6RA 1L4YA 3C8UA 4B71A 4JSTA 2G6BA 4DKXA 4XSHA 2Q9AA 1KIMA 1OPXA 1GWNA 1G6OA 4KODA 2CL7X 4BGDA 3PQCA 4KVAA 1NKTA 1EK0A 4BEBA 1G3QA 2ORWA 3AVUA 1UBGA 3CRRA 1YZQA 3BBPA 2CCGA 3QF4A 4C3ZA 4FCVA 2D2FA 4BFYA 3NC0C 4I4LA 4JKIA 3DO6A 1Z0DA 5DISB 1GM5A 3VX3A 1ESNA 2H92A 4KV9A 3I5XA 3M4YA 2Z5FA 2XNDD 4US1R 4UQOA 3JVVA 2IHBA 1QDEA 1LNZA 2ZE6A 2GBLC 2PZEA 4WVFA 5TARA 3EPLA 1WCV1 2FN4A 4XTCS 3PV0A 1BYUA 4X8HA 4A6PA 1MO4A 3QE0A 2J7PA 4PO9A 2O5VA 1YHNA 5JRZA 4OK3A 1XP8A 2D62A 2C04A 3AUYA 2ZJYA 1VG1A 3QKSB 3RSLA 4IDNA 4IXMA 3PEUA 1DELA 5E7IA 4PHGA 4C0BA 3THYB 1HEIA 3KXIA 4PXAA 3EPHA 2XB2A 1KNQA 4RCZA 2NO1A 2PJZA 1G291 5FOSA 5JCPA 1GDDA 3KJGA 1W36C 3TH5A 4I1OA 1NMYA 3KJEA 1U2RA 4M1TA 1W1WA 4PO1A 2R6FA 1IJFA 3TK1A 1XU4A 3B1XA 1GTVA 2ZE5A 2GTPA 1G1MA 2WIAA 4C7OB 5FOXA 4XWKA 1E2FA 3Q5EA 2I1VB 5KDLA 1HQYE 5BN5A 1KKLA 2P3SA 1BIFA 1R5BA 3T5DA 5CLLA 1XCGB 5G3YA 2RHDA 1Z5ZA 4LOAA 1SQ5A 3L82B 3ZIAD 4QBFA 1ZUNB 3TE6A 3GLHE 3NTUA 4PQFA 2QROA 2V55B 2VP2A 1DAFA 1U90A 1NIPA 1GKIA 5FBQB 4M4SA 4D26A 3U44A 1VPLA 1FQKA 4OHWA 1SVIA 3DMNA 1OKKA 5H68A 2QL6A 4FMDB 2P0EA 1Y63A 3W6PA 1NG9A 3LX5A 2PCLA 1U94A 4JLPA 3TQCA 2VSOA 3ZZTA 5L3QB 2VLIA 3QIAA 5BN4A 1AZTA 2IYRA 4BFSA 4HLUA 3WMGA 1YZNA 2O52A 5FUVA 4JKYA 1W4CA 3DZ8A 4JYBA 1TQ2A 4EUNA 3PCRB 4DT1A 2GCOB 1D8TA 1EX6A 4LYJA 1OYYA 1IN6A 2EW1A 4LZZA 3VKWA 4ZDWA 1LS1A 1M2OB 3KX2A 5HE9A 2Z0MA 3CM0A 1XTQA 4C0AC 5JZVA 3SS8A 4JVLA 4X8OA 3HJNA 1ZM3A 3AKCA 3D8BA 4S2EA 4I81A 1US8A 1G5TA 2IUSA 3IGFA 4JBXA 1G5RA 1R8SA 1G7CA 3CNLA 4A8JA 4S35A 4DIDA 5L8VA 2ZI5A 1OH5A 4U00A 4GNKA 3GCGA 4E07A 4EPYA 3MGCA 4HSEA 5DYIA 2QRZA 1YZTA 3NKVA 4B3XA 1CRPA 2JJ1D 1KOFA 4C30A 2YOHA 4LPKA 5DSZA 4IW3B 3EZ6A 3LFUA 1KDOA 5BQ5A 3AQ4A 3NHAA 1IY1A 3RVBA 4KAXA 1YZLA 2JLQA 1ZC3A 3NDBB 1H65A 1T4GA 5LPNA 1DAHA 5EUMA 1V43A 4US2R 4DDWA 2HT6A 3BFVA 4FCWA 2X8AA 3QOFA 3CPEA 1OSNA 3QSYA 4NYMR 4XTRA 1NVWQ 1E9FA 4JBWA 2GJ9A 2QT0A 3SJAA 2VQSA 1U0LA 2KE5A 4IFEA 1KI6A 1Q20A 1GVNB 3SHFA 3IEVA 2NIPA 4LSGA 5CDFA 1SVOA 4B3CA 3H2YA 4DSNA 5AK0A 4PO8A 1KI4A 2E87A 1L2TA 3EWAA 5FBVB 1QHXA 2OBNA 4DB2A 3FMOB 1Q1QA 4G3XA 2NPIA 4JLMA 4A0GA 2MSEB 3DHWC 2B7CA 3AF1A 2WWIA 4PZZA 3VNUA 5B64A 4Q48A 2ZJ8A 2GF0A 4P33A 3JZMA 2WICA 2ZAMA 2J3EA 2WOJA 3DDCA 2XITA 3FHCB 3U6BA 5JWRA 1E9SA 3EZ2A 1DS6A 3IIMA 1NN3A 1I4DD 1RYHA 1WRBA 4UNSA 3TJZA 4GZLA 2WSMA 4K81B 1QRAA 1CIPA 4LJ8A 1G3IA 3UWOA 2J41A 1G3RA 2DCUA 3NG1A 1A4RA 2JJ2A 2QGNA 2V6JA 1JBKA 1GNPA 1RKBA 2ZR0A 2OXRA 3NHBA 3KFVA 4XD7D 1W4RA 4HB4A 3N70A 5DYGA 2VF7A 4Q03A 2JATA 2ERYA 4KVGA 4TLEA 2B7BA 2QAJA 1Z0AA 5FUXA 4XWOA 4QGFA 4HAWA 2D7CA 1FMLA 5EE5B 2OSBA 5C18A 1SHKA 2QAGA 4HLUC 4TYNA 5CYOA 3R8CA 1CBUA 2ZI9A 3LXXA 2W2XA 4B2LA 3MWLA 5TDHA 3NBXX 2HUPA 1M7GA 1E2LA 4NU0A 1ZW6A 3ZLJA 2J59A 4KCGA 1B0UA 4KFSA 1CF4A 1P4SA 2HYIC 1Z0FA 3CIOA 3H86A 4LCBA 2VP9A 3L43A 1F3OA 1M34E 4NYIR 4I1UA 5HKKA 4GMXA 1ZP6A 4PAMA 4Q9IA 2BV3A 5JSZB 2I4IA 1QHYA 2GZHA 1XMJA 5HZKA 2GAOA 3ND8A 1OFHA 3EWSA 5AUQA 4QKQA 4RD6A 2WTUA 3BRWD 3QKRA 4CT5A 3VNVA 2HCJB 4JYCA 4NBSA 2VO1A 2XOKD 4OK5A 4JLOA 5E95A 3T15A 1X8KA 2REOA 3AF4A 3C5HA 3H4MA 5BYKA 1AS2A 3AB3A 1DAIA 4L9SA 3TKLA 4B3GA 2ZI6A 4DCTA 2KBEA 4U5XA 2ZRFA 2EFGA 4JVNA 1A7JA 2J87A 5HCNA 1G41A 3A6PC 3BJIC 3C41J 4CDGA 3WYFA 2FGKA 4M1OA 4EJSA 3C5CA 3GJ8A 5K8TA 4DHEA 3RS7A 1W7AA 2H1LA 3WNBA 3HDTA 4A9AA 4M9XA 2F3RA 3N2EA 2ZU6A 1ZBDA 5C46F 3THWB 3CZPA 1MRSA 1W0JA 3ICEA 4HUQB 4DLYA 4ARZA 3VKGA 4LUCA 5J4YA 3Q8XB 2H8KA 2KSQA 1P9RA 4QBHA 2WKQA 2O0HA 1GFIA 4A6XA 1ESMA 5C4GB 1QHIA 2CNWA 1KSGA 3QPWA 3BH0A 1HQCA 4G5SA 1MT0A 4HB3A 2FE4A 2QE7D 5JWOA 3AV0B 3AVWA 1EFTA 2YWHA 3X1YA 4EFNA 4EPWA 4ZIRB 3U7GA 2AWOA 1P73A 3SR0A 2IXEA 2XXAA 1M7BA 3AVQA 5J4HA 3U5ZB 2LKDA 3AEZA 2YINC 4V02A 2ZRGA 4MDFA 2FPMA 2FFHA 2ZROA 3L0IB 4AURA 1G7SA 1II8B 2N1BA 3NBZC 4G5OA 3FVQA 3A36A 3R7WB 4ZV4A 1R2QA 1TQ4A 4TLBA 3UKDA 2VP5A 2C9OA 1ZD8A 2HJVA 4QHTA 2ZE8A 3FMPB 3DOEA 3KKQA 4C0SA 3UWKA 2V8OA 1WB9A 1E1QD 4QHSA 4KITB 2A2ZA 221PA 4TN1A 2OBMA 4M9SA 5EXSA 4M1SA 4MRRA 1AKEA 2HDNB 3W3ZB 3SOPA 1KNXA 2C5LA 3ADKA 2VA8A 1YR7A 4UJ5A 2WIBA 5KSYA 1OFTA 4QGHA 5GJWC 4A1FA 4BFXA 5F9HA 2CMKA 4D82A 4XJXA 1OF1A 2G0NA 1ZU4A 4JVSB 1VIAA 1YRAA 1OH6A 4JZKA 1A82A 2F1JA 1KSFX 2KJQA 3SQXA 4M9QA 3GLGE 4AYWA 4LY6A 3I61A 4YMWA 3THOA 4URXR 2QAGB 2VF8A 2VIIA 1S96A 1VHTA 1TPZA 4NCHA 1T9HA 3PUXA 1ZNWA 3EIEA 3SU8A 1T8UA 4M21A 2PMDA 3WP1B 2IYLD 3MWKA 2JLRA 5FOTA 4TLCA 3C16C 2ZTSA 3KTAB 1AQUA 1VIYA 1XFAA 3QF7A 1ZVQA 3CO5A 4WXRA 1BKDR 4JL5A 4MUAA 5CB8A 1SXJC 2ZQ5A 4RD3A 1FW6A 2OFXA 2O8EB 5JSZA 4LV6A 4G5RA 1UEJA 2GJAA 5JWHA 