4FIDA

Crystal structure of a heterotrimeric g-protein subunit from entamoeba histolytica, ehg-alpha-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
334
structure length
317
Chain Sequence
KPITVMLLGSGESGKSTIAKQLKILFGGGFPEQERATHKSSICSNVVTCMRTLIEQSAILNHPMKYQPKSKEFTTEDPVTLPFSPELVGDVEALWADEGIQATYEESAKFQLPDCAKYLFENVKRIAMEDYVPTEEDLIHNRTKTTGIHEYDFVVKDIPFHLIDVGGQRSERKWVSFFSDVDCAIFVTSLAEYDMKLYGNTSRLTESIAVFKDIMTNEFLKGAVKLIFLNKMDLFEEKLTKVPLNTIFPEYTGGDNAVMGAQYIQQLFTGKLQTEEMNIEKVYTNPTNATDGSNIKRVFMLAVDVIMKNMAANGKMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords G protein alpha subunit
publication title Heterotrimeric G-protein Signaling Is Critical to Pathogenic Processes in Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Signaling protein
total genus 85
structure length 317
sequence length 334
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4fidA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fidA01
3THYA 2YNMA 1QHHA 4ZO4A 3UXMA 1JALA 3HR8A 3R8FA 1G21E 4DT1B 1G3QA 2BMDA 1M7GA 3BFVA 4WVFA 3QKRB 4LV8B 3LY5A 1NJGA 4DUGA 3VX4A 2KB0A 1G3RA 3P4YA 4B76A 2ZRBA 1IY0A 1N6OA 1HE1C 1Q22A 5TDHA 2QE7A 5EE9A 4JLBA 3NVAA 1F3OA 2MSCB 3A36A 4F4JA 1TQDA 5EXPA 4RCYA 1XXHE 2ZM5A 1XX6A 1XMSA 5EQTA 3F0TA 3CF2A 3LBIA 5CM9C 5DIFA 2QUZA 3RVBA 3B78A 4B35A 2GCOB 2ZUBA 3H0KA 1YZTA 1GKYA 2ODBA 2TMKA 5D3MA 1RPZA 3U3JA 2CEAA 2WJJA 5FI1B 4LPKA 1XEWY 2ZR7A 2ZRFA 2HT1A 3A8TA 2BOVA 1GOTA 1G7SA 4EDHA 1Z0IA 1NKSA 5HE9A 4GRAA 4B47A 1EX6A 3AVOA 4JSYA 1E0AA 1QDEA 4G3XA 2V6IA 5FUYA 4DCNA 1XMVA 4TZ6A 2EFHB 2FGKA 4FCVA 1X6VA 2A7QA 1S1CA 4QGFA 1IN6A 3D3QA 4HI0E 2J45A 4TMVA 5DYIA 3S1AA 1W36C 2QT0A 3NDPA 4JLOA 1ZINA 4BGDA 1XF9A 3CNNA 2QP4A 4A6PA 4IDHA 1S1MA 2FSIA 1TQ4A 4DLZA 1QBKC 1ZP6A 3K9GA 4DB2A 1FMJA 2QA5A 1ZNYA 2F43B 3VR5A 1AS0A 3L82B 3U5ZB 1EESA 1US8A 2OFXA 4Q4HB 4PSKA 2B6HA 4DCSA 2PZEA 4QG7A 5CYOA 2WAYA 3B9PA 2ZRIA 1C4OA 4B43A 3D7MA 3SQWA 2D74A 1NMYA 3KQUA 4R2IA 2FU5C 2J0QA 2CVFA 1YZUA 3T06B 3C4JA 1IJFA 1LB1B 1P61B 3KX2A 2AHOA 2G0NA 3RDPA 4C2TA 5JEDA 3K0FA 2ZRDA 1PLLA 4YMTA 3DHWC 1IBRA 3A1SA 4M8NE 4QM7A 1HY3A 2PMDA 1NSFA 1S3SA 5CK5A 3CPEA 2QENA 2IK8A 3OEEA 4NMMA 4TMKA 1N6NA 2ODWA 4WAUA 1NBMA 1T5LA 221PA 3LV8A 4GOXA 3VAAA 1KOFA 3AF2A 1M1YE 4PZLA 1RJ9A 1Z6TA 1CR4A 1ZU4A 2R6FA 2XEXA 4PHHA 4A2WA 5JJLA 1JJ7A 4QOSA 4TN1A 4AWXA 1E9AA 1XJCA 3MGCA 3KKMA 5EE5B 2HLDD 4LK2A 1KI8A 4Q9IA 4N0EA 2CL6X 4V0ME 2VP9A 1XTSA 3ADDA 2QQ0A 2IUUA 2O52A 3PJRA 2I4IA 1SVMA 2QSYA 2YOGA 3RLFA 1W0KA 2FH5B 2FN4A 4DEXA 4ZIRA 2X2EA 1QHYA 5K8TA 1FQKA 4IRUB 3RNLA 3P1JA 2N42A 4I1UA 1CLUA 1E4VA 2X1VA 4HAUA 4JT2A 2HV8A 3GJ6A 3AVUA 3W6PA 2C9OA 2D4HA 2FZ4A 1EWQA 3KKNA 1IY2A 4EIWA 4FCTA 1ZD9A 2CCGA 4C7OB 4BASA 2ZITA 2ZRNA 4L9WA 2NZ8A 4TTRA 3BAFA 4OKSA 1M8PA 4D4KA 4R9UC 2IYSA 3KKPA 1G20E 2BBWA 2ZI6A 1E2HA 2R2AA 1JNYA 1N5IA 3K0AB 3GFPA 2P0EA 3IDQA 5L3VA 4C0AC 5L3SA 2O0JA 1U98A 4P4SA 3PITA 3ASZA 2XITA 4RFSA 4I99A 4ZCMA 2AFHE 2R6AA 4OHZA 5J47A 1FNNA 1LFDB 1P2TA 2BKUA 3RSLA 3TVDA 3FKSD 5CM8B 4PX9A 1SQ5A 2WBLC 1VYVA 1XMIA 4X8LA 3UPUA 2GJKA 1DS6A 3ZZ0A 2GKSA 1UBEA 1ZMXA 1X1SA 2AX4A 1OXUA 4A8JB 2Q3FA 4OJKA 1VYTA 4MUBA 1OLOA 2CHQA 4C2UA 2ZREA 3KZ1E 4IXNA 2IYVA 4US1R 2XSZD 4BWYA 1E3MA 4WW0A 2IYRA 1TF5A 4C0LA 1NNEA 5JJIA 1ZD1A 1ZW6A 3CR7A 2G88A 3KDSE 5CJPA 1KSHA 4BQSA 4DCVA 4OQFA 1JXOA 1VG8A 3FYHA 1IN4A 1V5WA 1EFTA 3KL4A 4OQXA 4ASUA 4DT1A 3RHFA 2ZAOA 4OHYA 4UKDA 4Q1EA 2CVHA 4NBSA 2IUTA 3OAAA 1L4UA 3IIKA 3KXIA 1FX0B 4A9AA 5AWFC 2ZI3A 1VPLA 1OV4A 3DEFA 4OQLA 2OXCA 3ZS9A 1R2QA 3EC1A 4QJ4A 1ZD8A 2QEQA 4QXAA 3K70D 4W5HA 1FQJA 1RE0A 2PZFA 4L9SA 4B3FX 2G3YA 521PA 4BFZA 1G7RA 3B82A 4LY6A 4M53A 4NYMQ 3GJ4A 3GLFA 3MAAC 3HU2A 2XZPA 1KGDA 4QFMA 2QP9X 3W8RA 4D4MA 1N5LA 2GDJA 3FGNA 2GCOA 5CJ2A 4OI0A 3BC1A 3MSXA 3U7FB 1KKMA 3LA6A 1TNDA 2ZUDA 4QHYA 5JCZA 4JBXA 1II9A 1KDPA 4CEIB 1CKEA 3SZRA 4Q47A 3FOZA 2Q21A 3ZD6A 1W46A 2DBYA 3GLGB 3T1TA 1NBME 3GQBA 2AKAB 5FR1A 1XEWX 3CH4B 4WZ6A 4LHXA 3GLHA 1CP2A 5C2JB 2BVNA 3NBYC 2XTZA 1F2TA 2A78A 3NG1A 4HSEA 3TNFA 5JI2E 4HLUC 1VIYA 3PVSA 3NWJA 4LYAA 4Q48A 2XX3A 1WB9A 2J59A 1OXVA 3CRW1 1CR1A 2Z43A 4LPSA 3B8HA 3U4QA 3QF4B 2PJRA 2JEOA 2XNSA 2HCJB 1P2VA 2ZI4A 3KKOA 5IK2A 3VQTA 3GEHA 1E4YA 2GTPA 2AKYA 4A0GA 4HZIA 1E0KA 2F43A 4EQ6A 1PUJA 2VF7A 2GHIA 5K8LA 1SVKA 4DLUA 4Q4HA 4BFSA 2XOKA 1DG3A 4FMBB 4ITRC 4D4JA 5KPJA 3R9XA 4RY2A 4B2LA 4GZMA 2REXB 4D2IA 2P6RA 4C3ZA 2ZS7A 3QXCA 2LWIA 2PT7A 2RGCA 4OYHA 5HZKA 4BPBA 1XRJA 2OCBA 3OFNA 4KYUA 2R6GA 4NDZA 4Q9LA 1UBGA 2B8WA 1FUUA 3AKCA 3BGWA 4KV9A 4M21A 3DMNA 3QPWA 1KSGA 1VG0B 3DL0A 4U7DA 4PHTA 4BLQA 1N25A 3GJ0A 4MRSA 5FPSA 2WJGA 2ERYA 1WDTA 5DHFA 1NIJA 1YZNA 2HF9A 1FTSA 2FSHA 4IFEA 5A0FA 2IXGA 1XXHB 3HU1A 3A58B 2ECKA 4K46A 3EW9A 3WY9A 2CL7X 1F2UB 3KTAA 3QUSA 5IT5A 3LD9A 1Z08A 4CEJA 5G40A 1Z29A 2NPFA 3LQRA 4XD7D 3TJZA 2RGXA 2GXAA 4JVLA 3AF0A 4P33A 3C16C 1NVWQ 1W1WA 1K5GA 1KI4A 1NIPA 2QMOA 4Q19A 3TR5A 4DKXA 1OKKA 4A15A 4OK3A 5JHHB 1YQTA 4PQRA 5JS7A 2FWRA 1QF9A 2OAQ1 4CVNA 3WHKA 4ZV4A 2QGNA 2CCJA 1E2GA 4O0MA 2VLIA 3ZVMA 1R5BA 2O8CB 4IVPA 5JRJA 4A36A 1H8HD 3DVLA 4DRZA 2IX3A 1KK3A 4C7OA 1OJLA 4QM6A 2QMUA 