4FIDA

Crystal structure of a heterotrimeric g-protein subunit from entamoeba histolytica, ehg-alpha-1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
334
structure length
317
Chain Sequence
KPITVMLLGSGESGKSTIAKQLKILFGGGFPEQERATHKSSICSNVVTCMRTLIEQSAILNHPMKYQPKSKEFTTEDPVTLPFSPELVGDVEALWADEGIQATYEESAKFQLPDCAKYLFENVKRIAMEDYVPTEEDLIHNRTKTTGIHEYDFVVKDIPFHLIDVGGQRSERKWVSFFSDVDCAIFVTSLAEYDMKLYGNTSRLTESIAVFKDIMTNEFLKGAVKLIFLNKMDLFEEKLTKVPLNTIFPEYTGGDNAVMGAQYIQQLFTGKLQTEEMNIEKVYTNPTNATDGSNIKRVFMLAVDVIMKNMAANGKMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Heterotrimeric G-protein Signaling Is Critical to Pathogenic Processes in Entamoeba histolytica.
pubmed doi rcsb
source organism Entamoeba histolytica
molecule tags Signaling protein
molecule keywords G protein alpha subunit
total genus 85
structure length 317
sequence length 334
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 4fidA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4fidA01
2NZJA 1CR0A 2DCUA 3T5GA 3CX6A 3A4NA 3MWJA 1E2PA 5FPSA 4GDFA 4HLUC 4Z1MA 4PZLA 1OXVA 1VYTA 3HYRA 3TGPA 2OLKA 3F8TA 2JLXA 5ANRB 4TQUS 5KU1A 4TTPA 3P4YA 5G3ZA 2FX3A 4JJZA 4BPBA 3CF6R 1IJFA 2R2AA 1U0HC 3VAAA 2ZI9A 1AM4D 3LBHA 2EU8A 2CVHA 5EXXA 4RD1A 1TEVA 5E7JA 4ARZA 3KDSE 3QXCA 1EWQA 1AK2A 2WWHA 4US0R 4ZDKA 2ERXA 2ZE6A 2NQ2C 2J7PA 2XJ4A 3CH5A 1S2MA 2AFHE 2QPAA 4B76A 1Q44A 1NVVR 4ZKEA 1NF3A 4A2WA 5C46F 1ZYUA 3THOA 3CONA 2WAYA 1BYIA 4TL8A 4LWZA 1BYUA 1KI2A 1ZM3A 1VIAA 2IYLD 4X8MA 4JJKA 4LK2A 1P2TA 2CJWA 4KO8A 3WP0A 2ZSFA 4DCUA 3LLUA 5DNYB 1HT2E 1U8ZA 2AFIE 3KB1A 1AZTA 1UAAA 4MDEA 1ZCBA 1HH4A 3UATA 2B7BA 1FNMA 4PO9A 2WVJA 2R8RA 5AJXA 1M1YE 5CLQA 4US2R 1FUKA 3NHAA 3HU1A 4N3NA 1DVRA 1YVDA 1U8AA 1U94A 5KTYA 1FPMA 5EE3A 3KKNA 5H1YA 2JATA 1W7AA 1E9CA 1QHXA 1SKYE 2G0TA 3QE0A 3WMGA 2PX3A 2IC5A 4NL4H 2EFDB 3BERA 5AJWA 4XVQA 2GEUA 2ZRNA 3BBPA 3KQLA 2QP9X 4E5UA 3X1ZA 5LB4A 1XD8A 3MLEA 1UF9A 4WOPA 4XTCS 3GLGB 4BFWA 1NLYA 2ZTSA 1HT1E 1VCNA 1H8HD 1FP6A 2ODBA 4WZBE 4B2PA 3A8TA 4D0NA 4B34A 2WV9A 3K9LA 5IT5A 3MWLA 1TNDA 