4L5BA 3RANA 4F4CA 1KYIA 1SGWA 2R9VA 3CBQA 1CJMA 1KDPA 3F3YA 1XDBA 1HA3A 1GL6A 4HATA 1H8ED 2BBTA 4GOKA 3MCAA 2ZS9A 5CM9C 2O8CB 2W2TA 3I73A 2C8VA 5C1BA 3K70B 4BFWA 5J5CA 1SXJB 5DLQC 1Z29A 5HE8A 2O8BB 1OHHD 2EVWX 3K9GA 4NL4H 4W5HA 1NMZA 4JLNA 1S2MA 3NH6A 2PEYA 3W5JA 4R7ZA 4C0KA 2BKEA 1KI8A 1B23P 3MG9A 5BW8A 1WXQA 4POAA 4NYMQ 2RGBA 2J5XA 1E9CA 5CIQA 1GL9B 4LJ7A 5TMPA 2IBMA 3THWA 2G1JA 4NMMA 4AG5A 3O8RA 3G0HA 3MJRA 2ZRPA 3GMTA 3W5IA 3W3AA 2JLZA 3N5CA 2FMXA 3Q85A 1OFIA 2O0JA 3WHLA 3K09C 3VMFA 1L4UA 1MR3F 2DBYA 3B13B 4XVRA 1RIFA 3IILA 3UMSA 3S1AB 2GJKA 2VBCA 1FQJA 5CJPA 4ZIRA 4IHQA 1GRNA 2OHFA 3QXSA 1GKUB 1NVVR 2OLKA 2Y8EA 1AS3A 1VYUA 2QORA 2OESA 4TL6A 4RJLA 4V0LA 4A92A 2BBOA 1D2NA 2C98A 2MSDB 2XZPA 1TMKA 5G41A 3TW4A 4IOMA 3M6AA 2QQEA 1N6HA 4OJKA 1HE8B 5FBLB 4DLSA 1JPJA 1E2QA 3IIKA 2XEXA 1GRRA 1MV5A 2YZ2A 2Q3MA 1MKYA 2JCSA 3P4YA 1R10A 2CK3D 2PMKA 1M6NA 2HYDA 4PHTA 1G8HA 3W9YA 4AC9A 2XXAB 3O8CA 4KJZA 5AUPB 2FG5A 2Z4RA 2RGNC 3ZVRA 2ZSDA 3AGPA 3PITA 1W49A 2F6RA 1ZJ6A 2ZUDA 4ASUA 2ODBA 1HURA 4RFSB 4A0RA 4YONB 2A5FA 4Q7KA 2P2LA 3U3RA 1KHTA 1OH7A 3EA0A 1DAKA 4O2RA 4QM6A 3QJYA 2O0KA 2CDNA 3K9HA 4PR0A 4B2PA 5DN6D 1IHUA 1JR3E 4KFRA 5SZHB 3HU2A 3GFPA 1LV7A 1E9EA 4PSKA 1OXVA 3B7GA 4AI6A 3ZYCA 3EW9A 1Z6TA 4GI7A 2ZM5A 2I1QA 2XGJA 4D4JA 1FP6A 3P26A 2FV8A 4DLVA 5J4VA 4EJSC 2RGGA 1Q0UA 5FPTA 4N0DA 2WWFA 3TR0A 4DEYA 1E1RA 4FI3C 5FL7D 5A5GA 4EPTA 1Z0IA 3NWJA 1BYIA 1G6HA 3KTAA 1JAIA 2X77A 4DLUA 3WMFA 721PA 2ANBA 3WRYC 1E0SA 1IXRC 2GDJA 2ERXA 5JJKA 1KJYA 4Z1MD 4FMCB 1XTJA 1G20E 2O8EA 2FH5B 2ZPTX 3GJ0A 3CR7A 4MGZR 2PJRA 3B2EA 4H1VA 5K8LA 4LJ4A 3ZVMA 3OFNA 4EPVA 3AF2A 2WM9B 2C2HA 2AD1A 4JLKA 3B60A 5KSPA 4B3BA 3CRVA 1XXHE 2QM7A 1XCPA 2GXUA 3K0FA 4P3YA 4PHFA 5BN3A 1EG7A 1NP6A 2ZI3A 1W47A 5HTKA 4AKIA 3VR3A 1UM8A 2VL7A 3EPJA 1Z6AA 3GEEA 1SXJA 4YDHB 4D81A 1FUUA 2QTVB 3P32A 3W6NA 4JJZA 4B3DA 3OFND 1NY5A 1NRJB 5DHAA 2A5DA 1Z63A 2JDID 3V9PA 5JCZA 4JJKA 2QP3A 3KQLA 1GOTA 1X6VA 2O8CA 1NBMD 2JIZD 3VHLB 2AKAB 3RABA 1XD2A 1VKJA 5LDDC 3GPLA 2ONJA 1P2VA 5EP3A 5CB6A 2E9SA 1T0JB 3R8FA 4P31A 4UNNA 4UXJA 3CNNA 4LJ5A 1XWIA 3BFXA 3EG5A 1S1CA 2GVDC 1GSIA 2JDIA 3AGQA 1OE0A 4Q9JA 1FX0B 1G3MA 2PEZA 2GVZC 2X1VA 5HZHA 3E5HA 3GJ7A 1XD9A 4GPTA 4MRSA 4NYJR 2F1HA 2C99A 3PUZA 4CRWB 3VAAA 3WNCA 3QXJA 3QVVA 2HF9A 4LC0A 4ZI2A 1I2DA 2OEPA 4YMSA 2GBLA 4XSGA 2R65A 5HR5A 2AXNA 2P65A 4MKHA 5L3RA 4N1AA 1GIAA 3WYGA 4O0MA 5FOVA 3L0OA 5EUQB 2OFWA 1KI1A 1IQPA 3X1ZA 5JS7A 2QM8A 5B57C 3SZRA 1XXHB 4GRAA 4Q1FA 4F93B 1GNRA 4JLBA 4FW9A 5E7JA 4Y0AA 3LBIA 1TNDA 4LI0A 4ZPXA 4OQFA 3IQXA 4B6FA 4BQSA 1PUJA 4O25A 1DTSA 2FA9A 5AR1A 3VHXA 2QBYB 2YOFA 3AVYA 1S3SA 2CCJA 2FOLA 4FD2A 4CEIA 4BASA 3TQFA 2CHGA 1T0HB 3GQBA 3DVLA 2OLJA 2AD5A 3K0EA 4LPSA 2BKUA 1F6BA 1DADA 2BCJQ 2VP6A 4Q01A 3WBJA 2C77A 2QG6A 2QQ0A 4M9ZA 2MMGA 4EPRA 3H1TA 4HZUA 5FPHA 4RFSA 4YMVA 1UAAA 1UEIA 3L0PA 3BS4A 3SHWA 3UMFA 4NCIA 2ZSEA 2V1XA 2GESA 5H8WA 2Q21A 1G9XA 1O3YA 4PTLA 5IK2A 2QNRA 1QHHB 2FZ4A 1DO0A 4OKSA 4F4IA 2IX3A 1RW4A 1LTQA 3F0TA 2UZIR 4WZBE 1ZM9A 2F1IA 3I72A 5FI0B 3PEYA 4I1VA 4TMXA 4D4KA 4QBIA 3LXRA 1Q44A 2QTHA 3K70D 4A2WA 4A36A 1CULC 4NYJQ 5J47A 2WWYA 2AX4A 1U0HC 2OUKA 4QXAA 5IK2D 3KKPA 4OQLA 1XEWX 2CLSA 2P5TB 3HR7A 4PC7A 3LQRA 2J9RA 5D3MA 4BLTA 3CRMA 3DOFA 1XZQA 4ON9A 3AKDA 5CK5A 2FGJA 3LQQA 3SBEA 3LAWA 3ZJYA 2VYFA 4Q4JB 2NZ8A 3TUIC 1XNJA 1N0VC 4TL7A 2IYUA 4Q21A 4CEHB 3C7KA 1NBME 2CEAA 2DFTA 3MD0A 2RCNA 3BGWA 2CHQA 3BERA 2FFBA 1DAGA 3UANA 4DLRA 2ZSBA 5EE9A 1CLUA 4HAVA 1U0JA 1Z06A 1R4AA 2HXSA 4L4UA 2XNSA 4LJAA 5FTNA 5C4MA 5L3QA 2O8DB 5CJ2A 4NH0A 3AUXA 4DT1B 4YLGA 1Q1EA 3WNDA 3GJ4A 1F2UB 4D0NA 2OILA 1NVUQ 4N0EA 1ZM2A 3GJ3A 2ORIA 4Q1CA 1IN8A 3G5UA 2F9MA 4CGZA 1LVGA 5EE0A 2CLDX 2H16A 4LGMA 1TAGA 2V7QD 4XVQA 4URWR 821PA 2FSHA 4LHXA 4HEJA 1N6LA 5IHPA 4C2UA 2NO6A 4MRVA 4KLZA 4A8JB 3AKYA 4DLZA 1IJEA 1FX0A 3BIFA 1ZUHA 1Z0KA 3K0CC 2W0MA 1Z8FA 1XD2B 1KMHA 1W2GA 2IYZA 1ZM7A 4GZMA 3PUYA 4I1SA 2NGRA 2IWRA 4Z54A 4DC9A 3KQHA 5TVKA 2YWEA 4IRUB 1NN0A 1AZSC 1E0JA 2Z6VA 5AJVB 2IYQA 1FZQA 3NC1C 3NVAA 2A78A 2HXYA 1VG0B 1KDRA 2EU8A 4ZKDA 1Z07A 1R8QA 2BBSA 2G83A 2BC9A 4HZIA 5CYPA 1SKYE 1Z28A 4RKFA 4US0R 4G01B 4BFZA 2OE2A 2KB0A 4FMCF 2BM0A 5IT5A 2C03A 3RAPR 3CWZA 2D06A 4TZ6A 2ZANA 3SFZA 4OK6A 2EWVA 1RZ3A 3UMRA 3I3SR 2A7QA 4BLSA 3VR4A 2W6JA 1MH1A 1P9WA 2FZLA 1NSTA 1U8ZA 5EQTA 4TLAA 1LB1B 2BM1A 1TU4A 4Q9HA 1P7CA 3ZD6A 1ZCAA 1KI3A 2WWGA 4FIDA 1ZNZA 5EP4A 4XH9B 1XXHA 2W83A 3GEIA 3HU3A 1IN4A 2REBA 5G40A 4HZUB 1UADA 4M1WA 2BEKA 6Q21A 3BH6A 3FPAA 1T5IA 3SYLA 1SVMA 1N6IA 3IDQA 4JVMA 3ZQJA 