4MKIA 3IBGA 3SYKA 5IF9A 3LW7A 1Z22A 4RVCA 3CZQA 5F2EA 1NJFA 3EWSA 3K9HA 2F9LA 1MO5A 4YXWA 2VO1A 2PJZA 2XTNA 5DGXA 1R4AA 4E03A 4F91B 1TMKA 4LI0A 5CIWA 2OT3B 4ZKDA 1E2KA 3SU8A 2WOOA 4FMCB 3BH0A 4LBWA 4LJ6A 2EFGA 4XJXA 2WJHA 1XCMA 2IYQA 4HAWA 2QZ4A 4OQMA 1FPMA 3Q7QA 4EPRA 1TEVA 5FR2A 3GLFE 1WXQA 4JLMA 2VHTA 3L8ZA 3VR1A 3QG1A 4AI6A 1DADA 3PEUA 2AFIE 2JJ2A 1Z2AA 2IEZA 2LKCA 4US0R 4ERNA 2WSSA 5GADl 2PLFA 3IPYA 4ZPXA 5CB6A 2V55B 3BFXA 3AV0B 3ADBA 3AVWA 2IHYA 1S3GA 2HXYA 1UKEA 2OILA 3LLMA 5AJXA 4JL5A 3REGA 4OHWA 1E9SA 1M2OB 1WF3A 3QY0A 1OH8A 3GLHE 4MH0R 3A6PC 3M1IA 3WBJA 3H84A 4LHWA 2BDTA 4B3CA 4B75A 5CLLA 3DZ8A 4HUQB 1W4AA 2ONKA 2EFCB 3K70B 3SJBA 4D80A 4LBYA 2PBRA 4O25A 2QMHA 3A1WA 4ZDJA 4MRRA 1BMFA 1P73A 5BYJA 2OM2A 1FX0A 2I1VB 3ICQB 1Q21A 4MQBA 1E98A 2IW3A 3RAPR 3E1SA 3I92A 2JLVA 2RHMA 1UBCA 2ZYWX 1E94E 3SS8A 1E2EA 3HPQA 1JR3E 3LWNA 3EPKA 4FMDB 4PAMA 3PCRB 2RHDA 1GL6A 2W6JD 4PPFA 4EJSC 3L43A 5KNBA 1XCPA 3THYB 4BFUA 1QHHB 3DM5A 1E2IA 4B3DA 1SVOA 2JLZA 3Q8XB 5KNCA 1B0UA 4AIIA 1RRFA 2W00A 4IOKA 4D0NA 3CF6R 4EPTA 5IRCD 4LHYA 2JA1A 4M9XA 4UNSA 3WRYC 2YC2C 2EVWX 3NTUA 3FVQA 2QM7A 4JKIA 2IYUA 4PC1A 2PEZA 2ZE8A 5GJCA 1E0SA 2H1LA 4PO8A 2QI9C 1G8FA 2RMKA 3UATA 3ZYCA 4UJ5A 2ZYVX 5LPNA 1V43A 4ACBA 1QG4A 4H1VA 2R65A 1E9FA 1ZM4A 3QF4A 4HYYA 4PC3A 2NOAA 5D3MB 1AK2A 1UBFA 5SZKB 2EYQA 2GVDC 4JLPA 5HR5A 3KQKA 1KKLA 3EA5A 4MGKR 5B58C 4NZYA 1AM4D 1WBDA 1IY1A 3ZDQA 1W2GA 1G18A 2ZXUA 1X1RA 4JLJA 1MRSA 1OH6A 1W4CA 1DAEA 2H5EA 1AZTA 3I8SA 1UKYA 3S1AB 2IC5A 1NVVR 2FNAA 1W4RA 2O8FA 1EGAA 2VP4A 3F5FA 4HEJA 4WBSA 1S9HA 4L8GA 3W9YA 2CNWD 2EFEB 2HLDA 3CNLA 3I73A 4HAZA 4RD6A 3B9QA 1BS1A 3RYTC 2OE2A 4HAXA 3WMGA 1E32A 3WXMA 4P32A 1US8B 2BBOA 5J4KA 1ZUNB 2FOLA 2OFWA 4Q7KA 4BLTA 2NPIA 1E9CA 1KDRA 2O0HA 3CPJB 3SJCA 1Z47A 5KDLA 2OFOA 2D7CA 4JYBA 3EARA 4OI1A 4AC9A 2PCJA 3UIEA 1J99A 1F2UA 1ZRHA 3LVRE 1IM2A 2YV5A 2AK3A 5FTKA 4CRWB 4PO1A 1BYIA 4JIMA 1Q3HA 1Z6XA 1E69A 1HQYE 2H92A 1JR3D 4QGAA 5G53C 5IHPA 4PSAA 3FMPB 1E0JA 3KJGA 2VRWA 1CIPA 5LD2C 4HLDA 5AJVB 4LJ4A 3BFKA 2FZLA 3TW8B 2GAOA 4LSGA 1RJ9B 1NN3A 1PLJA 1E2FA 3R7WB 2C96A 1CS4C 4DSOA 3BWDD 2O8CA 4A1FA 2R62A 1IXZA 1G6HA 1U0LA 1GRRA 1HT2E 3GMTA 4M1TA 3HU3A 2FFQA 2WMOB 1IN7A 3ADKA 2ZE7A 1KDOA 1LV7A 2IUSA 2ZSDA 1L7VC 4Z54A 1YZKA 3R8CA 2WKPA 1XPUA 4IKEA 1J7KA 4KODA 4A4DA 3GFTA 4BECA 5HE8A 3VX3A 2B8TA 3U44B 3ONWA 1IAQA 1T3LA 1D6JA 5FOVA 4C0HA 3FKSA 1MR3F 1MO6A 4TL8A 2GCPA 4IHQA 5DYGA 1ONBA 1OH7A 2A5YB 2C98A 5H8WA 2YWEA 2Z4SA 3FHCB 1HH4A 4HZUA 2Z6VA 1NMZA 4DC9A 5J4YA 5DHAA 1ZAKA 4Q1AA 1GFIA 3FTQA 4Y0VA 5EE3A 3RS3A 2WPDD 3B7GA 2C77A 4XVUA 2XSZA 5AUQA 1W44A 4AKEA 1F6BA 4M22A 1XTKA 2V9PA 3D31A 3RABA 4YDHB 3W5IA 3IBYA 2NO1A 5FBWB 3ZH9B 2J9RA 5FTMA 3BD9A 3NXSA 1GILA 1RYFA 2W0MA 4Q66C 4OHXA 5L3SB 4P4SB 4C30A 4YXWD 1KO1A 1HV8A 3FMFA 3O8CA 3CO5A 3SJAA 1GL9B 3TAUA 3T1VA 2L0XA 4O2RA 1P9WA 1OHHD 4KSBA 4B3XA 1NLYA 4V0MA 2QSZA 3JZMA 4G5QA 5LBIA 2GXUA 1YZLA 2YVUA 1G5RA 2IF0A 3CWZA 3BE4A 3MWLA 4Q4JA 2Z4RA 3NH6A 1AQYA 4MDFA 2IA5A 2H7VA 4M1OA 4BLSA 2ZSEA 1RZ3A 1XZQA 2YC4C 1Z07A 2N1BA 3PEVA 3QXSA 4V0KA 4OK6A 4QC2A 2ZRMA 2QNRA 1Q3TA 3H86A 5BQ5A 3EPLA 4MRVA 5CLQA 1A4RA 1DELA 3R9WA 1KO4A 1R0YA 3MMPA 1XJQA 1AIPA 1UKVY 4NYIQ 2ZRLA 4JYCA 2JLRA 3EIEA 3NBZC 1VDZA 4AURA 2VHQA 3QQ5A 3DPUA 1U94A 2ZSAA 3AP3A 2ZETA 2Z5FA 1IN8A 3LBHA 1U81A 1OYYA 1WP9A 4DIDA 4ESVA 2VYFA 2C5LA 3ZS8A 1KI3A 4WIAA 5BN4A 2QORA 1NVUQ 1R5OA 1XP8A 3AKDA 2OZEA 1BIFA 4R2HA 3B2EA 2HJGA 3QVUA 1YR6A 1D2EA 4A92A 3GLFB 5FH9A 2UVQA 1RRPA 1BMFD 3IEUA 1R8SA 3X1XA 1FTNA 1N6PA 1ZNXA 1R10A 1SKYB 1NVVQ 3K09A 4NYJQ 1G8HA 2ZI5A 4GBMA 4PPGA 5G3ZA 2FJUA 3CR8A 3EPHA 3FE2A 4GZLA 1XBTA 2QPTA 5JWRA 2FEOA 3CWQA 1YE8A 3KB1A 3T61A 1TPZA 1PLKA 1LNZA 1SXJC 2J1LA 3THWB 4TL7A 2GVZC 1YRBA 4DB4A 1MO4A 4LJ9A 2JLSA 3TK1A 3GLHB 4NYMR 3BH6A 3SYNA 1F2TB 1UEJA 2B21A 3SBDA 2VHCA 4G5GA 1OH5A 1N6KA 1ZUIA 4TYNA 2VBCA 1ZM3A 2ZJ8A 2QU8A 4Q02A 5JECA 3KJHA 2HYDA 3PFIA 3NDBB 1YR9A 3BOSA 4DLXA 3U4QB 1K5DA 1XZPA 2QBYA 4D4LA 5GJVC 3D6TB 2PH1A 4BRUA 4EQ6B 3CONA 2N46A 2VA8A 1G1MA 3LH5A 3G5UA 3KQHA 2XXAA 3OF5A 4XD7A 4Y0AA 3B1ZA 3AF4A 3GCGA 2V54A 3QE0A 3AUYA 1P7CA 3VR3A 3THOA 1W36D 4DLTA 3LQQA 4B3BA 1RKBA 1E2PA 1E9EA 1Z0AA 1E6CA 3K0CC 4B33A 3DM9B 2OBMA 3PEYA 5FUWA 3I62A 3N70A 1DARA 3PR1A 3QG5A 3MUFA 3LNCA 5A5GA 4LX0A 2REOA 3ZJYA 3HDTA 3CZPA 2FFAA 2QAGB 1H8HA 5DI9A 1ZCAA 2ZS9A 3CB4A 3CRVA 3OHMA 1T9HA 4R98A 1DPFA 4BUJA 1LS6A 2G77B 4Q1FA 1OYWA 3DMDA 4MDEA 1KZ7B 2J41A 2ZSBA 2WVJA 3TKLA 3LX8A 3IILA 4MYTA 3KQLA 3R7WA 5J4LA 1G19A 2QN6A 1AA9A 4D81A 1EFUA 3TLXA 3K9NA 1FZQA 3B1YA 3KFVA 5FL7D 2YOHA 5TY0A 3SI7A 3NH9A 2JGNA 2ZJ2A 1G7TA 3UANA 4U00A 2OSBA 2VF8A 2ZS8A 3O8RA 3KTAB 3IHWA 2DWOA 4CEJB 1KK0A 3MFYA 2XB2A 1EWRA 2EWWA 2R8RA 3B1VA 3U44A 4BZQA 2WWHA 4A2QA 1JQLB 1SKQA 4CGZA 3TUZC 3U7HB 2C78A 1KMQA 4LC1A 4R71A 2Q6TA 1OW3B 4LWZA 2O8BA 4RSGA 3SN6A 1ZU5A 3EASA 4HLQB 3TRFA 1OPXA 4BZPA 5JEEA 3CBQA 1P60A 2W83A 2ZPTX 3GJ5A 2CJWA 4LJYA 5JWOA 2YKGA 1U0HC 1CR2A 3CLVA 4H9GA 3VMFA 2ZANA 1Z63A 1TUIA 2YJTD 1MOZA 1ODFA 2JCSA 4JS0A 2OLKA 4UXIA 4YMSA 3AM1A 3ZZTA 3IO3A 3QI2A 3P4XA 3QPUA 1UDWA 3B5JA 1KI9A 3UK6A 