1EESA 1N0VC 4JVMA 3EPKA 3GJXC 4FCVA 1YZQA 2OFOA 2IXGA 1OXXK 2BCJQ 2GXUA 2VEDA 4OHYA 1ZW6A 3ZYCA 3QNUA 1US8A 1EG7A 4NYMQ 4Q00A 4JLJA 1XTKA 5DO9A 1F48A 2JIZD 2VHTA 2VP9A 1CF4A 4LJ4A 2QAJA 3BB4A 5KSOA 3C16C 4M1SA 3RANA 3A58B 4NCJA 4OQXA 3K0AB 4AYWA 3KZ1E 4N0DA 1MH1A 1E0JA 1HUQA 1GAJA 3AKDA 1R0YA 4XWAA 5GVSA 3TR0A 5JBQA 4WW0A 1Z63A 4FWIB 4DT1A 5BYKA 1Z2CA 4OQMA 4KYIB 2QM7A 1W36C 3RS4A 1P2SA 1S4QA 4F4CA 1X1RA 1Y63A 2ZJ2A 4XSHA 1E2FA 4KCGA 4NP6A 2QTFA 3SJCA 3T15A 3MCAA 3TE6A 5AJVB 3HYTA 3WNDA 3X1YA 1E2GA 1XJ0A 4KODA 3DMDA 5JWRA 2RMKA 2ZUDA 1H65A 3E70C 4PC3A 2FFAA 3AF2A 3TJZA 2A5DA 4I1SA 4JLPA 3DPUA 2J9RA 1KAOA 4BLRA 4QHYA 4L9WA 3U7FB 3NDPA 1IY1A 821PA 2CMKA 4UXHA 1KMQA 1KZGB 5AUNB 1CU1A 2A7QA 3AH8A 2AKAB 2N46A 3L0SA 2IA5A 4AKEA 5CITA 5F3WB 4D6PA 2IYRA 4H9GA 4V0LA 1XJCA 2GXQA 4A0RA 1E94E 2F3RA 4TYPA 1DADA 3MFYA 2QAGA 4QG7A 3P1JA 4DIEA 2PZEA 3B82A 3DMNA 4RKFA 3D31A 3WMEA 4WZ6A 1Q20A 5EP4A 1G8YA 1JJ7A 2V7QD 1PLLA 1CR1A 1E96A 3FVQA 1Q0UA 2P0EA 1AIPA 4BWYA 2QP3A 1UKYA 4A4DA 4Z51A 1NVVQ 1SXJA 1F60A 2OXCA 1VHLA 4A2QA 3ZD6A 3AVUA 2HF8A 1Q1QA 4RD2A 1TU4A 1IQPA 4RZ3A 1MOZA 1HE1C 1XEWY 4Q9IA 4PHTA 2ZPTX 5J4HA 4C2TA 3VR2A 4GP7A 3ZQJA 2E1RA 3CWQA 2O0HA 4XJXA 3OFND 5IK2A 2WKPA 1IBRA 4LYFA 4OHVA 3NDBB 5E4FA 1E69A 3RAPR 3W5IA 2Q9BA 3I8XA 3K0FB 4OHXA 5CIQA 1W4RA 2O8DB 3QKSB 3B1VA 4JZKA 1P6XA 2IL1A 2ZYTX 1A82A 1GSIA 5D3MB 5DI3A 1KI7A 5FTNA 5HE9A 3UG7A 2FMXA 2V6JA 2WMNB 3CRRA 3W8RA 5L3SA 3T5DA 4P3YA 4HSEA 3VHXA 3OEED 3AVVA 1T8TA 4X8OA 1P2UA 5L3QB 1QHGA 4O3MA 2VIIA 4RVCA 2C8VA 3A1TA 4LV8B 2EYUA 1E6CA 4LBVA 2PJRA 3CF2A 4LJ8A 4JSYA 1KI6A 2YC2C 2XITA 3AEZA 4AKHA 1TQ6A 1JAHA 2DWOA 3QBVA 3AVXA 5KDLA 1C1YA 4WZAE 3QSYA 2J0VA 4D4LA 4DCNA 4R71A 3R9XA 1RW4A 1Z6TA 4C7OA 1CIPA 2V1UA 2GWHA 1CBUA 1WF3A 2VLIA 3TRFA 1RFLA 3NTUA 2WTUA 1P61B 5JI2E 1OPXA 4IHQA 2BM1A 2RGAA 1CR2A 3AVWA 2V54A 1FTSA 2OCPA 4KSBA 1GKYA 4NPHA 1U9IA 2IEYA 2W6ID 2ZXUA 3GP8A 1B0UA 4RY2A 5UKDA 2EFGA 3RRMA 3NH9A 4BFYA 3OEHA 5K8UA 2PZFA 4PQFA 4Q9HA 4PAMA 3VNVA 2QTVB 1R5NA 3UK6A 3QKTA 4C0SA 4D4KA 3SNHA 3CWZA 5FTLA 1U81A 2VO1A 