4Q9LA 1HUQA 1R5NA 2WPDA 3MAAC 1UDWA 1QVRA 3K8YA 2QEQA 2WJGA 2PL3A 1ZC4A 2PX3A 2OV2A 3ZDQA 4B3FX 2RGDA 2B8TA 4LBWA 3PXGA 2ZRMA 3OIVA 1P5ZB 2IS1A 2JASA 1GRQA 4FMDF 4NKRA 4QNRA 5BYJA 1ZIPA 3K53A 3QENA 3B1ZA 1T3SA 1U9IC 3GFOA 2A5YB 4NPHA 2L0XA 3Q3JB 1XEFA 3I5YA 3IPXA 1E9RA 5JEDA 4BZPA 3KQKA 5SZIA 3ADBA 3FKQA 2OFOA 2Z4SA 1CS4C 2HT1A 3EARA 2IYSA 4HLDA 4YMUA 3TNFA 3FE2A 3I4LA 1VG8A 1MABB 1VYTA 1J2JA 4OI4A 3P1JA 4H1UA 1CJVC 4TZ0A 5HKKD 1K5GA 1YZUA 1H8HD 2GILA 3MSXA 4PQRA 3W6OA 5E7MA 1VCOA 1TUIA 1UBEA 4Q4HB 3ZS8A 2WMOB 4G0NA 1IXSB 1RC8A 2XNDA 4EDHA 3EX7C 1DG3A 3U6KA 3RC8A 1KK2A 1RE0A 3RRYA 2YYZA 4DDUA 2FEOA 3AM1A 3UG6A 1MO5A 2ZRJA 4U02A 4FWIB 1TF7A 3LLMA 3KXLA 1NY6A 3DPUA 3GJXC 1SKYB 1T91A 4Q4JA 5DH9A 3NBYC 2ZS7A 3I32A 5H70A 4DCVA 1KJWA 2EFDB 5AJYA 5L3SB 4W7SA 4YDSA 2DHRA 2R6DA 3TW8B 3Q7PA 5DGXA 2Q9CA 5GVSA 5JHHB 3I92A 2WVJA 5JMTA 1TADA 3QEOA 1E2EA 1ETUA 5EZ6B 4B34A 4P4UA 2QY9A 3CX8A 3VQTA 5GJVC 3P4XA 2REXB 4IDPA 3OIUA 1JQJC 3W8NA 2BMEA 4PPNA 1KMHB 3IBYA 4X8LA 3ZVLA 1RPZA 1XMVA 2WSSD 2IEZA 5B58C 3T12A 2KBFA 3EIQA 4P4SB 2B6HA 3SE0A 1L8QA 4B6EA 5G3ZA 2ZR7A 2IYTA 5M04A 2F43B 4KHZA 3HYRA 3BB1A 4RVCA 3QPUA 4TL9A 1DO2A 3TUJC 3VFDA 1HV8A 3IPYA 3OEEA 1R0XA 1XTIA 2UVQA 3DL0A 4W9MC 1G8PA 4DRZA 3K0AB 1YR8A 1KSJA 3RHFA 1N5KA 2YC4C 2QSZA 4BEJA 1OKKD 4JMPA 1BS1A 2MSCB 4HUTA 2TMKA 2BOVA 2R8RA 1XTRA 5DE3A 1F2TA 2XJ9A 4Q1BA 2VH5R 5DHFA 4IEIA 2ZJBA 5FOUA 1W5SA 2GAAA 1OJLA 1J99A 3AVTA 3ND9A 4UXHA 1XX6A 1YU9A 2D4HA 3AP1A 2NZJA 1A2BA 2IL1A 4FXPA 5EXTA 4EIWA 2D74A 4GFDA 4LK2A 4P0TA 5EJEA 1DPFA 2WKRA 1L7VC 1W5TA 1R0YA 2WWWA 2EYQA 1D9ZA 1JJVA 3SQWA 2JA1A 1LW7A 1E2GA 4D25A 1P60A 2NPFA 1NJFA 3T06B 4MRNA 1YQTA 4PC3A 1P75A 2PLFA 1VCIA 4H9GA 1E4YA 1SVWA 4HDOB 2ORVA 3SC3A 4GBMA 4EPXA 1J70A 1A2KC 2ZVPX 1N6OA 1OW3B 1EX7A 2YHSA 421PA 4C0QC 4GOXA 2DFKB 1SKQA 5TV2A 2R6GA 3LBNA 2FFQA 3U2QA 1NVXQ 3THYA 3D3QA 1Q22A 1COWD 2ZRNA 1E96A 2VSFA 4UXIA 5GJCA 3KXKA 4LBYA 1X1SA 3QQ5A 3V4FA 1GKYA 2C78A 1X1RA 4TMKA 1IM2A 1Q21A 1C4OA 3DMDA 1BOFA 4A2PA 4LJ6A 3HPRA 1OFUX 1P72A 2BIFA 3GLFB 3AF3A 4Q1AA 4W5WA 3OESA 3B82A 4TQAA 3V00A 3K9LA 4MITA 4D0GA 2JAQA 1NL3A 3SYKA 4EFLA 2ZVQX 1W46A 4PPFA 3EASA 1N5JA 1VECA 4LC1A 4Q4HA 4DZZA 1ZMXA 2IXGA 5SZJA 3CX7A 3PEWA 4MUBA 4QOSA 2GK7A 1SXJE 2VEDA 3TMKA 1HY3A 3GJ6A 3Q72A 3B85A 2G1KA 4BLPA 5CITA 2UZ3A 2QMOA 3KB1A 1NLFA 3LW8A 1JEEA 4XVUA 1MABA 1Z6XA 2NTYC 1E9BA 3PR1A 1Z0JA 1DBSA 3L0SA 1YZGA 1UPTA 4F91B 2BMJA 4QNMA 5P21A 4B44A 3EC2A 2YJTD 1G16A 4IDHA 3OZXA 1KY3A 3VR6A 2ZUBA 3CRW1 4GOJA 2DY1A 2J1LA 4Q02A 5DIFA 4DSTA 1KI9A 4HAXA 4XWAA 1C9KA 3DZDA 5FTKA 3AP2A 5LBIA 5G53C 4KFTA 4UNRA 5H1YA 5CIWA 1NKSA 2G88A 4OJQA 2ZJAA 3TVDA 2O8BA 4IVQA 4IFBA 1I2MA 1E79D 4NONA 5L3SA 1Q12A 3T1QA 1KI2A 1KO4A 1E6CA 1VCNA 4P32A 5GJBA 1I4TD 3SJCA 4N3NA 4RSGA 5TY0A 3ZD7A 3G82C 4Q4AA 1US8B 3VKHA 3QG1A 3UATA 1N6KA 2FFAA 2RHMA 4V0ME 3TSOA 1H8EA 3TVTA 4TT3D 4C4PA 3T1TA 1E0AA 4LHZA 3L8YA 2WAXA 4B33A 4JT4A 3LA6A 1IOZA 1UKVY 3RRNA 4YQFA 4Z8XA 2BMFA 4UKDA 2OCPA 1KY2A 1PVOA 1W2HA 2GJ8A 1XMIA 1HTWA 3AVOA 3KB2A 4DUGD 5ANRB 1RJ9A 1NMXA 2F43A 2RGNA 2Q9BA 2ZJZA 3QKTA 1OXUA 3D7MA 3NIBA 3J81k 1S8FA 2ZRLA 2OCBA 3MWJA 2QP9X 4IVPA 2R44A 1YJ5A 1GG2A 2GEVA 2CXXA 5KPDA 2NG1A 1R6BX 2ZRHA 1G8YA 4PSAA 3K0AA 3UG7A 4Q19A 2FJUA 1N5IA 2IW3A 3ZGXA 4M2LA 4DDVA 5F2EA 1G18A 3LDAA 1E0KA 2Q0HA 4TL8A 5EP1A 1P3JA 3R20A 4J0QA 2WJHA 3CR8A 4DJTA 4ILEA 2XOKA 1IN5A 1E2PA 3GLHB 3EIHA 4G1UC 4OI2A 2G0TA 4TYWA 1UBCA 1NJGA 2YOGA 3IO5A 2XB4A 4L16A 2QZ4A 3QF4B 3I1FA 2P6NA 2B21A 2IUTA 2LKCA 3GJ5A 4LX0A 2YWGA 2GXQA 2JLVA 4Q5IA 1XEXA 3FB4A 2WV9A 3IUYA 1Y3AA 1CJTC 2CK3A 2ZREA 3EC1A 1JI0A 2GZAA 5FPSA 4DBLC 2F7SA 1J8YF 1N25A 2KWIA 4F7WA 2D7DA 1XF9A 1XBTA 4UNPA 4M1YA 3CONA 4PANA 3A4LA 2WWHA 1U8AA 1DARA 3PIRA 3SFVA 5HPYB 2OG2A 8OHMA 3FGNA 3RRZA 1G7TA 3KKOA 1F48A 1Z47A 2ZI4A 2GETA 3AP3A 5DN6A 4GDFA 4EAQA 4PC1A 3OHMA 3KUCA 3Q9LA 1E2KA 3QPVA 1T8TA 1EFRA 1VDZA 3LD9A 3LVQE 4ITRC 4TTPA 3RC3A 1KKMA 1PLLA 1AKYA 1WE2A 4E09A 3FOZA 2YNMA 1LF0A 2VHQA 3CLVA 4V0MA 3UK6A 3BFKA 4B2IA 3C14C 1WDTA 2CJWA 3BE4A 3NEYA 4TSFD 1EWQA 1JAHA 1LF5A 1JQLB 2C95A 4DVGA 2QU8A 2RH5A 1PLKA 3BAFA 1E1RD 5FUWA 4BPBA 3QVUA 3QXHA 2ZRDA 1R0WA 2G9NA 4JLVA 2G3YA 4Q7LA 2IA5A 3SYNA 2JJ8A 4PAOA 2GF9A 2HLDA 1S9DA 5DI9A 4RZXA 3BK7A 5AJXA 3T61A 3A1SA 4BECA 2QSYA 5JS8A 1XEWY 4LV8B 1N0UA 3RLFA 5B2ZA 3CX6A 4MKFA 4ZKEA 3EZ7A 3U4QA 2HF8A 3THXA 2D2EA 2P5SA 3QKRB 4AG6A 4F4JA 3X1XA 2IF2A 4MH0R 4PZYA 1CKEA 1G64A 2PZFA 3NH9A 1CEEA 3LBHA 4Q18A 4BZXA 5D3QA 3NBFA 5KU1A 2OCAA 2BJWA 1R5OA 1KGDA 4P4TA 4HB2A 3U3JA 5F9FA 