1ZM7A 1XU4A 4RCZA 1ESMA 3BK7A 2J3EA 4PR0A 2VHJA 4P0TA 2ORIA 4BEJA 3O8BA 4KBGA 3GJ3A 1GWNA 1CRQA 3RSOA 4QNRA 4EFMA 2ZTSA 2GJ9A 2JIZD 2DR3A 3NKVA 4N0DA 1F48A 4QNMA 1W0JD 2X8AA 5EP2A 3ZQ6A 5B30A 1CXZA 3I5YA 1ZIOA 4V0OA 4G0NA 2J7PD 3UWKA 4KFUA 2W6JA 1KO8A 721PA 1KAGA 4B3GA 3LAWA 1I2DA 3MD0A 1E2QA 1G64A 1M7BA 4UNNA 1T3HA 4US2R 3G82C 1KTVA 3C5CA 1P62B 5TMPA 1G8GA 2ZRGA 4GFDA 4MKGA 3QKTA 1AZSC 4CT4B 1XD8A 2WWXA 1OXXK 1E2NA 2OG2A 2W2XA 2HDNB 2VH5R 2ZUCA 2ZRHA 2WICA 1KI6A 1Y3AA 1R0ZA 4JVSB 2EYUA 5SZJA 1ZNWA 2GEDA 1G291 1TQ2A 3BIFA 3OEHD 4EJSA 2BM1A 3CX8A 1GSIA 3Q3JB 3TIFA 3VHLB 4LV6A 3RWMB 2VP5A 4F38A 1WMSA 3TSZA 4CW7A 2GEUA 3QXJA 4PO9A 3IEVA 4KAXA 2WJIA 1MO3A 1CBUA 3WMFA 4TT3D 1LVGA 1IXSB 1VYUA 1Z06A 2JJ1D 4Q9JA 3LO5A 3QPVA 2JLYA 5EZ5A 2IS4A 4CDGA 5TV2A 2WOJA 1DAHA 3NIBA 2GBLC 5BN3A 3C5HA 5TB5A 2WIBA 4Z1MD 5FOWA 4GI7A 4DCTA 1LF5A 1OIWA 2GWHA 1GVNB 5EP4A 4PANA 4L5BA 1M34E 1DE0A 2DYKA 3AVYA 4FD2A 1W48A 1JEEA 4OJQA 1VMAA 2W58A 3L8YA 4GMDA 2V4ZA 4LJAA 5J40A 3X1WA 3THWA 1S96A 3TBKA 5JLJA 1NLZA 5FTNA 4ACAA 1S0UA 1JAHA 2CNWA 1T0JB 4KXFB 5JWHA 4WZAE 2Q3HA 5E3HA 3THXA 2FGJA 2GILA 1P9RA 2WMNB 4BFXA 2V8OA 4HATA 2GNOA 3SFVA 2BM0A 2EFDB 2AD5A 2MMCA 2MMGA 1EK0A 3LXRA 1P4SA 4JSTA 4JBYA 1W36B 4LC0A 3OIUA 1J2JA 1E1RD 4Q9HA 2GJ8A 1RFLA 2YOFA 1N3BA 4L15A 3NBFA 4XSGA 1KO5A 3AVPA 3CX7A 1U0JA 1WA5A 3SEAA 1G17A 5C4GB 4QJ5A 4LYJA 1JR3A 4DSUA 5LDDC 4TYPA 4TQ9A 1EX7A 3H2YA 2C03A 3PG5A 3BS4A 1LW7A 5SZHB 4JLAA 4IDNA 5D3QA 2O8FB 3A4MA 2QAGA 4DLSA 1L4YA 2GXSA 1QZXA 3I3SR 1Z0FA 4XH9B 3AQ4A 1XEFA 5GVRA 5AUOB 2XGJA 1T4GA 1F60A 3IQWA 3MWJA 1VKJA 1P9NA 4NH0A 2GF9A 4X8OA 4URVR 5FOSA 4CEHA 4QGHA 3HWSA 3MLEA 3N5CA 3GLIA 1G41A 5LB4A 4IW3B 3HYRA 1FOEB 1N6HA 4TTQA 1JQJC 4DCUA 3CM0A 3X2SA 4I1VA 3RS4A 1N6IA 2Q9CA 3IIMA 4WZBE 3ZVNA 2B7CA 5M04A 1H8ED 4R7ZA 1I4TD 5E7JA 2DWQA 1XTQA 3BB4A 2AWOA 1P3JA 1P5ZB 2I3BA 2WPDA 3QNUA 3IGFA 2QTVB 5KHOC 2ZI7A 3ECCA 1XPRA 2CK3D 4LZZA 3HYTA 1O3YA 2WHXA 3ND9A 4Q00A 2H8KA 4H1UA 4B6EA 1XEXB 1AGRA 1U8YA 2VEDA 3V9PA 1GIAA 1TADA 4OI4A 4Q4LA 3AVXA 3W34A 5FBQB 4JLKA 2ORWA 5JHGB 4W5JA 1HTWA 2NG1A 1OFTA 2O8EA 1E9RA 1T0HB 2KSQA 3MJRA 2QP3A 2GK7A 1OHHA 5FPKA 1GM5A 1XTIA 4A6XA 3AF1A 3KQNA 1ZC4A 5JS8A 4Q1CA 1Z0KA 2J0VA 4TLBA 1D2NA 2WWIA 5B2ZA 2O8DB 5CITA 5P21A 1E9DA 2PL3A 1VHTA 5FBLB 2WWWA 2YYZA 2A2ZA 4OBEA 4W9MC 4HZUB 1G4UR 3C7KA 1QRAA 2DFTA 3LX5A 4RZUA 1Y63A 2QROA 1MT0A 4YONB 4TYYA 1DAGA 2WWFA 3BB3A 1SKYE 4PHGA 3F3YA 3WYAA 5FBRB 3TQFA 2P67A 1CTQA 1JPNA 4NPHA 5J5CA 4EFLA 3BB1A 2QL6A 4UNPA 2IYWA 3UMSA 1XFAA 1Z8FA 2FFBA 1BOFA 1T3SA 4EPVA 1G16A 5DH9A 3FB4A 3N2EA 5FTJA 1AKYA 1OF1A 5F98A 1ANKA 4FINA 3ZVRA 1ESNA 4PZZA 5KU1A 2CMKA 4E22A 4GMXA 3ASYA 1KY2A 3NC1C 3ZVLA 1KY3A 4Q01A 2V7QD 2Z83A 5J4VA 1KJYA 3U7EB 2ZRPA 3CRQA 2JLWA 4Q4JB 4AG6A 1MH1A 4MKFA 3VR2A 1J90A 2DHRA 1TF2A 1Z6AA 5KSOA 4YQFA 3Q85A 2YWHA 4Z8YA 2AN9A 3IO5A 5L3QB 2P5SA 3VNUA 3X1ZA 4B2PA 4NP6A 1JEDA 4KJZA 3PUXA 2ZVPX 1KSJA 4JMPA 3UKDA 1DAKA 1ZCBA 1SHZA 4LRWA 4EPWA 4EKDA 2OV2A 1UADA 2CCKA 3SNHA 3L0PA 1T5IA 3ZQJA 3FHTA 1CEEA 1SGWA 2VSOA 3VTKA 2RGBA 1LTQA 4FWTA 2ZJAA 2GEVA 4DEYA 2IS6A 2GETA 3SOPA 2WJVA 2ODNA 1E1QD 4BLPA 4YDSA 3KUCA 3EPJA 1NSTA 3CW2A 4IFBA 1ELOA 3PUZA 1XNJA 3P27A 2GJSA 5C18A 3UMFA 1CJTC 2IYLD 4NYIR 4IEEA 2BEKA 1JR6A 4C0QC 4LYHA 5EUMA 2E9SA 2P6NA 3BXZA 2ZRCA 1KNQA 2BJVA 1SVIA 1R7RA 2YZ2A 2XZLA 1P6XA 3GLIE 2WM9B 1VG1A 4TQUS 2VQSA 3LRPA 2IYXA 4CZ2A 4DWJA 2IYYA 2W6ID 1M6NA 421PA 2F55A 5JI3E 2J7KA 5L8VA 2WV9A 2GRJA 5TVKA 1PVOA 4ZCLA 1HT1E 2Q3MA 4QGGA 1SULA 4B2IA 3WP0A 2F1HA 2QMEA 1WE2A 3LW8A 4I81A 1AS3A 2HUPA 4A0RA 2OBNA 1TQ6A 3IUYA 3K0SA 4A2PA 2ZJZA 4PC2A 5HPYB 4GSYA 1R6BX 3WRXC 1Z0DA 3TSWA 1U2RA 4NYJR 5C46F 3OIYA 4ZCIA 4ZDKA 4D26A 2QBYB 1PV4A 1VECA 5FL7A 2E87A 2VP0A 1KZGB 1Q44A 1DG1G 3DZDA 1WCV1 5FTLA 4TMZA 2XXAB 1LF0A 1MABA 4JVMA 4WXRA 3A4NA 1I2MA 3I5XA 1CU1A 3MJHA 4TMWA 1VCIA 2CL0X 3QEJA 2EU8A 4BRWA 3EXAA 2P5TB 1A2KC 4P3YA 2C99A 1N0VC 4Q7JB 4XOIA 4B74A 2QPAA 2RGNC 2F1JA 1VG9B 3PENA 3QF7A 3VFDA 4B32A 2V6JA 2DY1A 4C0BA 5JCPA 1DVRA 3E70C 1AGPA 3O47A 4FN5A 1XD9A 1KJZA 4FWIB 3CPHA 3RWOA 1AN0A 1NMXA 4HDOB 2FSGA 4NCIA 2NZJA 1KSFX 3CKLA 1YZQA 2PT5A 4QBGB 4XTCS 3WYFA 3TAHA 1A1VA 2F3TA 1XJ0A 2ZYUX 1DOAA 3CRMA 5FPHA 3SDZA 1XEXA 1RVDA 4F4CA 3WNDA 4EUNA 5KYKA 1N5JA 1YR7A 1G5TA 1B23P 4RZ3A 2WTUA 2B92A 4U02A 2LCFA 3TUIC 4PXAA 4I4LA 2B7BA 2VP2A 3L0IB 5CDFA 1U90A 1G8YA 3REFA 4L4UA 4TZ0A 1W2HA 2VL7A 4IOLA 5IDVA 3W6OA 4DVGA 4YMUA 2AR7A 4L16A 3L0SA 4RD1A 1J8MF 4NCHA 3AH8A 1JB1A 1TU3A 1Q57A 3LXXA 5KSPA 4B73A 4GNKA 1XDBA 1EFRD 1Z0JA 2JIZA 5J4HA 4KVAA 4XWOA 1PJRA 3D8BA 3T1QA 4DDVA 1W0JA 1E79D 1S2MA 2O8BB 2XJ4A 2O8DA 2ZROA 1CJMA 2OBLA 4AY2A 1Q1BA 2J7PA 5F3WB 4PFSA 4FXPA 2CJWB 5EP3A 2HYIC 5JSZA 5HZHA 4UJ3A 3OIVA 5F9HA 4QKQA 2I1QA 4F7WA 1LY1A 2YHSA 4LGMA 1M74A 4N3NA 4I1SA 2QAJA 3CUEF 3LDAA 5H70A 1C9KA 2WKQA 4Z8XA 3T35A 4M9SA 4DDWA 2BMFA 3C14C 2ZR9A 2IF2A 4BLOA 4PAOA 3QBTA 4C0KA 2IHBA 2R6CA 1I4DD 2XTMA 3GJ7A 4Z51A 5CIQA 4DLVA 2P3SA 1ZUHA 5E7IA 2J5XA 2NO9A 3MWYW 3OEHA 4HDQB 4KFRA 3KFXA 4DBLC 1KI1A 621PA 4LV5B 2FMXA 1SXJE 2GZHA 1GNRA 4KCGA 5B57C 4TYWA 2RGAA 3QSYA 4BFVA 