4A6XA 5FOSA 3GJ7A 4YXWD 1X8KA 2A78A 5KSPA 3WY9A 2CE2X 3EARA 1SGWA 1CJMA 4EPVA 4M9ZA 2PMDA 1ZD8A 2G3YA 2QE7D 1XFAA 2R6AA 4G5QA 4WA7A 3NIBA 4GZLA 3DOFA 2GJAA 2CE7A 5JEDA 5KNBA 2HT1A 3CO5A 2NTYC 2XOKA 1G5PA 2OCBA 2D74A 1Z83A 1UPTA 2NGRA 4KLNA 4OK6A 1MRNA 3FFAA 1NY6A 3AF3A 1EFHA 4Q4AB 4B47A 3JZMA 2BDTA 2WWFA 4BFSA 1TQ2A 4RD3A 4CEIB 4ZDJA 2ZRHA 5C4MA 6Q21A 1A4RA 1VIYA 1KNXA 1ZCAA 1VG1A 2BCGY 3AVQA 4ERNA 3B5JA 3H84A 4BFXA 1D9ZA 4LYAA 2GXAA 4OI0A 4URVR 1DPFA 4PC1A 4U5XA 2HCBA 1IJEA 2V55B 4O2LA 3S1AB 4MYHA 4Q5IA 3QBTA 1IAQA 4YMWA 2AL7A 4EDHA 3B9QA 2LKCA 3EZ7A 3IHLA 3VKWA 2ZRGA 2V8OA 3SE0A 1EX6A 2OSBA 4NMMA 3VKHA 3RHFA 4FWTA 1EXMA 1S3GA 1E9AA 5HCNA 1SVOA 2ODEA 5FPYA 4PFSA 3CPHA 4YDSA 2CCGA 3T1VA 1NVXQ 1IN8A 5DLQC 2F55A 1M7GA 3KTAB 4WIAA 4AIIA 4V0KA 1VCIA 2WWXA 2P2LA 1Z0KA 1OT3A 1OF1A 3H0KA 1LTQA 4OHWA 2CK3D 1DEKA 3TAHA 2FDCA 2J3EA 3K70C 2WSSA 3SBEA 2QMEA 3GJ0A 3TH5A 1XNJA 1FNNA 3TSZA 2DPXA 2HLDA 2ZJ8A 1FTNA 2PLFA 4TZ6A 2X2EA 3X1XA 1NN0A 1OYWA 1XWIA 5B58C 2O8FB 4Y0VA 3ZVMA 5FR1A 2WJYA 2AN9A 3C4JA 4IVRA 4TMZA 2DFLA 2C9OA 3U61B 1RJ9A 4GNKA 5C2JB 1G41A 3CRW1 4HAYA 4DCSA 3HPQA 1OH8A 3DO6A 1R5BA 4UNSA 2PX0A 2ZRJA 3TVTA 4KAXA 4ESVA 3UMRA 1M7HA 3K1JA 4BFUA 5TMPA 4B35A 1BS1A 5BW8A 2KWIA 3WNBA 4Q4JB 4I1VA 4RFSA 2F9MA 2G88A 2WPDA 5B2ZA 1KGDA 1G7SA 1WXQA 2F1HA 1XJQA 2JJ1D 3BH6A 4M1OA 1JXMA 5JEEA 3HP1A 4B44A 2BBOA 4DEXA 3CX7A 3BOSA 2GBLA 1W5SA 3EXAA 5JHHB 5FI1B 1TF2A 2I1QA 4DUGA 4LC0A 3GEEA 4XVRA 1J8MF 2ZR7A 2YOHA 3W90A 2WJVA 2YZ2A 1FOEB 4HAUA 4W5HA 2OG2A 2WJGA 4G01B 4M9XA 3ZD7A 2ZR0A 4R7ZA 2XAUA 5DGXA 1NY5A 4I81A 4DDVA 1W36B 1JB1A 4BLOA 2Z83A 2GZDA 4OI2A 4YDHB 4QRHA 1X8JA 2BEKA 4N1AA 1D2EA 4PHGA 1XTIA 4RFVA 3WRXC 3I1FA 2BVNA 1PV4A 4O0MA 4WVFA 4M1KA 4F91B 4MRVA 5DYGA 2QMUA 3NKVA 3CW2A 2B92A 3PEVA 4K46A 4R9UC 4C0JA 1UKZA 4EIWA 2XXAA 2ZRFA 4JYBA 2GTPA 4PR0A 4ITRC 2X8AA 2KE5A 4GMDA 4OQNA 3B1XA 1VTKA 1QHHA 3UPUA 2AD5A 2HT6A 3AVTA 1N5LA 3B78A 4IXMA 4PSKA 1TQDA 1E9FA 3HPRA 3RWOA 1G3IA 3B1ZA 3KL4A 2YOGA 2XGJA 2Q21A 5G40A 5JWHA 3RYTC 1RYHA 3RWMB 4Q03A 1X6VA 3QKUA 1K5DA 2A5JA 