4K8OA 1UF9A 4IDOA 1Q3HA 3EZFA 4L9WA 1UJ2A 2RGXA 1ZD9A 4BFVA 1IBRA 2IT1A 2JLXA 2QP4A 4A0HA 1NN1A 1YKSA 3MMPA 4HYYA 5FR2A 1GZSA 1FL9A 2RAPA 5FPYA 4JIMA 3GLGA 4HUQA 5ELXA 4ARZB 4LYFA 2PCJA 4NP6A 2WOOA 1EFCA 2QENA 2F3TA 4RD0A 4HLCA 5KO2A 4R9UC 2QN6A 2C9CA 2GHIA 3VR1A 2NO7A 3CNOA 1FNNA 3RYTC 4DB4A 3QEJA 1TF5A 4KBFA 3RS3A 1R0ZA 1Q3TA 3B78A 1FNMA 2CE7A 3AKEA 1S3GA 1OT3A 4R98A 1Z3IX 4BFTA 1XPOA 4NYIQ 2IS2A 1II8A 4WW0A 3QI2A 3ECCA 3WRXC 2WZQA 1FPMA 2YC2C 3IBGA 3H84A 4B48A 2K5UA 1F5NA 5GADl 1IXZA 3FTQA 5JRJA 4WBSA 2QBYA 1OHHA 2P67A 2IXFA 3HPQA 5FTLA 3PJRA 1WBDA 2QMHA 2ANCA 2B8WA 2PLRA 5AUOB 3VU9A 1W4BA 3ZIAA 4D4MA 4MYUA 3ZQ6A 3EZ9A 1GP2A 1E2MA 1OXSC 2G77B 1JALA 1VHLA 2MMCA 2C9YA 2FX3A 3GLHA 3FMIA 1YR9A 5LD2B 3ADDA 5HCIA 3IKJA 5KDDA 2F55A 3K09A 2Z43A 3GLFE 1RFLA 2ATVA 4DCSA 3O47A 4TWZA 3SJZA 1AS0A 2CVFA 2XZOA 1QHHA 3LO5A 3U61B 5FL3A 4CF7A 2IHYA 1AIPA 2AFHE 1VTKA 3KJIA 1WBBA 4Q7MB 4IXNA 3LWNA 2GCPA 1S0UA 2J45A 2P6UA 1FMJA 2OT3B 3LV8A 5A4JA 4NTZA 2ASEA 2DWOA 3K0SA 1JXOA 1OIXA 2QI9C 4RD2A 1TQDA 2RGEA 1CJKC 1WP9A 1J90A 5KDOA 4M8NE 3FKSD 1W48A 1P6XA 4WOPA 3ZZ0A 4LYHA 4XOIA 1BO6A 4LJ9A 3MLEA 2F9LA 4M1MA 2R6AA 3HWSA 2YKGA 3VR2A 4NZYA 4QFMA 4QM7A 1RRPA 4A15A 2GJSA 2WBLC 5UKDA 2IS6A 3C4JA 4Q4LA 1OYWA 4M22A 4A4DA 4OQXA 2CJWB 3BB3A 3MWYW 1WQ1R 4RZ2A 5E4FA 4B47A 2XJ4A 3BOSA 4QL3A 1P62B 3F5FA 3THXB 2JJ1A 1N6PA 2XSZA 2XZLA 2GK6A 3OEHA 1S1MA 3RRMA 3TAUA 5KUTA 4A8JC 4V0KA 1KTVA 5KNCA 5A0FA 3RS2A 5EXPA 3PG5A 3QG5A 1OV4A 1EESA 2X2FA 4HDQB 4M0LA 3DKVA 4DCUA 2OAQ1 2W6ID 2ZETA 1DAEA 5FFMA 1NI3A 3OEHD 5EZ5A 4R2HA 4RCYA 4CEJB 3GLGB 3QXXA 5FBWB 3RS5A 3WP0A 1DAMA 3E1SA 2JLUA 3FHTA 4LJYA 1Q1ZA 1E2NA 1IY2A 4Z1MA 4TSFA 3OE7D 3U60B 3KKNA 3LH5A 1ZM4A 3ICQB 4E22A 4WIAA 3OAAD 5AWFC 2W6IA 2ZSFA 2FSIA 1FP7A 3WHKA 1J7KA 2WJIA 3T5GA 4ZCLA 3AH8A 1ZD1A 4NHOA 1MO3A 3CUEF 1XPRA 4NCNA 4D2IA 1PLJA 1QZXA 2HLDD 2ZU0C 5F98A 1AK2A 2PH1A 1KZ7B 1IONA 4LYAA 4TQ9A 3RS4A 3OE7A 4CYMA 4HAYA 1CR2A 2SHKA 1U9IA 5AJZA 2DPXA 3I62A 4NCJA 4O2LA 2IEYA 4AY2A 4W5JA 4B76A 4XD7A 5DO9A 2FPKA 1OB5A 4MGYR 2IYWA 1KAGA 4LWZA 1KZGB 2QA5A 4EQ6B 2OM2A 5C2JB 2B92A 1RVDA 1Q1BA 1CTQA 2H57A 5LB4A 1TL7C 2AXPA 2ONKA 4WZ6A 3M0EA 3R7WA 1AGRA 4LBVA 4OHVA 3AVVA 2W6JD 1Z6GA 1E3MA 3VU9B 3VX4A 4EKDA 4A82A 5SZKB 3PFIA 4Q7JB 2ZRAA 4DLXA 1G19A 5CM8B 3O8DA 1ZAKA 1D6JA 2FPLA 1AJEA 1ZINA 3KUDA 2NMVA 4MGIR 1E32A 1MO6A 1U99A 2VP0A 4I99A 3QNUA 4B73A 2HCBA 1AN0A 2GA8A 1EWRA 2BEJA 2YV5A 1F60A 1PJRA 2RGAA 1CU1A 1G4AE 2ZRCA 3D31A 1A5TA 1NVVQ 3IQWA 3O8BA 4M1KA 1XCMA 2VTKA 1WA5A 2ZEJA 2GXSA 2RB4A 3N2IA 2CL6X 2V54A 4II7A 3KQNA 3K9NA 3DKPA 1E99A 4Y0VA 3TAHA 3RWMB 4OL0A 4RD4A 1X86B 3CF2A 3WXMA 4TYYA 2OXCA 2QPOA 4DEXA 1JNYA 1N6RA 5DI3B 1II0A 1JR6A 3SDZA 1XTKA 4ZDIA 1XPUA 4FINA 4MDEA 3I8SA 3KKMA 1E9DA 2FF7A 1IY0A 2CL0X 2Q6TA 1E4VA 4RZ3A 5KHOC 3GLIE 5FTJA 5JJLA 3IIJA 1JEDA 1QF9A 1RYFA 3A58B 1PV4A 1S9HA 3HP1A 2H5EA 1OB2A 1KMQA 2ODNA 2WMNB 2QPAA 1M1YE 2CNWD 3LLUA 4AD8A 4AK9A 2QE7A 2ZIAA 3EXAA 2XAUA 4OBEA 3AVXA 1JB1A 3X1DA 3M1IA 1D2MA 1GUAA 1TEXA 3SBDA 2A5JA 3TIFA 2ZITA 4R71A 4CEJA 2HJGA 5FTMA 1NSFA 1DG1G 4IJMA 4MKIA 1RRFA 4F92B 4GP6A 4UJ3A 2Q3HA 2UKDA 3D6TB 1N6NA 2ODWA 3FKSA 2FU5C 1E2DA 2ZS8A 2IC5A 4CVNA 4ABYA 3FDIA 3FFAA 4DSUA 5FUYA 2WAYA 5AUNB 4IVRA 1XB2A 3E2IA 1P61B 1M74A 4OHYA 1ZIOA 4UNQA 1E1QA 1FUKA 1ELOA 3TSZA 1X8LA 2AR7A 1N2CE 2DR3A 4RD1A 5BWMA 2ZUCA 2GXAA 1YE8A 4IKEA 1XJQA 3MFYA 4ACBA 2WSSA 3B9PA 3CWQA 4C0HA 5B30A 1BH2A 4HAZA 1FTNA 1I4LD 1NF3A 2XSZD 2NO9A 2DFLA 2VHJA 3JZAA 5JBQA 2XTZA 4KYIB 1EXMA 3REGA 1W4AA 3LRPA 3A1UA 4MYCA 4BZQA 3B8HA 2Q3FA 3H0KA 4EQ6A 1X3SA 4QJ5A 4QBGB 1QBKC 3OEED 1A1VA 3KZ1E 2VHCA 3HYTA 5J40A 4PX9A 4AYTA 2GCNA 1K6MA 1TUEA 3DEFA 2EYUA 3KJHA 2JGNA 2IK8A 4WXPA 5JJIA 4OI0A 5FR1A 2R6CA 2ZI7A 3X1WA 2VHUA 1E94E 2VHTA 5EE1A 3TR5A 1KSHA 1D2EA 3BWDD 1EFUA 1KI6B 1OLOA 2QT1A 1KI7A 3WYAA 2EFCB 1JR3D 2ZR9A 1KO1A 2ZYTX 4HAUA 4JL8A 2EWWA 3KL4A 2A9KA 2OBLA 2JJ2D 4AKHA 2V3CC 4FWTA 1W36B 1ZRHA 3ASZA 1E9AA 1EGAA 4RKEA 2GKSA 2ZYWX 2W0SA 4KU4A 3WY9A 1SHZA 4LBZA 3U44B 2WJVA 1E2HA 3QBTA 4DLTA 1FFHA 1JR3A 3KFXA 3A1TA 1HT1E 4V0OA 5E3HA 2NQ2C 2GEUA 4LRWA 2PBRA 5GVRA 3R9WA 2W00A 5KPJA 3U7HB 1QHSA 1UKZA 3AF0A 1Z83A 4LHVA 5DI3A 3EAQA 3KDSE 2DFNA 2Z83A 3OIWA 4GMDA 4MGKR 5D3MB 3UPUA 1QHGA 2QPTA 3UIEA 2PX0A 3SEAA 4MRPA 4CIDA 1V5WA 1II9A 1JXMA 4LHWA 4BLRA 4JSYA 5K8IA 3NDPA 4ESHA 3A8TA 3WBKA 3ETLA 4L15A 4LDJA 3MUFA 4O3MA 3VR5A 2V1UA 4IOJA 2H17A 4D0LB 2A30A 4CW7A 2FSFA 2J46A 4CEHA 1FTSA 3W34A 3SI7A 2W58A 2WJYA 2ZSAA 1NLYA 3ZS9A 3TBKA 4ZCMA 1U81A 4HDCA 1T3LA 4PQYA 3NEJA 1TF2A 2WPDD 2ZE7A 2DWPA 1AGPA 1U98A 2N46A 4IEEA 1J8MF 1F2UA 3LNCA 1ONBA 2C96A 4TQUS 1MRNA 3B1WA 3BXZA 2EFHB 4Z51A 2KI5A 4ZCIA 4PPGA 5JI3E 4KO8A 1P9NA 1ANKA 1C1YA 4OI1A 3ADCA 4QGAA 2VRWA 1D9XA 2CCKA 4URVR 2OZEA 2ZJ2A 1TU3A 4DSOA 2JLWA 3BORA 3LW7A 4BRWA 3TUZC 4AYXA 2XTNA 3BH7A 1WMSA 1W0JD 2QTFA 4BLQA 3CH5A 1KK3A 1GL7A 2CE2X 5DNYB 4QGGA 1KO8A 1PZNA 2QAGC 3IEUA 3FMFA 1H8HA 3HU1A 1XTSA 1KK1A 2ZYUX 4QRHA