1Q0UA 3K1JA 2XNDD 4TT3A 1VHLA 1E99A 2JJ1A 4KBFA 4UNQA 1SHKA 1W7AA 3EIHA 5E7MA 1COWD 1ZYUA 4OL0A 3SFZA 1QHXA 1ZM9A 2PMKA 4LJ8A 4Z1MA 2CE2X 4B71A 3GPLA 3EAQA 5L3QA 1HYQA 2ZYTX 3AGQA 1KJWA 2OCPA 1NN5A 2RH5A 4NTZA 4YC7A 2WWYA 4YLGA 4ABYA 2G6BA 1BKDR 2ZE6A 1JBKA 2BCGY 2ZQ5A 2WSMA 1Z6GA 4BFYA 1UAAA 1BYUA 1K8RA 1A7JA 3PEWA 4TSFD 1J8YF 3RS5A 3B13B 5FL3A 2BBTA 3QVVA 4A8JC 1UEIA 1E2JA 4PAQA 3B1XA 1MV5A 1KI6B 3AGPA 2UZIR 1N0UA 1R5NA 4EJSB 3AF3A 2ODEA 3U2QA 3TR0A 1JAIA 4V0LA 3RRYA 4URXR 1RRGA 1YU9A 2K5UA 2QQEA 1KK2A 5H68A 1PUIA 3RRZA 4UNRA 1NL3A 4OK5A 5FOXA 5EJEA 2IT1A 4LJ5A 3BERA 3BRWD 3BJIC 2HT6A 3VU9B 4GP7A 1DAIA 4Q4AA 5CYPA 1II0A 2HJVA 1L2TA 1FP6A 1E1RA 4UXHA 3C41J 2IXEA 3DOEA 2J0SA 3X1YA 3EX7C 3P20A 1Z28A 3TW4A 1GUAA 2IYZA 2MSDB 2BCJQ 3DKPA 3QBVA 4HDCA 4TLAA 1WQ1R 2FF7A 3TVTA 2F1IA 1GZSA 5B64A 4WXPA 1W49A 3SJZA 4RJLA 3ZIAD 4HLUA 5DSZA 3CNOA 4G5OA 4AG5A 3GP8A 2D7DA 3VR4A 2ONJA 2RGDA 4Q9KA 4OQNA 3ZGXA 3CX6A 2CBZA 2RAPA 3EC2A 1FFHA 4F92B 3THXB 1A5TA 3U6BA 2YWFA 5G3YA 3EZ9A 3B6EA 2RCNA 5FFMA 1XD2B 4ZI2A 2A3RA 5CDFE 3TGPA 1CULC 2BKEA 2FFHA 2IXFA 2ERXA 2MSEB 1SXJD 3W3ZB 2JASA 3RS7A 1OB5A 4P4UA 1T8TA 2QRZA 4ARZA 3RC8A 2KBEA 4TLEA 1TTTA 4FIDA 3MRSA 2VP6A 1HUQA 3CF0A 1Z3IX 5DN6D 1H8EA 1F5NA 2JJ8A 4NE2A 3JZAA 4M4SA 1P75A 4XIGS 1G4AE 1XTJA 1KMHA 4JVNA 4ESHA 1DTSA 2ZRJA 3SC3A 3R9IA 4DJTA 4IJMA 2CK3A 2DFNA 2XB4A 1YRAA 4NU0A 5JJKA 2W2VA 4P31A 5FBVB 1OFIA 1ZIPA 4NKRA 1R0XA 3W90A 3SR0A 2GCNA 4K81B 3AEZA 2C04A 4Q1BA 2V1XA 3UMRA 1A82A 2JLQA 4ZKEA 3OIWA 4B34A 2PEYA 1Z6YA 4MGIR 1IXRC 1HURA 5LD2B 3U3MA 1JPJA 2GA8A 3SQXA 1R0WA 5G41A 5HKKD 4RFVA 2FDCA 2CLCX 4II7A 3BBPA 4LYFA 4M1WA 4CIDA 4HB3A 2FPKA 4BEBA 3JVVA 2FV8A 4PZYA 5LB2A 3GLIB 2ZAMA 2GZAA 3FHOA 4CYMA 2IWRA 1MKYA 1NN0A 4KU4A 4AKGA 2YINC 4X8MA 1G3UA 2OXRA 2W2TA 1UM8A 4LUCA 4PQYA 2D62A 4MYUA 3T5DA 4MGZR 1X86B 3OE7D 4FCWA 1G6OA 4KVGA 4LOAA 2AK2A 2QY9A 4KI0A 4AYTA 1GKIA 5EXSA 4HB2A 1L8QA 2SHKA 3O8DA 4A82A 2CE7A 4MUAA 1OFHA 2ZVQX 4QRHA 1NF3A 1NG1A 5AJYA 821PA 4O3MA 2O0KA 2WZQA 4I1OA 1ZVQA 1R8QA 2BHRA 3TMKA 2HXSA 3QENA 1KYIA 1GNPA 2AD1A 3PV0A 3Q5DA 4GP6A 1AJEA 3NEJA 2XZOA 1U9IC 3K9LA 3SHWA 5BN5A 2XAUA 4D25A 3TQCA 1NG9A 5K8IA 3A4LA 3TSOA 2E1RA 3KJEA 2DB3A 4C4PA 5EXXA 4EPXA 3RRMA 1U8AA 4D82A 4YMVA 1W47A 4LBVA 2O8EB 1JXMA 2ZU0C 4QBFA 1FNMA 1NN1A 1II8A 4Q7LA 3A37A 5FUXA 2HF8A 1GL7A 2QRNA 2V7QA 4B48A 1GRQA 2DPXA 2Q9AA 5DI3A 5DLQC 2IS2A 1JECA 3LVQE 4JLVA 3NC0C 5KTYA 3AP1A 1CRPA 1VCMA 1NRJB 1JI0A 4QJ3A 1NVXQ 1Z83A 3PXGA 1KHTA 5KDDA 3I1FA 3EZFA 4S2EA 2KBFA 4ZDIA 4K8OA 1X8JA 2ZJ5A 3AP2A 3DDCA 4M0LA 5C4MA 1GKUB 4S35A 4BLRA 4FW9A 5EUQB 4XVRA 2QG6A 1TL7C 5EXTA 2BEJA 2J0UB 4F4IA 4HUTA 3IHLA 3KXKA 2C9YA 4KYIB 2IWHA 3RS0A 5DO9A 1TUEA 4G01B 4Q1DA 5EZ6B 1U99A 1VTKA 1X8LA 2NO7A 4GOJA 4MA4A 4M1SA 3L2OB 1YR8A 5AUPB 2IS1A 3ETLA 4W7SA 2D06A 2ZE5A 4IDOA 1E1QA 5FPYA 2P65A 2EWVA 4KLNA 4NCNA 1D5CA 2QT1A 6Q21A 4LHVA 1YKSA 4QL3A 3C15C 1CF4A 2LKDA 4KHZA 2BC9A 2KE5A 4MITA 5FOUA 1NLFA 2JDID 2PZGA 4IDQA 3A1VA 1FW6A 1Q20A 2GESA 4HAYA 4OHVA 3DOFA 1BH2A 2JLUA 4J0QA 3FMOB 3PUWA 3FWYA 4TYQA 2ORVA 3U7GA 3VU9A 2W6IA 3QXXA 2F9MA 1QHSA 4QHSA 1Q1EA 3Q7PA 8OHMA 3K70C 2IYTA 3M4YA 2EQBA 2J87A 4IEIA 4URUR 4Q7MB 5BYKA 3VNVA 3WNCA 3EIQA 1KNXA 3B85A 1Q1ZA 3QKRA 1AS2A 4QBHA 4XVQA 4NCJA 2NO6A 2RKOA 3LFUA 2HEIA 2GXQA 2FA9A 3WP1B 3NHBA 1GITA 2WIAA 4JJKA 2C95A 3IIJA 1OIXA 4CEHB 4JLDA 2F7SA 1S9DA 2V3CC 3P26A 2V1UA 4Q5IA 1SXJB 5JBQA 4W5WA 3ADCA 2OO7A 3WNBA 4NHOA 1W5SA 5DISB 4AYXA 1OB2A 3VKWA 1YVDA 4GDFA 1XD2A 2A5DA 4KFTA 4WA7A 4PC7A 3K8YA 3I8XA 3RC3A 4Q18A 4UQOA 5AJWA 1P72A 1W4BA 2QTHA 2NGRA 1G9XA 4XTRA 1UDXA 1DO2A 4RD2A 5KDOA 3K09C 3ZZUA 4NONA 2J46A 3TH5A 2R9VA 2ASEA 4KSCA 4DUGD 1DAMA 1E2MA 4WOPA 4GPTA 3HJNA 4TL9A 5JMTA 4TLCA 1N2CE 2P2LA 4E5UA 1CJKC 2QE7D 1VCNA 1YJ5A 2CHGA 2RGNA 3PIRA 4AK9A 3MWKA 3KKQA 4JL8A 1KO7A 4JJZA 3LLUA 1E2DA 1TEXA 2ANCA 1T8UA 2VHUA 3AVQA 3T34A 2GK6A 2OESA 2OHFA 3CIOA 4LJ7A 4DDUA 1MABB 1RW4A 1IN5A 1IQPA 1ZBDA 2D3WA 2OUKA 3NEYA 4OI2A 4TQAA 2DFKB 1FL9A 2UZ3A 1DO0A 4RD3A 4NCKA 4RD4A 4DLRA 1EFRA 4P4TA 4AYWA 3FDIA 4DZZA 1ZNZA 1E79A 1SVSA 4M1KA 3GFOA 5KUTA 1G7CA 1FP7A 2PCLA 2RB4A 5AK0A 4CF7A 1IOZA 5JZVA 2AXNA 4N1AA 1XPOA 3I32A 4YMWA 1Z5ZA 2H18A 3A1TA 3TE6A 3W3AA 4G5SA 1DBSA 3AUXA 4M9QA 1IJEA 3LBNA 4TMTA 4MRPA 1IHUA 2CDNA 3B1WA 1XMJA 3HR7A 2A5JA 3KJIA 4IDPA 3RS2A 4Q21A 1BO6A 2ZJOA 4PHFA 5TXGA 2ZJYA 4IVRA 1QHNA 2C2HA 2OLJA 2QM8A 2ZSFA 3FFBA 1QHGA 2XJ9A 2AL7A 3QOFA 3VKGA 4LCBA 3I61A 1J70A 1YZGA 1MRNA 4F93B 3HP1A 4RKFA 1NY6A 1FUKA 2ZEJA 2XNDA 3K0EA 1D8TA 2A5FA 4M9ZA 1RRCA 2JATA 3SHFA 1COWA 1DAFA 3OEED 3PUYA 3I72A 1FMLA 3W5JA 1NBMD 3KXLA 3IPXA 5KSZA 3T5GA 5JSZB 2FE4A 2X77A 3EZ6A 2F1RA 1XWIA 2W0SA 1RIFA 4CT5A 1HA3A 3BORA 4JT4A 4UXJA 4BFWA 3E2IA 4A0FA 3K0AA 2KJQA 2PX3A 3T1OA 4TSFA 5E4FA 1GP2A 3ZD7A 4HB4A 1C1YA 5KOYA 3PUVA 2J0UA 1P2UA 4EFNA 3K53A 3MCAA 2FPLA 2IBMA 5E95A 4LDJA 1W0KD 2CLSA 3B60A 2O5VA 2BMJA 4A0HA 1GNQA 1K6MA 3BH7A 3QKSB 1KK1A 4FMCF 4PPQA 121PA 3CH5A 1OIVA 2NTYC 1HE8B 3NBXX 3QIAA 3UG7A 1QHIA 2NMVA 1X8KA 4DXAA 2GZDA 4A8JA 1YHNA 1RC8A 4M1YA 3FKQA 2GJAA 5ELXA 1I4LD 4M1MA 4AKIA 3WBKA 3F8TA 3UWOA 3AB3A 1NP6A 1E2LA 4URZR 4FI3C 1EFHA 1KI2A 2ATVA 1LS1A 1SVWA 5K8UA 3WMEA 3ZIAA 3RANA 2A9KA 2ZRAA 2BIFA 4TL6A 3A1UA 1PZNA 2UKDA 2Q0HA 1G8PA 1ZC3A 2CLDX 3GEEA 4KO8A 3EA0A 4XWKA 2VPPA 3VKHA 1HQCA 4GL2A 1XB2A 2REBA 4TTPA 4DSTA 1Q12A 4V0NA 1Q1QA 3MG9A 3EZ2A 5EE1A 3U6KA 4DSNA 2OCAA 4AKHA 3SYLA 5FUVA 4B6FA 1QVRA 1AKEA 2JLXA 2ZI9A 4O2LA 3VHXA 3H1TA 2X2FA 4QBIA 4BZXA 5A4JA 1TAGA 3AVVA 1HEIA 1G5PA 3UG6A 2RGEA 4Q4AB 4NL4H 2ANBA 1SXJA 4ZI3A 4RKEA 5HCIA 3SBEA 2VSFA 5GJWC 1IONA 3DO6A 2D2FA 1CR0A 3DKVA 4JL6A 2QTFA 4FMDF 4MGYR 1NKTA 3C8UA 4Q03A 4CEIA 3QJYA 3GJXC 4ON9A 5HCNA 5DN6A 1UPTA 2CHVA 3GLGA 2BV3A 4IOJA 4V03A 3R20A 4JZKA 4PTLA 3TUJC 1ZJ6A 3WHLA 2FPMA 3H4MA 5H1YA 4KFSA 2DCUA 2OEPA 5KNDA 2FSFA 2AWNA 2BWJA 5TARA 4ASUD 3PQCA 1UJ2A 3GD7A 4TLDA 3U61B 2Y8EA 3I4LA 1GDDA 3OAAD 5F9FA 4HB0A 2AXPA 2ZIAA 1UKZA 4URYR 5AUNB 3FPAA 4LHZA 4RZXA 5FOTA 1GAJA 1EXMA 3RRNA 1S4QA 1XTRA 4JLNA 3K0CA 4PSVA 1E9BA 4GT1A 5HKKA 2GAAA 2FG5A 1T91A 1TU4A 1VIAA 3QXHA 4MYHA 2H17A 3U3KA 2C8VA 3V4RA 1NY5A 5FI0B 1N0WA 5CK4A 3M0EA 4ARZB 3U3OA 4IVQA 2FX3A 2IEYA 3Q5EA 5DNYB 3OE7A 4DHEA 4JKYA 1SZPA 2G9NA 2X19A 3CRRA 3QEOA 3T15A 4E07A 3AKEA 2H16A 1RYHA 4KITB 1KIMA 1KMHB 2BJWA 3GEIA 4X8HA 3E5HA 3V4FA 2QPOA 2GF0A 2G83A 3Q9LA 1CJVC 4E09A 3U60B 3G0HA 1N6LA 1GG2A 1W5TA 2OAP1 2F3RA 5JFGA 2H57A 1NI3A 2WKRA 4JBWA 4IOMA 5JRZA 4MYCA 5ANRB 1WBBA 1D9XA 2D2EA 1GTVA 2G1JA 5DE3A 2NQ2C 1XCGB 1XXHA 3W8NA 5IK2D 1UFQA 3W6NA 4EAQA 3OZXA 2QAGC 4BFTA 2VTKA 1P2SA 3KB2A 2BMEA 4U5XA 5GJBA 2DFLA 2DWPA 2XOKD 2RGGA 4MRNA 1M7HA 3K0FB 1GRNA 1T6NA 4D0GA 1U9IA 2Q9BA 1WRBA 4HLCA 1OSNA 3M6AA 1OE0A 3IKJA 4QHTA 4PQFA 4B44A 4RD0A 2A5GA 1G3IA 3ZLJA 2A30A 3EZ7A 4D0LB 2FEMA 1AQUA 3OFND 3JVUA 4XSHA 5GVSA 2ATXA 4IXMA 4DLYA 1OFUX 1QVAA 1O87A 2PLRA 1D2MA 2CXXA 2EW1A 3T12A 4C0SA 2ZJBA 3N2IA 1G3MA 5EP1A 2YWGA 3ICEA 2WAXA 4AD8A 4G5RA 5FPTA 1OT3A 3VR6A 5EE0A 3WYGA 1KAOA 1SVLA 2ZR0A 1D9ZA 5SZIA 4PPNA 4ZIRB 4TMXA 4C9BA 1QG2A 1N6RA 4MKHA 2G1KA 1DEKA 1II8B 1EG7A 4PC6A 4EPYA 4KLZA 2NO0A 1VCOA 1Z2CA 1ETUA 2JDIA 1TX4B 2PX0A 5DI3B 2BBSA 1OKKD 3OESA 3IQXA 3QKSA 1ZM2A 2QGZA 5KO2A 2JAQA 4POAA 3SE0A 2WJYA 2VSXA 4G1UC 1S8FA 4DIEA 2R44A 3ND8A 1H65A 2KWIA 5AR1A 3P32A 3X1DA 3U3RA 1X3SA 4XWAA 2Z0MA 1EFCA 3J81k 5KSYA 3EG5A 2R6DA 3GLGE 4HAVA 5HTKA 2F6RA 2C9CA 2ZU6A 4V02A 3L0OA 3Q72A 2P6UA 4RFSB 4DLWA 1U8ZA 5BXQC 2ZRKA 1OXTA 4ZDWA 1TF7A 1JJVA 2VIIA 2IL1A 1KDTA 4GOKA 3EWAA 1E96A 5BW8A 5BWMA 5CB8A 4HUQA 4M2LA 5L3RA 4TWZA 1A2BA 2OCYC 3FMIA 3HPRA 5KPDA 4DDTA 4C0JA 2GBLA 1OXSC 3QKUA 4ILEA 1CJUC 2KI5A 1KI7A 5AJZA 3NHAA 2WWGA 5UKDA 4BE7B 2HCBA 4D6PA 3AVTA 2JJ2D 3GJ8A 3V00A 2NIPA 4LBZA 2WSSD 5C1BA 1N5KA 3FFAA 1UF9A 2G0TA 3KUDA 4URWR 3AKYA 4RZ2A
chains in the Genus database with same CATH superfamily
3PSAA 3BCRA 4M7RA 1YC5A 5KREA 4CN8A 1JH8A 3P9YA 2I2CA 1C30B 4R0MA 1I7DA 5DLEA 3JR7A 1Q7CA 4HDRB 2O6HA 1AMUA 3A6JA 3QKRB 1YL5A 4MR8B 4ILKA 5HUJA 4D98A 5L4NA 3QE3A 3ZY2A 2XLCA 3WR5A 1C80A 1BC5A 1Y9DA 1Z4QA 3OD5A 4K28A 4OV6B 4EJFA 1JZSA 5JAIA 1HE1C 2F48A 5TDHA 2ZPUA 2AFHA 3F7TA 3FSJX 1AF4A 3LO8A 4KX5A 5U4XA 2P9GA 4BS9A 1QRUA 2MSCB 2XLBA 3A36A 5KYGA 1TQDA 1YKFA 4P08A 3QY9A 2MSLA 1QRSA 1XX6A 1Q3KA 1DMRA 1DUSA 1KJQA 4GM1A 2DP4E 4MWSA 5DPMA 4FVTA 5CA1B 3PHJA 1OZFA 1F4PA 2EWMA 2GCOB 1TXGA 4P35A 1U65A 4RTOA 1BGVA 3I9FA 2WHRA 3ROTA 3WJ1A 3QYFA 5D3MA 4NCBA 1T2UA 5EEGA 4P7GA 3C3DA 1M8GA 1E4OA 5FI1B 4LPKA 2CT8A 2YVQA 2ZR7A 3EIOA 3T3EA 4BVBA 3WMXA 3N2GB 2BFNA 3F6BX 5D51S 1Z0IA 4AZTA 3A9UA 2DPMA 1EX6A 3RREA 4JSYA 4BC0A 4X20A 4BE9A 5C37A 1XMVA 4EVSA 3AY6A 1U3TA 2CBXA 4R1MA 1QR6A 5TF4A 5KNCD 1HTTA 1L6RA 1X6VA 2A7QA 3E9MA 2PTHA 3RBZA 4QGFA 4GXNA 4OXKA 4TMVA 2DUWA 2P3LA 4CL2A 4BBPA 1XF9A 5K51A 8ATCA 4M8IA 1U7TA 4HXGA 3KETA 1S1MA 2AR9A 3FPEA 2B7LA 2EFJA 3H2KA 4UOZA 1P2DA 3BDVA 4CU2A 1J0DA 1T13A 1Y5RA 3BGDA 4DG8A 2IVZA 4DB2A 2G72A 4NOLA 2HGZA 4EX7A 1A88A 4IJ5A 3BSYA 2XMZA 2QD1A 4Y2RA 3DLTA 3ZU4A 5CYOA 4E5YA 2WAYA 4ZI7A 3UHOA 3KOOA 3SY8A 5IAGA 1O6FA 3Q0IA 3C8HA 4IQ0A 1EVIA 3MEQA 3AB7A 2R8BA 2J0QA 3C4JA 1EJ2A 1P61B 2HY7A 4C4SA 3MC1A 4GX0A 2BMWA 2AHOA 2CD7A 1M2GA 2JLBA 4ZOAA 5FFFA 2GQ0A 3HE3A 2WTXA 2IXAA 2ZRDA 4K6CA 2KW5A 3QVMA 2Z30A 4YCCA 1HY3A 3RAGA 5DK6A 3SIWA 4D1YA 3FJOA 1HK7A 3PZRA 2IK8A 4INZA 4TRRA 4WUTA 4WAUA 4ZU6X 4GOXA 3DQPA 4UHKA 2BSAA 3VAAA 2IP4A 1J00A 1EVZA 3GARA 1RJ9A 2XEXA 4IXDA 3WI7A 4KO4S 1JJ7A 4LJSA 4PS1A 4A2WA 2PXHA 4ESOA 1XJCA 3ESRA 4MGEA 5C7LO 3KYIB 3BMNA 2MYUA 3ODGA 3IVCA 4LY3A 1HE5A 3DXYA 1E7RA 3V97A 1KI8A 5DEIA 3WHIA 4BMNA 2CL6X 3OLZA 1V2HE 1QIDA 2VP9A 3IVGA 4RIEA 4V0ME 1XEAA 4XLZA 2JG3A 3AT1A 2I4IA 1ZN9A 3O95A 4DMKA 1NI5A 1RLOA 2RSLA 2VZEA 3JAKA 3JX9A 4ZT2A 3LA8A 1W0KA 4JJAA 2FH5B 3GNLA 3GRFA 1U3DA 4DKJA 5LMUB 1B14A 3CMMA 4W6ZA 2CFRA 3L9WA 4GX2A 3VV2A 3K3PA 2DB3A 1ISHA 3C39A 1QGAA 1OV6A 1A76A 3ZHBA 3TTTA 3RNLA 4HWTA 3T0GA 4F8EA 1CLUA 2JGDB 4HAUA 2FPSA 3RYFB 4ZCPA 4XFDA 2FJPA 3PFFA 1R66A 2TECE 4J1SA 4LSWA 1PGJA 3ZWYA 1IY2A 2GN8A 1PVVA 2CCGA 2I76A 2O06A 1O97D 4IP0A 5JD5A 2HSZA 4Z4GA 2EKLA 4NZNA 2L18A 1PBNA 4KO1S 4NBUA 2JKYA 1TW2A 5KYXB 1ZSNA 4L9WA 2NZ8A 4KIGA 2NLOA 3H5RA 4MO2A 5J40A 9MHTA 5JZBA 1RHMA 2ZUSA 