chains in the Genus database with same CATH superfamily
1IQRA 1PQYA 3E9DA 4ZWNA 5A6VA 1NUAA 3WLMA 3P20A 3HN2A 4BBJA 4U2KA 4D9MA 5KTYA 4ZEMA 2XUAA 3UFXB 1M5RA 1HT2E 2QYTA 4EJSB 3G8DA 2N0SA 3OBBA 1D5CA 1OXXK 4OJMX 5J4KA 5CA0A 4JEHA 1J0AA 4YWHA 5AJWA 3EE6A 1C9EA 2XX3A 3KHSA 4H18A 3TQHA 2ONYA 4C7MA 4HNRA 1QRDA 4LE1A 3NHYA 4XYBA 4CKCA 4RSMA 4P3OA 3EAGA 4LHSA 2FMHA 5B6JA 2XT0A 4HPJB 1UP6A 3HVKA 4Q3EA 3JWHA 5F4ZA 1DG9A 1Z73A 2CLCX 5I7SA 1F8XA 4HK4A 1HFKA 1JHMA 4OIFA 4GP9A 3IPRA 4NV0A 1NP7A 4ATNA 4CMEC 3S2ZA 1EJ2A 1YVDA 3FYHA 3SFTA 1G8KA 3V7WA 4DZRA 4LF5B 1PTJC 1LI4A 3OWXA 3Q3GE 4GVPA 4JQOA 5AKEA 2VOEA 1G21B 5FO1A 5U4QA 2QLLA 4Y0NA 1D1QA 3NXSA 5IJZA 2VRCD 2VHEA 4CT4B 3W2HA 1G5HA 3P9NA 5DRTA 5C32A 2Z2JA 4YJ3F 2XMCA 3V4SA 1SURA 3D8SA 1PK7A 1XEXB 1GPUA 3LY7A 1I6LA 2FRDC 4KI0A 3TD2A 4OQPA 2FRXA 2I6SA 1UFOA 4KBGA 5CBKA 1ZNYA 1Q0TA 1GRVA 1JA1A 4R41A 2OO3A 3IA7A 2NZXA 4LYYA 4CEIB 3I04A 2R85A 1DRUA 3AVPA 1QG4A 1XZPA 3COYA 4L8GA 2WP8J 4L8LA 4XM2A 1ULZA 2EAUA 5DIZA 3SSAA 4CLRA 4Z4IA 1HOTA 2RMKA 4R8MA 3R5HA 5E3JA 3K5PA 4HB0A 2G67A 1I3NA 3REQA 2A8YA 1UZUA 1XJCA 1N5DA 4ZVTA 1DQRA 3N2LA 4ZOCA 5EEGA 1DSSG 2QN1A 4NV1A 5HS4A 4R1PA 5T4EA 1ZD5A 1UMDA 2ZJ5A 5ICFA 4D6PA 1NBEA 2B4QA 3IAEA 2QVLA 4M0KA 2FMFA 3GZNA 2HF7A 4XLZA 1PHPA 1T9AA 3ZVNA 1NLMA 2PIDA 1IOVA 3M5WA 1OY1A 1C0IA 4X6XA 4XPZA 2DWUA 2D4AA 4TMZA 4BX0A 3K92A 3VPXA 1A0OA 1UJNA 1XT6A 2PA3A 5DCUA 1E7SA 1Z08A 4DV2B 1YZYA 4UARA 3I8XA 5H9WA 2GN2A 1RRVA 4JLAA 4BNFA 5DGIA 4TS9A 3IURA 5BNWA 1KAOA 2RKOA 2HXGA 2QMEA 4CKBB 1IY9A 2YMLA 3I28A 1GTG1 3N07A 2YDYA 3QP9A 2SICE 3ETEA 2DYKA 2QQFA 3BKXA 3CXUA 4NBNA 3UF0A 4UAGA 3L07A 4JLWA 3ZQUA 3GDOA 5K0FA 5LMZA 1Z2NX 2GUWA 3OOYA 2FSGA 4GKAA 4E5VA 3HZHA 5LP6C 1UZAA 1POWA 2GERA 3BX1A 5C81A 2J3IA 2OPHA 1BMFD 1W44A 5BN1A 2AOXA 5TSDA 1DE0A 1X1TA 1NDQA 1NW7A 2AS0A 3GFGA 3AIIA 3UJBA 2ID4A 1COWA 5DTEA 3W8RA 1VJCA 4B32A 4DWJA 2DB3A 4GOMD 4LVUA 2IYVA 1AF4A 4D42A 4MHTA 3GD7A 3NTXA 3KUKA 3F90A 5HRAA 2UVDA 4MA5A 2EG5A 3LQYA 3MBKA 3GDGA 1NF2A 1D1PA 2OBYA 4M7RA 3A6FA 1N2EA 3UJDA 2ODAA 4MW6A 1BQ3A 4DA6A 3UV3A 1NLZA 3EUWA 1U0GA 5LL6P 3BXOA 3TQQA 3U09A 2FZWA 4REMA 3DFKA 3ZK8A 2JIRA 4JX9A 2P0YA 3LXMA 3OPNA 4EEZA 4RGBA 4M46A 4W5NA 4WZAB 2P91A 5F7XA 5J9FA 4XRGA 4Q47A 1E7RA 2AOWA 3FBWA 3LDHA 4U4AA 2IPAB 5FA6A 3SEQA 1AA9A 3UT0A 2YY6A 4HQKA 1SVSA 2CKMA 3AEQA 3Q5DA 1IU9A 3AXSA 1U4OA 4D79A 1XTTA 1SCDA 4X3OA 4G5GA 4FYPA 3F8WA 2Q2VA 2HPAA 2GH1A 3KEFA 1K63A 2IHUA 2NOAA 1T3ZA 4Q3LA 5I3CA 3K70C 4B35A 3RARA 5K0GA 5BRAA 2JI9A 4FYMA 3DUWA 3S0JA 4A2QA 3GEPA 5TXGA 3E05A 3TTYA 4HWGA 5TGZA 3PENA 1EFKA 2NYVA 4ALKA 5K0ZA 4MVJF 4YYEA 1RHQA 4WINA 2AN4A 2HBYA 2J9XB 1L7DA 1KJ9A 1JVNA 2PWAA 3LKDA 4M0DA 1JBQA 1U2GC 2E85A 1MF7A 3JQFA 4N5DA 1AM4D 1WCIB 1ZK3A 5DM1A 4LOLA 2WFLA 4IVNA 1WKCA 3PF9A 3RIGA 4AKEA 4DMGA 3UMYA 1M1UA 5EHNA 3LXUX 3JQ7B 3NO4A 3V34A 1FIUA 2NXCA 1PUIA 1E6LA 1GZDA 4XWTA 2O8FA 1G8GA 2NZYA 2YVLA 3CTMA 4C4OA 3ZN2A 2OV3A 1SXHA 5FLXA 1PNRA 4Q00A 2LWIA 1EU1A 4D6YA 2ZBPA 1RWNA 3WKDA 4G4SP 1UDXA 3DAPA 4TMVA 5DNVA 2I78A 3DBHB 4OQZA 2WB2A 3D8UA 4RA6B 4OREX 2IP4A 1XVTA 2JFNA 2JLSA 2E1RA 4BRSA 3OQMA 2C2KA 5KNBH 4BE7B 4DV7B 4KOAA 4YAJA 3IQZA 2BONA 3KYIB 4M53A 3KEMA 4GOLD 4UUPA 4DDTA 3R9XA 5CNMA 3CLUC 4EO9A 5ITWA 2AG6A 1W0KA 4H7KA 4ZFNA 2WWXA 1RBQA 1T25A 1CR0A 3V8PA 4JI6B 4V0SA 3SN6A 2OCYC 5DBHX 4ZRNA 3NHMA 4GXRA 4Q66C 3USES 3WLLA 4A0FA 5IVPA 3FFBA 1FDSA 1XG5A 2HK8A 1ACMA 3JYQA 5EJAA 5FL7A 4FUTA 3ZHYA 5IAAA 2CSXA 3DGEC 3DT6A 1Z22A 4GT1A 3X2SA 1XMQB 4X1IA 5HKAA 3F8TA 5MN6A 3A04A 4PNHA 1P91A 2YWFA 2IY8A 1W87A 2YN0A 3P0RA 4MA4A 1RHKA 2IIQA 4Z9FA 5HRCA 5JEEA 4R0MA 4PNEA 2AGVA 1IMOA 1KRXA 3CPJB 5LKAA 3KLBA 4FVTA 3SJBA 1WUTA 4XM0A 1IAQA 2C9ZA 3WIUA 3ZCRA 3BTUA 4N0QA 4WN9A 4ZDJA 4I9NA 2B3DA 2POQX 3A1VA 2IYFA 3F2VA 3PWTA 3ODGA 4Z8YA 4UZEA 4CBVA 3G5TA 4OP2A 4RIFA 2ATXA 2CV0A 4C2TA 1J8QA 5EA2A 2VAWA 1QONA 2J9FA 1ZJZA 4WMLA 3H4IA 2OO7A 3NEPX 4IH4A 1K5DA 5T67A 1JHXA 4AS2A 2PKYX 3LZDA 2PX5A 2DAPA 3I76A 1JYEA 4RY2A 2ZRIA 1QIGA 2PRIA 5BSVA 2EWMA 4AB1A 1SXJD 3PKIA 1BS2A 3JQGA 2IIPA 2BFPA 2IYNA 4TV8F 5AW0A 2GEFA 3BGDA 3CW2A 4XIGS 5IDWA 2W2QA 2ZUWA 