4R9UC 1K4MA 3AEUB 1G20E 1NQUA 2G6TA 3KKPA 4D4KA 3DYVA 4CV2A 2PO7A 4WK4B 3K0AB 1ZEJA 2CB9A 1V7CA 2EBWA 3GFPA 3KHUA 2Q1SA 2P0EA 4IIUA 1QYDA 1WXHA 3E9EA 3UOWA 5L3VA 1L7NA 1UBMS 2WZCA 2YZMA 1A50B 2BTQA 3A9CA 3N76A 2MINB 2WHQA 4RFSA 3VSEA 1CRLA 1JYEA 5TGDA 1I13A 1JQEA 3LUKA 3L1IA 1DL5A 2G5GX 3IJRA 2R6AA 3LPAA 4Y7CA 2PSFA 4OHZA 5J47A 1HFEL 1FNNA 1LFDB 1W76A 4OO3A 3G59A 5FEMA 2POCA 1PNOA 3CNEA 3M4XA 3TVDA 5CM8B 5HM6A 4PX9A 1NPDA 3HFJA 1SQ5A 3GLVA 5BYBA 1VYVA 3AKZA 3UPUA 3P9RA 3FLMA 5BVHB 1UBEA 1QWSA 3IP7A 3IJPA 4A8JB 1HZZA 2H4YA 3O75A 1QZ3A 4G4JA 4OJKA 4MUBA 2FQQA 2I22A 4AQDA 4K0KB 3QELA 2ZREA 1DUIA 5KX5F 3LOQA 3FUUA 3JQGB 3KLNA 1URPA 5HVNA 3JQ8B 4JHXA 3GGCA 3N0TA 1RQ2A 1JLLB 1QFXA 2I66A 3SF0A 1C0LA 1XCBA 3LZDA 3H9BA 4CMIA 3BTOA 2XDYA 1RCUA 1JXOA 1Z6QA 4OQFA 2LCQA 4ZTUB 1IBKB 4I4TB 3FYHA 1IN4A 4P82A 1YRWA 3R7SA 1V5WA 4XWWA 3LLVA 5D1NA 2VUHB 2YIVX 3FKJA 3D4OA 2ZAOA 1XRMA 3HRKA 1QUFA 1DUVG 4UKDA 1TK3A 4NBSA 5EG5A 3OAAA 3AZPA 1L4UA 4HQLA 4A9AA 2ZTMA 1DIOB 2G28A 4KSYA 4B09A 2NUTB 5IM4A 1OWLA 1VPLA 1FNSA 1OV4A 1UBRS 3H8JA 4D46A 1PGOA 2FVXA 1ZD8A 2Z5GA 4QXAA 5KHAA 2DPGA 2MT9A 2YW2A 4DLPA 2QG9A 1OA0A 3M5WA 5KYVA 4B3FX 4WT7A 4D80A 2WNHA 5BQPA 4DIOA 1ZVVA 4NYMQ 3GJ4A 5MHTA 3PB3A 3BHNA 3HU2A 1X1TA 3QLUC 1NXOA 3EE6A 2P5UA 2QP9X 4D4MA 4MV7A 5CJ2A 4HDAA 3BC1A 1C41A 3C0KA 4MWBA 1HG0A 3UMMA 1DEHA 3LA6A 3SHVA 3W5AA 4G0XA 4P53A 3UGKA 2R5WA 4CKCA 3SZRA 3H7IA 5JZSA 2J9YB 5CXXA 2VJBA 2Q21A 4O33A 5KOHA 2RI6A 4F84A 3MFQA 3T1TA 1NBME 1Y5MA 2NZ2A 4QICA 1UJ4A 3PT5A 3OPYB 5DX0A 4RY9A 4LHXA 5B37A 5A3JA 3GLHA 3AUKA 4GQAA 4L0CA 1L7EA 2ACVA 2BVNA 2XTZA 1B6TA 1YOVB 3SC2A 3NG1A 1CB0A 3LWDA 3CSUA 2IU3A 2XE8A 4M0MA 4MVJI 3TNFA 3WK4A 1N2JA 1FLNA 1HE4A 4QFBA 3NWJA 2VDJA 4JOSA 2H5LA 5K3SA 4BQPA 1WB9A 2YX1A 3CRW1 1CR1A 1BEEA 2ZQYA 1ZI9A 3MXTA 2G70A 3QF4B 1NJ2A 1XRRA 2PUWA 3I2HA 3R0XA 4KE6A 4MIKA 4YUVA 3WICA 2PJRA 2HCJB 3A9WA 1Y48E 5FFNA 5IK2A 4XIIA 2F43A 1I7LA 2IW1A 2JAWA 3B1KA 1GRCA 2YIJA 2CDBA 1QH9A 2VF7A 1I0IA 3G85A 3ZCQA 1SVKA 3OCVA 4DLUA 4ISCA 5K8LA 4Q4HA 5IT4A 3N8NA 4FMBB 4GI1A 4ITRC 4PLGA 3ANSA 2H54A 5KPJA 1HTBA 1Y4AE 4YT5A 1L4LA 1VGRA 3CZAA 4UMDA 3QXCA 2JKVA 4M49A 2JFVA 2PT7A 3V80A 2RGCA 5C8DA 4P0PB 5F5NA 2VSNA 2Q5OA 4MEBA 4HDNB 3GN2A 3UAXA 1JG4A 1WF6A 4BPBA 4X1KB 3SWWA 1T5DX 5AM2A 1WXFA 2OCBA 4KYUA 1G21B 2H29A 3X1JA 3G0BA 1BJRE 3GT7A 3CZCA 2B8WA 4V0RA 3AKCA 3QPWA 4JI5B 3E9QA 1SOAA 5KWJA 4U7DA 4BC1A 1P17A 3NEPX 4NMWA 4TWJA 2HYIC 2JLAA 1EVEA 3A28A 5I8WA 3NIGB 1EDDA 2ZWVA 4MI3A 1V5GA 5F2KA 1N2BA 3QUQA 1KS9A 1NIJA 3P9CA 1KU0A 2QTBA 4HKTA 2X14A 1YZNA 3FOWA 4HEA6 4N39A 1FTSA 5D8DA 4LFCB 1JTFA 3V4OA 3N2KA 2WQ6A 1FFBA 4DLBA 2QHXA 1K8XB 1VZ3A 2V3WA 1XXHB 2WTAA 3SF8A 1U4OA 4K46A 3FNFA 5KNBA 4GI5A 3JD4A 1LLCA 1ZITA 1E3DA 1F2UB 1XAJA 4EGSA 3R1IA 3IEPA 3LD9A 3MWGA 4CM6A 2FW9A 2W98A 2N9UA 5ARBA 2MYPA 1T9ZA 1KJ8A 1D1QA 4YMHA 5FWYB 1F0KA 2RGXA 4DCCA 1NVWQ 4DDKA 1OAOA 1W1WA 1NIPA 2HHLA 4Q19A 1TYEB 4N49A 2D1YA 1D4FA 3LX4A 4UVIA 5JHHB 4L07A 1RU3A 2YV2A 5IZCC 2BI7A 5IM5A 3WE7A 3WDMA 4CCAA 1TI7A 1M5RA 1E2GA 4K9LA 4O0MA 4E5SA 4GH5A 4DABA 1KIFA 2CKDA 3K2IA 4E5DA 1RBQA 1JZTA 4IVPA 1CZKA 4RHUA 1V1JA 3DVLA 4A36A 2KMLA 4ER3A 1RP7A 4FUQA 1J0EA 4XFKA 1ENYA 2QRLA 3SYKA 3IV6A 1QB8A 4U9UA 3BTVA 3EWSA 3GNQA 2IITA 2F9LA 1MO5A 2I7TA 4OHBA 4YXWA 5JSKA 2XTNA 5EJ2A 2JVKA 3LQ4A 4M99A 3MJFA 3I2FA 4D3ZA 4E03A 4OYYA 1TMKA 2X7HA 1CRWG 5D7NA 5F52A 3Q0TA 3HDHA 3S28A 1M73E 2EFGA 5H82A 4XJXA 4DANA 2WJHA 2YV4A 1XCMA 4AJPA 4C87A 3GH3A 4QNNA 3Q7QA 1JQAA 3W05A 1YMQA 1NQVA 3TRIA 1Z5UA 5JS6A 4UW9A 1JEAA 2HMTA 1WXQA 4MLCA 1IK6A 3GLFE 3VR1A 1KEUA 5GOTA 4GUDA 1VL6A 2OZPA 2CNKA 3G68A 3G8DA 3DTTA 3NT2A 4AI6A 2IEZA 2LKCA 4US0R 2E4UA 5GIOE 3N8KA 3IPYA 4ZPXA 4C1NA 5KWIA 5AK3A 3JQRA 1GGKA 1NJ6A 4YCSA 1N5RA 1S3GA 1M1YB 1UKEA 2HXYA 4ZVTA 2PGOA 3ANYB 3A27A 2ZSKA 1VXOA 3HBLA 3K8OE 3DQQA 4J7CA 1WF3A 3G9QA 5JRDS 4YR9A 1NZDA 1U3CA 3VBCA 4KRGA 5CT9A 4OG2A 1YE3A 1FP4B 2O3SA 3GB9A 3IDSA 3H84A 2BDTA 2GN1A 1KYVA 3DZ8A 3WOHA 4EG8A 3ZDCA 2OZKA 5CX4A 1CPYA 1SBYA 2E89A 2SCUB 3BQ9A 4OA5A 5HMMA 3ROQA 1SBQA 1XQYA 3A1WA 2SICE 4PVCA 4ZDJA 4ZQFA 2YUTA 4BPRA 2J3HA 1FX0A 1KQ3A 4JI1B 5HS4A 5C5CA 2G07A 4ZWNA 2IW3A 2P9TA 4W4TA 5AM3A 1R1DA 5HILA 2POQX 2ZG6A 1DX9A 2PIAA 1JR3E 3OIGA 3LWNA 4DADA 1UK6A 2EBHX 3EK2A 1X19A 3BREA 2VPYA 3FZNA 2YJ6A 4N9WA 7REQB 1GL6A 5EMHA 1ISJA 1BJKA 1CQIA 5AI9A 1R4NA 1VE9A 3VOSA 2FPPA 4ZZ3A 4YAEA 2FY8A 3CPSA 2VYND 3C3XA 3TG8A 2EZ9A 4W7HA 5DX8A 4YRQA 3DM5A 1UPXA 1E2IA 1SVOA 2UZ1A 3Q8XB 1GNLA 2KYRA 3VDMA 3ZJVA 3QVTA 1PFGA 3CSDA 2W2QA 2WZBA 4XGRA 3CF6R 3PFHA 3PCXA 1J6UA 4EGFA 5IRCD 5ALQA 3HL4A 5A4AA 4OUDB 4QYTA 2JARA 1S2OA 4M9XA 1FBNA 3WRYC 1Q0TA 3DFKA 4PU0A 1NHGA 4JKIA 4IIBA 2JAUA 2AFHB 4KN5A 2GPBA 4IF4A 1XWWA 1K88A 2Y1CA 2OCKA 4H1HA 1L5FA 1EJBA 1G8FA 1PT6A 2G8LA 3H2IA 3QH4A 4EKNB 3ABZA 3UK0A 5LPNA 1CYDA 1QG4A 2VTDA 5ICFA 2KX7A 4QLBA 5BSHA 4ZMBA 1WZ2A 1O5IA 4I6EA 4HYYA 3FYUC 5D3MB 3F7MA 5SZKB 4MI9A 5FPKA 2IHKA 3F98A 4JLPA 4RF4A 1XA4A 2X7XA 2PRSA 1WB6A 1TLFA 3NIDB 2C3PA 2Y2UA 1W29A 3A3KA 4XEHA 4DA0A 5BWNA 1BFKA 3BGIA 4MGKR 3TGWA 3OQNA 1HFKA 4Y1RA 3I0NA 4D9IA 1YOBA 1C7FA 4DF3A 3DDZX 4X20B 5EI5A 2EHDA 2JCYA 2RK3A 1X1RA 2JCXA 2YN4A 2RHOA 5BUQA 2O19A 2OL4A 4LNHA 4QAJA 5K0GA 3QFTA 1YB7A 2YQ4A 3IIIA 1W4CA 1JVBA 3UWSA 4EHIA 1RNLA 4K7JA 1UKYA 4BB6A 3QKIA 4QUEA 5CD1A 5EHQA 1W4RA 3TDNA 2O8FA 2FEAA 4WBSA 1ULTA 2YN2A 3IQFA 4L8GA 2CNWD 3W9YA 3UJDA 3KSRA 4DBLE 3JAWA 1ICIA 2ETVA 4BMDA 3O84A 2RC6A 1BS1A 3RYTC 2FZGA 4HAXA 4XWYA 1E32A 1I8TA 3BMXA 1G5QA 4FGLA 4IRXA 3RTBA 3WXMA 4C29A 1KFCB 5J4KA 3HACA 2FOLA 4ZI7B 1ISFA 3VR6H 1G9TA 3D6VA 5GV8A 1T3ZA 5AW2A 5KDLA 2XCLA 2D7CA 3EARA 4ENSA 3AL3A 3ANNA 3KKZA 4RVGA 1WMBA 4OI1A 3BHIA 1AF7A 3TTWA 5L4LA 3HBFA 3HUEA 2YV5A 4PIVA 4CRWB 1YNOA 3I0MA 4H35A 1U8TA 1Y7HA 5DBIA 1NQAO 1Z6XA 2ZM6B 4CG2A 4HVLA 1XLUA 1ZD3A 3FMPB 5DYWA 4NXMB 1TAUA 2W4QA 1CIPA 3OP4A 5LD2C 4WNIA 1BDHA 4LJ4A 2WIDA 4GX1A 2FZLA 2A94A 1V41E 1GTSA 3DWIA 1WDLA 3IOMA 4PXSA 1ODKA 4HXYA 3L05A 1U8XX 4G9EA 3V8BA 3GEPA 1RJ9B 4LSGA 2H1CA 1ECCA 1PLJA 2QX4A 1D1SA 4LDQA 3R7WB 4CE6A 2O8CA 1HG1A 4A1FA 3CKKA 1FFEA 1G6HA 3E8MA 1HT2E 3A31A 5C31A 3M2PA 2FFQA 3WK6A 4AUEA 3ADKA 1RXYA 1KDOA 4Z54A 1RAGA 3D8TA 1VJRA 4LQLA 4IKEA 3OO0A 3T94A 5ECGC 1RLIA 1KY4A 2IOHA 3JAKB 5EUBA 2WJAA 5HE8A 2YXNA 3VX3A 1SY7A 2H1FA 5LYYA 1ACMA 3ONWA 3ZLUA 2HPVA 4GO1A 1T3LA 1VGQA 2H07A 3M4NA 3D8NA 3DAYA 2GD0A 4D43A 2O7VA 4EWLA 1KH3A 5DYGA 1YDWA 1NBHA 4JEUA 3MMNA 1L5QA 2QJFA 2IYAA 3OZAA 2WIGA 4B84A 2EZ8A 4N47A 5H8WA 1T8PA 4HZUA 5J4YA 1F17A 2XVYA 4YQZA 1HSOA 4PLFA 4J0KA 1ESZA 1BD3A 1VHDA 1GFIA 1HC7A 4K9DA 1GDHA 4Y0VA 2A1UA 2VQ6A 2C77A 4OCZA 5E4YA 3SHQA 4XVUA 5KWSA 2GEKA 2P9ZA 4CM5A 1BMQA 3PL5A 1W44A 4AKEA 5DM70 5U1PA 4H6PA 4KN6A 2BFFA 2SNIE 4F5WA 3COSA 4AQ7A 4JBLA 2P9HA 3KIPA 3RABA 2HQ1A 2UYGA 2FWMX 4KOAA 4WXEA 4OP1A 3U4IA 3WLJA 2J9RA 2VK1A 1LWNA 3BD9A 1RYFA 3BQNB 4HEHA 4MARA 1KA9H 2EZUA 2BTQB 3AMVA 3KRTA 3RRFA 5K6AC 4N3AA 5JFOA 2GRAA 5KOJA 1GL9B 4YACA 3T1VA 3O6VA 4BO2A 3DEJA 5IFKA 5ISMA 3H5IA 4B8ZA 3ONNA 4D9FA 4V0MA 1NUUA 3JZMA 3AZOA 1G5HA 2VKQA 4LY0A 2QR5A 1YZLA 5HGJA 1U2DA 4G0WA 3CWZA 1ZLYA 4Q4JA 3NH6A 4CU5A 2E37A 2BGLA 3DDSA 3OTQA 3AOEA 3WL6A 4BLSA 1KEZA 5DNCA 4Y1EA 1I80A 1Z07A 3QXSA 3E84A 2VHEA 5AKZA 4V0KA 4OBBA 4OK6A 1RHRA 4QC2A 2ZRMA 2QNRA 1Q3TA 3H86A 3R44A 4IMIB 4YMIA 2CVQA 3KM0A 5CLQA 3V8EA 3R9WA 1Y9JA 3D8RA 3MMPA 3ZNNA 4RAOA 1OU0A 4RXUA 4QXRA 1CY4A 1JHUA 1BN6A 1E3WA 2E4VA 2ZRLA 1IHXA 3EZXA 3PCTA 1JKJA 4JYCA 3SK0A 5HJEA 1VDZA 1BE6A 3PD7A 4AURA 4ZOLF 2ODQA 4LF5B 4CMIB 1BFUA 3DPUA 1XAGA 3HGQA 5L3SA 1UINA 4D42A 5FNVA 2Y4OA 3GNTA 5F35A 4CTOA 4KR9A 3IOEA 3IUSA 3PC7A 3CZ4A 1XK7A 1IN8A 3QLUA 5BRAA 2ZWMA 4QFCA 3NTVA 1WP9A 5B53A 1RS0A 2VYFA 2QTRA 3ROXA 3P96A 3O2QB 4EUHA 5JJ5A 1NW3A 2B99A 5HJ2A 1Y1LA 2G1UA 4I36A 1ZIYA 3OZSA 2GUWA 1NKVA 4ZYUA 3TZ6A 4AY4A 1V0JA 2E4YA 3NCTA 1BIFA 4JQCA 3B2EA 4JGIA 3VR2D 5EERA 4OH1A 3ADPA 3Q3HA 4N40A 2MCFA 1OILA 3IEUA 3LT1A 3X1XA 4DMCA 2G4LA 1OC2A 1P3Y1 1R10A 3I1IA 3E7DA 5IJWA 4HOYA 4XJVA 1NVVQ 3X43A 3DH0A 1RYMA 4R3NA 4D99A 2FEOA 3ZLTA 3VH4A 2R6HA 2WYVA 3CWQA 4CKCB 3IAEA 4L85A 3NVMB 3TIGA 4YJGA 5KOHB 1LNZA 3N87A 3FMVA 4TL7A 3S55A 1K06A 5F2OA 4BX2A 1BXRA 4LJ9A 1J4AA 1QGOA 1LPBB 2JLSA 3UGQA 2QI9F 2E1PA 3GLHB 5U4QA 1V1MA 3BH6A 4G23A 3UT6A 4ZT4A 4UE3S 2PHZA 3TIVA 3WNQA 4XR9A 1ZBQA 1EUQA 1ZUIA 4UTOA 4PNEA 2ATCA 4TYNA 3GXBA 3RH0A 4L6AA 1PR5A 3EGVA 3JY6A 4IGKA 5BWBA 5K3EA 3OOHA 4R9SA 4BCCA 3BOSA 2HMSA 1XZPA 2VOEA 2F8SA 2QBYA 1JSRA 1P33A 1I6KA 2FPUA 3D7LA 1F4LA 3D6TB 1BWQA 3LZCA 4FPXA 1V95A 2N46A 4JQSA 3KQHA 3CX3A 1H6AA 2XXAA 3TZHA 2XQVA 4XD7A 1XRLA 4Y0AA 2WU0A 3L7BA 1GYPA 1L7AA 4HNAA 1EAYA 3OQPA 4QUDA 3T3PB 1VSUA 1FIUA 1FNCA 1GAEO 1YDGA 4F8YA 2WQZA 4WK2B 2V7WA 1DARA 2MR6A 4BO0A 3JQ7A 5JADA 2V5AA 2ID8A 4KQ1A 2ZFUA 3VYWA 3W4IA 2DHCA 1WY5A 1Z15A 4F45A 3N28A 2PZJA 4E4YA 5AKJA 2FFAA 3BE8A 4RW0A 3TXXA 1BCRA 5DI9A 2JD1A 1ZCAA 5A1JA 2X42A 1EIZA 3UB2A 3DMDA 4EMUA 4MDEA 3S2UA 1ZSVA 4AAYA 2WVJA 4G36A 1K66A 1U2ZA 2GK3A 2YFHA 3TKLA 3VOBA 1AD2A 1YIOA 3UWDA 3QE2A 1EFUA 3TLXA 4K87A 1J56A 1FZQA 4BXOA 3E3AA 3SI7A 3CEJA 5FL7D 2F59A 2YOHA 3E5MA 3H6HA 3NH9A 3GYGA 3ACCA 4II3A 4LJ5A 2FUG1 1VOTA 3KSZO 1Z5OA 3OIDA 3PTAA 1O2DA 5KTPA 1LPPA 1IB0A 2DWOA 2BW0A 2UYOA 2PZ8A 1NUPA 3U7RA 2OYCA 3LPMA 1IIBA 2EWWA 1O4WA 4AZWA 3B1VA 3U4HA 5AQ1A 4FZJA 4IHJA 3JW8A 5FAXA 3U39A 5JBNA 5EESA 1WSDA 2RHCA 1JQLB 1SKQA 4CGZA 3TUZC 4QT4A 3U7HB 1P29A 2C78A 2PQ0A 2Q0QA 3DDOA 4LC1A 4YAWA 2Q4OA 4GI2A 1OW3B 1FFAA 3KQQA 3UQYS 4OQDA 1YCDA 3FNBA 3SN6A 1S5PA 1AKRA 2H59A 3EASA 3IIEA 1HQKA 1V5FA 3KQVA 4HLQB 4OXXA 5EWJA 3CBQA 1FU4A 1VL0A 1T8RA 1BX1A 1PQWA 5T64A 4WOJA 3I37X 1XMQB 1YRLA 3CLVA 4H9GA 1ADGA 2D2VA 3L4SO 2ZANA 1UXOA 3Q2KA 2P7HA 1FVHA 2YJTD 2VHYA 4NOMA 1MOZA 4TXMA 4ZQHA 4FYXA 1ODFA 1YA6A 3IVRA 3EOAI 4DRXB 2ONYA 3SHTA 4NPAA 3EBOA 2FEKA 2RKBA 4U6NA 5G0SA 1ADCA 3G0OA 2O4UX 3NTXA 1AUXA 1E61A 2O1SA 3HO1A 3IO3A 1DRVA 3JZDA 2HFJA 3WLEA 2C5AA 2OAGA 4UOEA 5CFMA 2BR4A 3ZR4B 1XU4A 2Q3LA 3ZKAA 1TVKB 1RJDA 1WMFA 1A2QA 2JIDA 1MLDA 1U6JA 2P6PA 3GFGA 4IO1A 5CDGA 5ELMA 4CI9A 3WS7A 2ZBFA 1RXWA 2QUBA 4MWTA 4PGGA 4LFBB 3RRXA 1Z2EA 2PBZA 2R47A 2JIZD 4FOTA 5A6VA 2O5EA 4N0DA 4QNMA 1LDMA 2X8AA 5EP2A 4NQZA 3TLYA 3LHFA 3RC7A 5M34A 3LBFA 3M89A 2J7PD 2J48A 3UWKA 2OVFA 