3ISVA 3OMWA 4XQ0A 3WTBA 5HTOA 4BLOA 1SOVA 1BGXT 2H0RA 2XGMA 4AZ0B 3G2HA 5DK4A 5F52A 1PR2A 4IOKA 4FMBB 3CF6R 1WQ3A 5JLJA 4AZ3B 1NBMA 2AJBA 2JIZA 1JX6A 1NXSA 2XTMA 1DVRA 3EUAA 3LX8A 4FONA 3JVUA 4I1YA 4MYHA 4PIPA 4LXGA 5CVUA 3UMCA 3VSAA 3ZU6A 5AW8A 5C7OO 4W82A 1MX9A 3L8ZA 1P33A 3B1YA 4ZV9A 4MHOA 2VT3A 1LA2A 5EXXA 1CVIA 1LZKA 5TT0A 3FIJA 1OQAA 3RV3A 3FUCA 3TAXA 3IKLA 4AKTA 2C4MA 3ER8A 3L0DA 5KKCA 2COKA 4BN5A 3NV9A 2W2VA 1CQJB 3BB4A 3FMGA 4IOLA 4PYMA 2V98A 3QVTA 5TGTA 4E2XA 4YRIA 1ZHOA 4EW2A 4G24A 4BNLA 3MJHA 1OFGA 5IRCD 1KFCB 2H7YA 2WJJA 3SLRA 1MOZA 2NVWA 2XD9A 3TLXA 3EA5A 2AI2A 2VDWA 3EH2A 2H9AA 3SVZA 2IHJA 3LVRE 2CFIA 3LQ1A 1Z6YA 2ZJOA 4E03A 3OQBA 3QTLA 4CF3A 3VTKA 1RPAA 1XQ6A 2SNIE 3QKUA 3H2GA 1L4MA 4MKGA 4UTXA 3K2EA 1G6Q1 5IN4A 5J2TB 1X7ZA 4FHGA 1TTTA 2SKDA 5EJ4A 3AEQB 4DL9A 1G2OA 1T5LA 1CUCA 1YUNA 4IY1A 1N3YA 4B6JA 3CW8X 3DGFC 4JP5A 5E0KB 4CDRA 4FK8A 1XZJA 4BJHB 4C0JA 1KARA 1GAJA 5A7GA 2A67A 5C51B 5IDVA 1E1DA 1L4YA 3C8UA 2J6IA 3N8IA 1E61A 1NM5A 2O7NA 1FTQA 2G6BA 4WKGA 5FWXA 5JC8A 2HGZA 2I4LA 1SBYA 1ZOIA 2Q9AA 1QE0A 1GWNA 2Q28A 1R9MA 3LGXA 3OLYA 2V7WA 2Z30A 2CL7X 1D0VA 4XOUA 3VU0A 1NPTO 3PQCA 2JI4A 3WA7A 4MX8A 2QPLA 1MX1A 1XFDA 2HBQA 2ZBVA 4OU4A 3P96A 4Q3DA 2J4CA 4B5LA 1G3QA 4F5DA 3FTDA 4F9GA 4YP0A 3V5NA 1YZQA 3BBPA 3QF4A 4BMOB 4M0EA 3E4DA 4JQYA 4I4IA 2GZRA 4YCBA 3NC0C 5DISB 1EVKA 2CFRA 2I62A 3GJQA 3H1EA 4G63A 3H42B 3EF3A 3GMIA 1UBNA 4KJXA 3M4YA 4TUYB 5IZ4A 3JVVA 2IHBA 1QDEA 2Y76A 2ZE6A 2FN3A 1YRHA 3L4BA 4YECA 5HUHA 4M86A 1GEGA 5IH7A 4RVFA 4YX9A 2P40A 1DO8A 4X1YB 5TQJA 4EB3A 5DNUA 5JRZA 4OK3A 4IRMA 1XP8A 1N4AA 4HNUA 2C04A 4GI1A 3NRJA 1YA6A 1DC7A 4IXMA 4H6VA 2ZULA 4NSNA 2XYRA 4E2ZA 4RE6A 2IZ0A 1UOQA 2JLBA 3QV2A 4Q12A 1ISFA 1GHTA 5B12A 3QKWA 3MK31 2XD4A 1SCQA 3LVFO 2PJZA 2RHCA 5FOSA 4X1IB 3E2PA 4M55A 1J20A 1SUPA 1TVEA 1P1IA 5JCPA 1W36C 3OKFA 1GQFA 1NMYA 4YPFA 3KJEA 1U2RA 4M1TA 1W1WA 1B0ZA 2FUG1 4IFTA 5K0TA 1AMOA 1ZJWA 2GLXA 1S2DA 3B1XA 3P7MA 4MO9A 3H05A 4PFQA 1C0PA 2D0OB 5CB0A 1NE7A 1PNTA 2XE6A 1BDIA 2LDBA 4LXYA 3HYNA 4LG1A 5BN5A 4PS1A 1R5BA 5B4VA 5KVSA 4F4DA 2OMEA 2O19A 4IIBA 4GYYA 1XCGB 2G8NA 5DM4A 5FXMA 4JI1B 1Z39A 3ZIAD 1PGPA 2O1WA 1BFKA 3TE6A 2NU7A 3NTUA 4MIYA 5BR8B 5EQJB 2QROA 2V55B 4RTPA 2C7RA 5GGXA 1S8OA 3GCXA 1U90A 1GKIA 2WJZB 3VA7A 4XXHA 1JDTA 3N86A 1NQWA 3EYAA 4FSDA 1WCYA 2H54A 4OHWA 4EKNB 3L7NA 4EKIA 3MUOA 4WESA 4J0FA 4FMDB 3W6PA 2G63A 5BVGA 3LX5A 3VKUA 3AHFA 3A9RA 3BJEA 4BQPA 3TQCA 3ZZTA 2VSOA 4UHEA 4AZ0A 5C5CA 2EJVA 2WC1A 1ZGAA 3LYAA 4IV8A 4BFSA 4E5YA 3G9ZA 3L06A 2AMVA 3F98A 4JKYA 1W4CA 2VTBA 4CLDA 2N47A 1L6IA 5EMKA 2QS9A 2NSJA 5JFOA 4LYJA 2JBAA 3LTEA 3VKWA 3KKZA 2PQ6A 3M9WA 1J1UA 1LS1A 3RFTA 3WYDA 3M7IA 4DYDA 8ADHA 4XAQA 2XXBA 4RMHA 3JU3A 1JQEA 1XTQA 5JZVA 2JFPA 4JVLA 4OJYA 4IGIA 4P0QB 5GOTA 3I9JA 3QLVC 1FZTA 3JR7A 3CYFA 4RQAA 1G5TA 3IGFA 3H87A 1G5RA 2WIJA 1G7CA 1N33B 3TZCA 1Y8AA 3CNLA 3ELDA 4DIDA 3LT1A 2ZM6B 4ZI7A 5EJ9A 4QRIA 4V1CA 4F1JA 4Q3CA 3DE2X 1R16A 5LBTA 5ICCA 5TIIA 2HSJA 1C7RA 1YZTA 2OYRA 4FNOA 1VLZA 4YCNA 3VNBA 2R8PA 3U56A 1L5HA 4CMJA 3TQTA 1CRPA 1C7QA 1Q7RA 1KOFA 3BTSA 2YOHA 4HVAA 4YJKA 5FWYB 2GK4A 4IW3B 4WK2B 4FS3A 3LFUA 2FFJA 3DEYX 5BQ5A 3AQ4A 4A73A 4BCDA 2P78A 3RVBA 1T6ZA 2G04A 2C97A 4KAXA 3UCFA 1YZLA 2BEVA 5KQMA 3IJEB 5D87A 2HBRA 1H65A 1T4GA 2DF8A 2YN4A 2DUJA 4IEFB 3V55A 5EUMA 1USIA 2H48A 3EPRA 4I3FA 1OREA 2HT6A 3BFVA 4DDWA 4GI5A 2B5OA 1KP9A 2X8AA 3AI7A 3CPEA 2WYUA 3QOFA 4DRXA 5JW6A 4NYMR 3QSYA 3KE8A 5D5QA 1V9SA 1E9FA 2I2DA 3EMKA 2GJ9A 4LKRA 4KQ2A 4PLZA 4JR0A 2BGLA 5IBPA 3JY6A 4G25A 3GIWA 1KI6A 1U5BB 3L7CA 3UWMA 4ECAA 1YJXA 2D2XA 1A3CA 3IEVA 1IUKA 1LNSA 2IV2X 5CDFA 4B3CA 3P2IA 5AK0A 3FPEA 1KI4A 4NZOA 1GN9A 5B7QA 5I7EA 4ZODA 1RI2A 1KAQA 3FMOB 2M1XA 3OX3A 3GB9A 5HMMA 3J80A 2EX1A 4TRMA 2BHSA 3WDLA 6REQB 2B7CA 5TPZD 1C30B 3M6WA 2V0GA 3Q9UA 2WWIA 3HYLA 3FRHA 1AC5A 3JQCA 4Q48A 5SY9A 5B64A 4IH1A 3GJSA 4TUYA 1VA5A 4O2AB 5DHSA 5IBQA 3FHCB 1P8AA 5DW3A 1Q7GA 3U6BA 1UL1X 3MOSA 3PVZA 1ORWA 3EZ2A 3IIMA 4UNSA 5BYAA 2CVQA 2WW8A 3BGVA 3KWJA 3SXUB 1C80A 1U6IA 3TJZA 1V1MB 4HSGA 4EG7A 2H65A 1REQB 4K81B 4PAGA 4EFKA 1UPUA 2UVPA 1IEWA 1IZZA 1G3IA 2J6BA 3DH0A 3UWOA 2GJ4A 3CT4A 1Y5RA 3T9BA 1WMAA 1IUNA 2N75A 4AAYA 1P0IA 2VFAA 2HRQA 2V6JA 1JBKA 2Z3VA 3IS3A 4GGOA 5KTSA 4AO8A 4CR7A 4MV1A 3DZIA 3HO8A 5CH8A 3Q8KA 4J1TA 1D2AA 1LXCA 1V1RB 3ZGLA 1V4BA 5ALIA 4GUDA 4M8LA 4HB4A 3RYFB 3KKLA 3ILYA 4JOQA 2VF7A 4Q03A 4QDJA 2JVIA 1RT9A 3STXA 2ERYA 3TEFA 1N7GA 4KVGA 3V4ZA 1G66A 2B7BA 5K2OA 2QAJA 1V47A 5BV0A 1MQ8B 2GNAA 2WV7A 2NACA 4PPYA 5C18A 1SHKA 2V45A 3AFHA 