3VZQA 4KFUA 3E7PA 4YP9A 1AOXA 3SZGA 2BKAA 3ES9A 4QDJA 4B3GA 5AXCA 5J1SB 3RE1A 5LU8A 1I2DA 4YAFA 1E2QA 3HDJA 1G64A 1QGUA 3TFWA 4CM8A 1M7BA 3LIPA 4JT9A 1P19A 2A9PA 3IKLA 3QUTA 4CCWA 4YIHA 3C5CA 1P62B 3IOCA 2DGDA 2VT3A 4GFDA 3ECAA 1HDEA 1T1RA 2ZWPA 4HTFB 3BFJA 4LVUA 1XOIA 5LM3A 2NSLA 1OXXK 1SC9A 2W2XA 2X4LA 3HRIA 3M83A 2HDNB 4RVOA 2ZRHA 1A9SA 1SOVA 5CMLA 1I01A 3S44A 1R0ZA 4GGOA 2EYUA 2A88A 3TSAA 4CUZA 1T2NA 2GEDA 5CDHA 2ENWA 2FXIA 4M38A 1GSIA 3Q3JB 5TX7A 3BF7A 3QWHA 4LV6A 1FNDA 2VP5A 3VHLB 1WMSA 2GEUA 3EQ6A 2VWQA 4PAGA 4EKIA 2O48X 3D6JA 3DWGA 3LK6A 4C76A 4BKUA 2XPCA 4MQEA 5LN1A 4TT3D 1UEXC 1Z06A 3FJYA 3NHJA 1OI4A 4RQBA 2XBMA 3HP7A 1KDYA 2JLYA 4I7EA 5E3IA 2J3DA 1B73A 2WOJA 4KPEC 2GPYA 4PCLA 1NNUA 1ZNQO 3PIIA 1NE7A 5TB5A 2VP3A 1D2HA 3FWKA 1CQIB 3NGMA 4L7QA 4GI7A 1DQPA 1LF5A 4YHBA 3UHJA 3GFSA 1DNPA 3K2EA 3OF2A 1OUMA 4L5BA 1FVXA 5CIYA 3H1EA 1F3LA 1JEEA 3IP9A 2W58A 1WXWA 4LRUA 4OJQA 3I6IA 1V35A 4GMDA 3DJFA 4R1UA 2FEPA 1AC5A 4EB3A 5C7YA 4EA6A 1NLZA 1HKUA 1XZEA 4N8SA 4F11A 2NWQA 1PWEA 1WO8A 5M2QA 3H8VA 3UFXA 1B16A 5BP7A 1HKHA 3DHNA 4M3NA 1T0JB 1SU8A 2IHVA 3PE4A 2IUFA 3FZEA 4PNHA 4JOQA 2Q3HA 2B1JA 4X85A 2FGJA 3T54A 3VHQA 8LDHA 4WLFA 3L93A 2V8OA 2DKFA 3IA2A 1SC6A 4BU1A 1WEKA 1JYFA 1TIPA 2BM0A 2EFDB 4KH0A 2AD5A 3OKCA 3RYIA 2MMCA 2G17A 3COVA 1ESDA 2WV7A 4LC0A 4TV9F 1DCKA 1SC4A 3NOXA 1DINA 4XEUA 3WX0A 5KVVA 3NBFA 5LL6P 5AVJA 4CMEC 1KO5A 1PL8A 3L6BA 5K1ZA 1OVMA 4Y1RB 3SEAA 4FHDA 2JK1A 1GTG1 4RVDA 1C8BA 1JR3A 3NHLA 2VUTA 3ORYA 1X0XA 3LUCA 5KKAA 2VDOB 5FBHA 4O4HF 5KAMA 1QE3A 2ZJ3A 4TQ9A 5JQWA 4IIGA 2GCEA 3DBIA 1GQ2A 1LQ2A 4PV7A 5IUJC 2HKIA 3RSSA 1MOQA 5BSKA 1EWTA 1K8ZB 3QPCA 5D3QA 2O8FB 3LFHA 2PYZA 3F9CA 1L4YA 4I46A 4DLSA 2YUIA 4U2KA 3I3SR 1G2OA 5REQA 4PLHA 1BSVA 4LRTB 3WNZA 1CJBA 5AVWA 3G7UA 4F6CA 3AR3A 1J2EA 1PF7E 4EYSA 4GMHA 5JD4A 5BUZA 3C6QA 5KBYA 2EBUA 3KOWA 3IAFA 4CKYA 1TB4A 1RKUA 2ZB3A 1P9NA 3MGAA 4PGMA 5KKNB 3F6SA 1TO6A 1U5BA 3K1ZA 4DHWA 5HRCA 3AWIA 2IY7A 3IQHX 1BVUA 4QGHA 4E11A 1WZEA 3GLIA 1G41A 1SC1A 3GZJA 4XQ0A 4YRNA 1RXUA 4IW3B 3HYRA 4WCFC 5KYUA 2XRYA 2WG1A 5E2AA 2NP6A 1Y3FE 2AC2A 4PZAA 2D13A 1X9IA 2O6LA 2W5UA 4E3WA 3ICOA 4WZBE 2Q9CA 3KZMA 2D1FA 3GMSA 3UNXA 1J97A 2IU4A 2NVBA 1Z2NX 5M04A 3E9RA 3QHQA 3EFEA 1YZYA 3QNUA 1P5ZB 1SELA 2I3BA 2WPDA 3FNQA 3RBXA 3TX6A 5LYJF 2UUOA 3ZJTA 4QEZA 1ZKDA 2XXBA 2CXNA 1A5BB 2VDMB 4WKGA 3P0JA 5TQ2A 2CK3D 2P2ZA 5AW0A 4O59O 4E13A 4INPA 3ND9A 1XELA 1KFEB 1SR8A 4NARA 4OHCA 1RVV1 3F78A 4IIJF 2HREA 2A9JA 1B8VA 3LP8A 4MWEA 2PMEA 2VEDA 1SU4A 5K09A 5JNVA 4BYMA 3I9OA 1QTNA 1R5JA 2ZIXB 4PPYA 3SXJA 1E20A 3AM3A 3GL9A 4OQEA 3U31A 5JHGB 2QGFA 3IEKA 4D3XA 3E7XA 1OFTA 1WWKA 3GR6A 3JZIA 2KSQA 3MJRA 2YXEA 2GK7A 2Q0SA 2W2OA 4PTZA 4HLNA 3FBGA 3AF1A 3HCBA 4C7JA 3HJHA 3QYJA 4Q1CA 2VUUA 3UUEA 2J0VA 4RPHA 5C80A 2HMYB 3G23A 2C31A 4L22A 3SD7A 4DGQA 1D2NA 2JANA 3E15A 3LCMA 4EUSA 4BQIA 3AM5A 3FLAA 4QXPA 3KTFA 2DE0X 5J3JA 2GM5A 4HZUB 1G4UR 3C7KA 1QRAA 2DFTA 5IJ9A 5HQJA 1AA6A 4WINA 3SP1A 3TI9A 3J80A 1MAAA 3PIDA 1PS0A 4TYYA 3JWJA 1DAGA 2A1UB 3ZXIA 1ZN2A 4UM9B 1W5EA 4PHGA 2D3TA 2I71A 1B8UA 5AI0A 4AICA 4AMUA 4EHFA 2P75A 4QT0A 1EZZA 4IVNA 3EBLA 2HSJA 1HYBA 4NFHA 1P0QA 1U3VA 4ALKA 2ABWA 4CKWA 4GKJB 1T3SA 2QMZA 2DY0A 4QREA 1WB4A 5DH9A 1PCXA 5FTJA 1AKYA 3ZBUA 4AMBA 5F98A 4FINA 1LZKA 1IBSA 3F2VA 2QTWB 1ILEA 1GV0A 3GJTA 5KOJB 4E22A 4BGVA 4GMXA 4I3GA 5FCDA 4F3CA 4NAUA 5HIIA 3L4KA 1HO3A 2ZIVB 3T4XA 5I7OA 1N8SA 2UVDA 3K35A 2GN6A 3MF4A 2WKSA 3FVTA 3JQEA 1KJIA 3MLAA 2Z83A 4U9IS 1KJYA 3RGGA 2ZRPA 2BJHA 4Q4JB 5ECWA 4AG6A 4MEJA 2OCDA 4MKFA 2DHRA 1NUQA 3BD8A 3MWDA 4MR7A 4YQFA 4H15A 4Z8YA 3TLGB 3A4VA 3IO5A 2ZJ7A 3DCJA 5L3QB 5ALXA 1EDEA 5LQDA 4ENQA 3X1ZA 1YC2A 4O4JB 3WGVA 5HUHA 1K0FA 3VKFA 4ITUA 3ROKA 3N6RA 3P19A 4KYTA 3PE3A 4X64B 2CBGA 4LRWA 1RBYA 4EPWA 1LDYA 1TD9A 3BULA 1E3WB 3D7KA 3G88A 3SNHA 1T5IA 4EUEA 3FHTA 1IZ7A 3ACBA 3VTKA 5A3QA 3ZXXA 2RGBA 4HX9A 2AI1A 2OC9A 3K9FC 4OLBA 3INRA 2OQIA 4FKMA 4H7EA 3GVCA 3TKYA 5T4EA 2F1KA 4NBRA 4L2IA 4FFWA 4QYSA 5AVVA 2FUCA 1KZ4A 5I4BA 3CINA 1JKXA 3CVUA 3STUA 3UYKA 4DL9A 4BLPA 4YDSA 3FYDA 1R0RE 4II2A 4MPDA 3DAPA 4Q4CA 3OZRA 4AXXA 3JQBC 1ELOA 4Y7DA 3P27A 4MS4B 4R9RA 3OHPA 4Q9AA 3T7IA 4U7PB 5C18A 2BEKA 2JZNA 2OGUA 2Y1LA 1RQ7A 4JBGA 1TK9A 1ZCZA 1S3FA 4N9QA 2ZRCA 1KNQA 5C51B 5DHUA 1SVIA 4RH3A 3OA0A 3LXMA 1XVUA 3UV6A 2P2NA 3FR8A 2VQSA 4DWJA 2QTZA 3L6RA 2W6ID 3IMKA 3SSMA 3EJWA 1DQNA 4IZOA 1K92A 1IUKA 3HVIA 3RHZA 2Y1WA 1H4TA 3MWEA 4KIFA 1KE2A 2M6SA 3DVRX 2WV9A 1U8EA 2QRVB 2ZB8A 2GRJA 3OP1A 2C92A 3VSAA 5CVTA 3DEKA 4LGCA 4YJGB 2A4KA 4QGGA 4QXOA 2JFXA 3G9UA 3W2GA 5AVRA 1WE2A 2WT4A 4JQOA 1AS3A 1T1JA 2HUPA 2CDRA 4O3FA 4TV8F 4BGIA 4BVJA 1U7DA 4DMLA 4X3CA 1DX4A 2YMMA 4X66B 1D4OA 4RLSA 1V1MB 2CW5A 3UM9A 3PFKA 2DC1A 1RJWA 3ZXUB 3B6KA 1QU3A 1LPSA 1CUJA 3TYXA 4FGJA 1TVEA 1U2RA 4GEKA 5C46F 5IEJA 5HDBB 5G4KA 4JN6B 3OKPA 4LE2A 5CT6A 2AUTA 2OTCA 3BWYA 3OQ6A 3WQBA 1RC0A 1XAIA 3FLEA 4MP3A 2QBYB 1N5DA 3WZLA 1ABFA 1I9CA 1DTWA 1VECA 4GD3Q 1VRCA 4OLJA 3V4VB 3ZWAA 1T5SA 2CYAA 1Q44A 2LIVA 4JGGA 3RSQA 5JAPA 1J06A 1WCV1 3R24A 2R68A 1E62A 5FADA 5KNLA 4TMZA 4JP5A 2XXAB 4BN0A 1GPKA 1JDUA 1QRRA 1JXAA