4FTWA 1EFVB 3SDBA 4PFKA 4KO2S 3O75A 2VYQA 1AVTA 1EUCB 4CPDA 3MWLA 5A1JA 1E3TA 1VCHA 4J9VA 1TJ4A 3WK4A 1PQWA 2C0QA 2HUPA 4Y1RB 1E2LA 3OPYI 1PR3A 3NDRA 4RO0A 1TM2A 5KJ1A 2HYIC 2VDUE 1TI7A 2YHIA 4LCBA 3N2KA 3K9CA 2J3QA 3DOCA 4UBKA 2OCKA 1DNPA 3MPUA 5ALNA 4WOJA 2WQZA 3KKKA 4RJKA 4CQMA 4LGVA 2AOVA 3IQIX 1WDWB 4LDPA 4L7QA 5LIRA 2JHPA 1XMJA 5HZKA 3RVJA 1OFHA 3HJCA 3I9OA 4WESB 1F4PA 1E7MA 1RCFA 2QW1A 5THKA 5A9SB 5KCMA 3CVVA 3QKRA 5AXBA 2HTFA 3HCDA 2R6HA 3BXEA 4CT5A 3VNVA 2DCMA 2QLNA 3ZHVA 4DBLE 1BCSA 1XA4A 2XOKD 4M1ZA 2V7PA 1N2CB 1AKRA 2GHTA 2HWYA 2LRHA 3AF4A 1NFQA 1R0RE 1RXUA 2NUBA 4G4SO 4K9SA 1LJ8A 3VTAA 3ZHXA 4DMKA 4Y9TA 5FEUA 2ZI6A 3WWDA 1HSZA 4U5XA 1CUIA 2E18A 4NVRA 5JALA 5BPFA 1A7JA 1XPJA 1U31A 3OICA 2DKNA 1L7PA 4F1KA 3GLRA 3HR4A 4M1OA 2ZTVA 3GJ8A 2ZIEA 3CO0S 4HDRB 5THQA 4LF7B 1YR1A 1QZUA 1MVOA 1U9YA 3ZWBA 3SHQA 2ISSD 3GDFA 4EW6A 1AK9A 1Z18A 2J8ZA 2PS9A 3N2EA 5DEIA 3VVMA 4E1AA 2VI5A 1LW6E 1N3LA 2LXNA 3HBAA 3LZCA 4ENUA 4ZI7B 5DNCA 2AEMA 4V1CB 1ZGZA 4LUCA 3CBGA 4QBHA 4MVJD 1RYBA 2O0HA 5C4GB 3RD5A 5G0SA 2F00A 4JMLA 5K8IA 3OJCA 3LBYA 5JY6A 1PQPA 1T36B 4G5SA 3RBAA 2QE7D 4OQDA 2A3NA 4DMRA 3RVMA 3G2MA 4ZIRB 3E35A 3RDPA 3SR0A 3F9CA 1DC5A 2V7XA 3V4PB 4LZOA 2HU5A 4R5MA 4U9UA 3ZV3A 4ND4A 1OAAA 4FIZA 5EKXA 2V58A 3EZNA 2ZROA 5ITZB 2YVKA 3RSZA 3D6MA 4JXKA 2G5PA 1JHOA 4X24A 4G0VA 4I1IA 2DQ4A 1R2QA 4DXHA 1NWCA 4R3WA 1E3JA 1N1EA 4RPLA 3FWZA 1M75A 1ZD8A 1ZEJA 3IUQA 3CSDA 2QUBA 2XDAA 1L5RA 3KKQA 3NOXA 4YRNA 1ESEA 1F2VA 1Y4SA 3ND5A 3MS7A 4JH0A 3RROA 1YS6A 3T9EA 3UAGA 4DTCA 1L4GA 2ZXEA 5EWMA 4ETNA 4JJ6A 1WCXA 2O23A 3B70A 1A8UA 2OBMA 3IVRA 4M9SA 2B20A 4E88A 1E6KA 3PC2A 1ZCFA 4RK7A 3IMEA 3W5BA 4N7BA 2P9YA 1ULSA 3RJZA 1E5QA 3V8RA 1KNXA 5ICGA 3ADKA 1QHFA 3C6QA 1E3EA 4UJ5A 2PKXA 4B4WA 1H94A 4QGHA 3MCZA 3C43A 2AFHB 3ZDFA 3GLSA 4R2KA 4G8CA 4KZKA 1A95A 1J1IA 4XJXA 4FDUA 3DB2A 1PVVA 4J75A 2G0NA 1B43A 3FNFA 4H4EA 3DP7A 1CDEA 1A82A 2P2GA 4WN3A 3AEKB 2UVPB 1Z62A 3ZGZA 4LTNA 3P5SA 4PZEA 2QAGB 2H59A 3EMBA 1VHTA 4L50A 3BSSA 3B89A 2Q1XA 4AY4A 2FR8A 1U0EA 1NTOA 1KS2A 1P0FA 1T8UA 3QVXA 1PVDA 2PMDA 2C29D 2D7JA 3QBDA 4NBVA 3QYPA 3ZGYA 5BYBA 2JLRA 2L69A 3COPA 3BL5A 5FOTA 1FDUA 2BAGA 1AQUA 1C4KA 1VIYA 2GX6A 2O06A 3CO5A 3QF7A 3A05A 4JL5A 1FX1A 4MUAA 4WKNA 2NPOA 3L01A 3HXLA 3OJ0A 4ISBA 3UEOA 2B8EA 3G1TA 4CMBA 4EKEA 3NXKA 1UBMS 3SE7A 4DOMA 2Q0XA 1MB4A 3EUEA 3RANA 3EQ7A 4I3HA 2DEUA 1C0EA 3CE6A 4S1PA 1BAPA 5C4MA 2X3YA 3ELBA 5KNDD 3SEFA 1AV6A 1Q77A 3GXBA 1RYYA 5CXUA 3I09A 4MZXA 1HA3A 2C2OA 2QRKA 3ME5A 1XDUA 3WYCA 1J06A 1H8ED 1EP2B 3MCAA 5BN3B 3DMFA 3VPAA 3RIXA 3CINA 3M82A 4KPEC 1SUIA 5C1BA 2NU9A 3AIMA 2C0PA 5EUCA 4WK0B 3BWYA 1SXJB 5A05A 2AOTA 4ZQHA 4NJOA 2OBFA 2EVWX 1PR4A 1RCUA 4Q9NA 3DA8A 4R7ZA 2JFHA 2J5KA 1AH2A 4POAA 1I51A 3WLSA 4NYMQ 3NYQA 2J5XA 4NG4A 4ZK2A 1F51E 1X87A 1E8NA 1GL9B 1HG0A 2VJDA 3H5VA 4LJ7A 4RHCA 4XIFA 5U1PA 3RVSA 4EA8A 3THWA 4WL0A 4QVKA 4AG5A 4WZBB 1JDSA 3QFCA 3MD9A 1UPCA 4D7AA 4TXJA 2HI0A 1VIVA 4EELA 1GFZA 1MFPA 5ALLA 1RLMA 2CNLA 3K09C 1L4UA 2LGJA 1ITZA 1U1GA 3I6IA 3UA4A 4EFDA 2ZWAA 3IILA 2Q2OA 4YHBA 4YCDA 1PDWA 2VBCA 1FQJA 3SIXA 2X0KA 3EWIA 3IT0A 3BMOB 4DR4B 4IHQA 3IUBA 4J76A 4E7OA 1UXIA 1KJIA 5I7OA 1YJAA 2OHFA 2FB9A 5HNKA 4DDKA 5JNVA 1M6EX 1Z74A 1AS3A 1VYUA 3AI1A 3A1EA 3DHYA 4RJLA 4V0LA 3TZLA 4A92A 4D92A 2MSDB 5K45A 1TMKA 2NO4A 3E9ZA 4G9EA 5E2BA 5AYVA 5CNIA 2D5LA 2PTHA 1HE8B 4NATA 4DV4B 4LY0A 2DVMA 1KC1A 3B6JA 3IIKA 1EGMB 1PT8A 1G8AA 2OK8A 1L7RA 4RVDA 2CK3D 3W8FA 3DAYA 3O8NA 2WHEA 3DZJA 1BX3A 4YDRA 2FG5A 2Z4RA 3PHIA 3RYHA 4BO3A 1F3LA 3WGTA 2ZUDA 3B3JA 4YFVA 2ZYSA 5DT9A 3JTMA 4RFSB 2QZJA 3R41A 4YONB 1MIOA 2P2LA 2RH4A 3TL3A 2NUPB 3F1LA 1ZUWA 3A4IA 2O48X 3PXAA 1Y8QA 4G41A 3SGLA 4DG8A 4B3SB 1U8FO 1H3FA 4F1WA 4PR0A 3K9HA 4X95A 1P5FA 4L02A 1RZRA 1CUDA 1IHUA 1UXJA 2GN8A 4KFRA 4TKUB 4BRZA 2Y71A 3M6XA 5JISA 4R2WA 1UAGA 1LV7A 4HNQA 5EWMB 1OXVA 2JGIA 3IAS1 3B7GA 1Z35A 1Y6ZA 1Q19A 1I5OA 1YAHA 4Y9SA 1ZSNA 2BFCB 4W1RA 5GPBA 4LXXA 5H80A 1M2HA 2RHHA 1LBHA 1OI3A 4X90A 2FUKA 4I5EA 3ZU3A 5LM3A 2E5WA 4LRXA 1Z36A 1I10A 3ZJVA 4HFMA 3C3CA 3OUZA 2XWBF 4HNHA 4MULA 5BXYA 4XVCA 3ZW9A 1BYIA 2W8BB 1G6HA 3I3OA 1PEKE 3KTAA 3OCJA 5AVYA 1NP3A 4DLUA 1IE3A 4ZC1A 3U0VA 4MO2A 1DPGA 4C6HA 1WY7A 3E7WA 2GYYA 1QYCA 4II3A 1QFJA 2WVHA 3KAJA 1HYGA 4FMCB 4Z1MD 3U48A 1P4AA 4FB5A 4YWJA 4MGZR 2J5RA 4WLUA 4H1VA 2B83A 3ZVMA 1X9GA 1GT6A 1WM1A 4JUCA 1GG8A 5AHKA 3VZPA 4ZVUA 5EJIA 3AF2A 1LNQA 4JLKA 1HL3A 2JI6A 1JQDA 1MB9A 2JHAA 3B60A 4AZSA 4F71A 1FFGA 4BOYA 1B3BA 2AR0A 3OQJA 4QU5A 3MWEA 2ZI3A 4XWYA 3ZZMA 2JBHA 1K8ZB 4QYSA 3T9CA 2KMLA 2VL7A 3CH7A 3EPJA 1UCFA 1Z6AA 2GOYA 4LQCA 4U2DA 3ZV5A 4CM4A 1RVV1 4D81A 4ERXA 2QTVB 1T9DA 4P3PA 1UINA 1C81A 1TDJA 3OFND 1U4SA 3QVKA 4TVOA 4HH0A 5EJ7A 1ZIXA 4AJIA 2W2KA 3I2KA 4RLFA 3V97A 4BMCA 3D2LA 2JDID 2X0JA 3TSCA 5JCZA 1KY5A 2F4NA 2YV1A 1Z5NA 4UMDA 1G5QA 4QUJA 2QP3A 1BXGB 4HNGA 4P3KA 4G4IA 3VHLB 5GV7A 2XUFA 3G6KA 5EY5B 4U7WA 1J5EB 3VOBA 3GPLA 4C03A 3TQIA 1P2VA 1AUPA 2R84A 3CZMA 2QLBA 1SU4A 1O9BA 2GNPA 3H3FA 4RDHA 4C5CA 1ULHA 2CHUA 4UNNA 4PHCA 3CNNA 1BJTA 4LJ5A 2X22A 2LIVA 1JQ3A 4G5XA 4I55A 5ENDA 2YXEA 1NR1A 3SF8A 1OE0A 1MRZA 1KWKA 3HFRA 4DLKA 1A27A 1DP4A 3I5AA 4K3VA 4PLTA 2VYND 2B35A 3ZYZA 3Q1KA 3GJTA 1YVUA 3QXJA 4BNDB 1W5AA 3JWIA 1LBTA 2I2BA 1DCMA 1L7AA 4LC0A 3N0WA 4D9BA 2GBLA 4B3IA 2BGTA 4NU5A 4CLOB 1PD0A 3FNHA 5FQOA 3NLLA 4LWOA 5CD1A 3L7JA 4IGKA 3AB8A 1XU7A 3OP4A 5IM4F 3VJMA 3ABQB 4RYLA 3V8MA 2FW1A 2VYVD 3L0OA 5EUQB 4EA6A 5ADHA 1KI1A 1X2BA 1IQPA 4MMZB 1N2XA 4NABA 4ZT2A 2Q1TA 4KWHA 4RKQA 1BROA 1S2LA 1W30A 3SZRA 2UUCB 4UBJA 2JKYA 4I5DA 2KQUA 4IIXA 3A32A 3VYRB 1FQWA 4Y0AA 4HRVA 3RSHA 4PO3X 4UU1A 4RTJA 5CDUA 2P30A 2FJ0A 2ZBRA 4O25A 1JSCA 2QBYB 3H1BA 1AY0A 5JCOC 4ZTUB 3O3MB 3AVYA 4WNIA 2FOLA 2D1SA 5SICE 4FD2A 4PZDA 4W7IA 3T7RA 4CU5A 1ODIA 1RKQA 4CEIA 3FPJA 1AGNA 2CHGA 4ARUA 2HJ9A 5C52B 1IVNA 1DT5A 4OAOA 1EVEA 2AD5A 2OLJA 3I04M 2A9FA 1QV7A 5M5BA 4CLRB 3WBJA 1FYXA 4M9ZA 5I8ZA 4EPRA 3H1TA 2WIFA 4RFSA 1CY4A 4BN0A 5BSHA 3MIZA 4B82A 5C5EA 1P6UA 1MJGA 2WSIA 3CLUD 3UMFA 4NCIA 2HZ7A 3I42A 2WJ3A 2ZSEA 2GESA 5C0OE 5H8WA 1EP1B 3I2JA 3PDIB 3INGA 1OAKA 1T5SA 3CY6A 1JPUA 1XZIA 2G76A 2AMJA 2QNRA 1HEYA 1QHHB 1JG7A 1RMYA 3CA8A 1A5BB 4URHA 3ZUPA 3IYLW 2OCDA 3IKTA 3VR2D 4CMKA 3F0TA 1JIIA 1R18A 2C2GA 1ZM9A 1FFAA 2F1IA 4XWWA 4UDXX 3PEYA 3LBFA 1GZ3A 4D4KA 4YRTA 1Z15A 2GBGA 2HHCA 2VJMB 1L7OA 3LXRA 3SC6A 4DADA 5F78A 3ONVA 5B2EA 3K70D 3LCVB 4HBZA 3ZCSA 4NYJQ 1Q2UA 4W8HA 1K68A 1UBHS 1SBIA 2BFDB 2OUKA 4Z9BA 3NAZA 1M0SA 4I9GA 3GVIA 3S5UA 1XEWX 3TO5A 4K9OA 2X6RA 1VOTA 2J9RA 5F7ZA 1TO2E 4BLTA 1QQ6A 2YWJA 4ZZ2A 4RL6A 1PV1A 1HKHA 3RVDA 4B6PA 3I6BA 3R77A 3LQQA 2C4KA 3GROA 1HDXA 1SHTX 1JWBB 4JEIA 3ZJYA 2I99A 2VYFA 3BUSA 2WU1A 4PLVA 4XYEA 2IYUA 4XFJA 2RI1A 4FDVA 5K9ZA 2WSYB 2FEWB 1NBME 4AMZA 2CEAA 3HDVA 2OFPA 1NXXA 3DFFA 2RCNA 3BGWA 4FILA 1FBNA 1JDBB 1Z6QA 3NVMB 4DLRA 4OXIA 4CMIA 1Z06A 1JIKA 1R4AA 3CLRD 4MVJM 1AV7A 3EGDB 3QE2A 4NBRA 3HKCA 3SBOA 4B1FA 4ZXFA 3MWDA 3NHFA 5CJ2A 1SQ0A 4H7IA 4MB2A 4R9NA 4MWCA 4GMGA 1H9CA 3IDAA 4D0NA 3MWEB 4A16A 1MFZA 4N0EA 1Q7EA 3AESA 2B4AA 4JU8A 4H0FA 4C7XA 1MQAA 1ZL0A 2F9MA 1IY8A 1KEKA 3A14A 1IBSA 1Q15A 1LVGA 2NVUA 2XMZA 4LGMA 4Z9AA 3HWWA 4X3PA 3GT7A 4WZAA 1A69A 4XVQA 1EE2A 1WHSB 2R1ZA 3DLPX 3W2GA 4HEJA 1ORHA 2JW5A 3JVDA 4WE3A 4BBPA 5JSFA 2XUZA 3N7UA 5IHPA 2WJ6A 4J4BA 3TLCA 1RXWA 3KVOA 2NO6A 4C2UA 1CY7A 1AKMA 3WHIA 1IJEA 4DLZA 2YRFA 3KQOA 3STTA 1ZUHA 2XRYA 1Z0KA 4R9VA 3K0CC 5J2UA 1X74A 2W0MA 1Z8FA 3KYCA 4RVNA 2IYZA 1PG2A 1ZM7A 3D02A 3DBRB 4EW1A 3HO1A 4V3CA 1FSPA 4G5HA 4RIIA 3RBVA 2BFBA 3Q2OA 4PLWA 5DCLA 5TVKA 2YWEA 3PDJA 2FYTA 2K4MA 1AZSC 4JBIA 3TOCA 3VO1A 5BUCA 2ISQA 3TLGB 2JZCA 4D8TA 2IYQA 3E7PA 3NVAA 3BCUA 3EH1A 3WSTA 4AFNA 5CPBA 1I30A 1Z07A 4E6PA 1DZIA 2BBSA 3ZGVA 3PU6A 2HDOA 2G83A 2BC9A 4MUYA 1IK4A 1MTOA 2FX2A 4GPAA 4KO1S 4P7KA 1SKYE 3VX3A 4BV9A 3SJ7A 3GO4A 5B7GA 2AFRA 1Y3FE 3JQ7A 3IXQA 4EG3A 4YREA 1XMOB 2QTNA 1V9CA 1A96A 4FMCF 4ZT6A 3ZLTA 4CM3A 1V16A 4H3SA 5DLYA 5CA1B 3GGCA 4OK6A 1PR9A 3UMRA 3TKYA 2RB5A 3VR4A 3RH0A 4YK7A 3LTNC 1P9WA 3BD8A 3G0DA 3IDFA 3LYLA 4BFLA 3LI2A 1SBHA 1I33A 1XEAA 1QK4A 3NUGA 4DQLA 1D4FA 2BP7A 3QX7A 2FDRA 4Q9HA 1XNQB 5BNFA 4FIDA 1R3UA 1ZNZA 3M34A 1W52X 4F3RA 4PSDA 1QO0A 1QZ3A 4I9HA 3GEIA 4TS4A 3HU3A 2REBA 1P1RA 5JMOA 1VPEA 2B34A 2R2GA 2ZZNA 2BEKA 3M6VA 3S7ZA 6Q21A 2IX9A 4CM9D 5TRTA 4WHMA 3IDQA 5JPDA 3ZQJA 1L8LA 1SIUA 2R87A 3E5RA 1GQYA 4L8VA 1UDWA 1QVRA 1NJ8A 2A1UB 2OCXA 1HMPA 1RLJA 3LMKA 4NY1A 2AF4C 4OHKA 2EQ5A 2VQ3A 2QEQA 3FJYA 3VH1A 3ZDQA 5AVWA 2BMWA 2B8TA 3FBGA 5BV2P 5FFFA 3GFRA 1P5ZB 4JODA 1ZH8A 1CDOA 1GCAA 4FMDF 1NPYA 1JG4A 1YU6A 4Y67A 3K53A 1BMTA 4OL9A 4K28A 1MV8A 1PSDA 3MS2A 4Z0TA 2A5YB 2YYSA 4EMTA 2CNNA 3FG9A 3E0QA 4L57A 3I5YA 3PJDA 3C5VA 1JIXA 1C3EA 1HKUA 3D3EA 2BI7A 3RM3A 3ADBA 3H3XA 4KL8S 1E6WA 1YCFA 5FAXA 2XT9A 5AOCA 2QRVA 3QVMA 4JJ4A 4YMUA 3TNFA 5TF0A 2A14A 5HWSA 2RJNA 4JJIA 4CM7A 2QN9A 4Q7QA 4YV1A 1F38A 2H1WA 4BJ1A 2AJLI 1GR0A 3IUSA 2HA3A 4ESEA 4PQRA 3HKEA 1VI6A 1TUIA 2H1SA 3LBAA 4FWBA 3RUCA 2XQKA 1PT6A 1Z12A 3OF2A 3S99A 3W0LB 3TGLA 1E5XA 2O3RA 1PKEA 3DUFB 3RRYA 4DDUA 4PRYA 2C88A 4J49A 3OE4A 1UAYA 3AM1A