2IK8A 1IXZA 2Q0HA 5FL7A 5FH9A 1OE0A 4GOKA 2A2ZA 1XMSA 3CM0A 5K8LA 1YZKA 2GJKA 3PEYA 2W2XA 3WHKA 2OBLA 3U44A 3THYA 3CRMA 2G9NA 3KUCA 1E2QA 3CPEA 4E07A 5IK2D 1YRAA 1HEIA 1F5NA 4FN5A 4L16A 2ZSEA 3M1IA 3PEUA 1WQ1R 1E2JA 4P0TA 4EPXA 4CEJB 2Z0MA 3LV8A 2FSIA 4NCNA 4QBHA 3PFIA 3SQXA 3KJGA 2OILA 5AWFC 4Z8XA 2XNDD 4P4SA 2ZRIA 5EP1A 2W83A 3ETLA 5HPYB 1VCMA 3SBDA 1IXSB 4PTLA 1ZNWA 3NC0C 1CS4C 2V9PA 2G1KA 3NC1C 3BFKA 4G5OA 1XPOA 4JKIA 4K81B 4F93B 4TN1A 1GRQA 5G41A 4B3XA 1N6RA 2OESA 4MH0R 4TL9A 2JEOA 1AQYA 1ESMA 1EFRA 4A8JC 2ONKA 4FXPA 1UDXA 2D62A 3WBJA 1GG2A 5HKKD 3TNFA 3TVDA 1DBSA 3K09C 4B2LA 4FCTA 2BM0A 4HB0A 4NONA 1ZP6A 1AS3A 1ZINA 4ZKDA 4BEBA 2FJUA 5LB2A 4URYR 1NNEA 4ZCMA 4QGHA 2AXNA 3QVVA 3UWOA 4AWXA 2PT7A 5H68A 1YR9A 3EA5A 1XMIA 1RPZA 3KB2A 4NYIR 3K0CC 1DO0A 5CYOA 2Z4RA 3TLXA 3A1SA 1RRFA 4UNQA 5TY0A 3U6KA 1W48A 2GBLC 3JZAA 1NG9A 2O8BB 1HQCA 3M4YA 1E9DA 1W0JA 4MRSA 4XH9B 3BB1A 1XF9A 2ZVPX 5FL3A 2WSMA 2F1JA 4H1VA 2FU5C 4K8OA 4DLZA 2BV3A 1O3YA 2DWQA 2J5XA 4URZR 3WMFA 4Q48A 2A30A 1KO7A 1RJ9B 1XTJA 4X8LA 4LPKA 5KNDA 3EPJA 2JLYA 1ZMXA 5L8VA 1FZQA 2V1XA 4GOXA 2L0XA 4AYTA 3ECCA 4MDFA 3K9GA 4MGZR 4RSGA 2OLJA 2JJ1A 2ODWA 1KSHA 1S1MA 3BWDD 4RCZA 1Z2AA 1S8FA 1T5IA 2P3SA 1CRPA 2R6DA 3KKPA 1IOZA 4IRUB 2VL7A 3LDAA 4JSTA 4POAA 1WDTA 1UBFA 4EFLA 1DAFA 1P7CA 1OW3B 2LKDA 2PCLA 2J59A 3B8HA 3GLHE 2YOFA 4Q4HA 1E1RD 3ZS9A 2ZRDA 3OAAD 4GMXA 4RD0A 2CVFA 1M74A 4D2IA 2FSHA 4Q7MB 3VNUA 4Q7LA 2H17A 4FMDF 2CEAA 1G20E 4QFMA 2HXYA 4CW7A 3ZIAA 3N70A 1XD2A 4HAWA 2QP4A 5AUPB 2ZI3A 2VP6A 2IWRA 4DSNA 2LCFA 2GAAA 1PZNA 1UBEA 3UANA 2REOA 4KVGA 3HU2A 4PHHA 1E79A 4G0NA 4MYCA 2VP5A 3EWSA 4EAQA 2BMFA 1EFUA 1W36D 4LJ5A 1QHYA 3SS8A 1J90A 2P6NA 1YR8A 3RRNA 1KI8A 1OV4A 1S1CA 4V03A 4DDUA 3AGPA 5FOXA 1Q57A 3AV0B 2JGNA 3IKJA 1JEEA 2F6RA 5EXTA 1ESNA 1Z8FA 3HJNA 4FMCF 1P62B 1G3UA 4AG6A 4MYUA 3UMFA 4C3ZA 2RGEA 3RVBA 5JECA 3L2OB 2KJQA 3FMPB 4LGMA 4LJYA 3BFVA 2QRZA 3TIFA 1N6NA 1G7TA 2FGKA 2XZPA 4S35A 3FFBA 1W4CA 8OHMA 4S2EA 4QJ4A 2QSYA 2NOAA 4RJLA 1FW6A 3IIJA 1H8ED 3I61A 2BKEA 3DM9B 4AY2A 4Q1AA 5HCIA 3TUZC 2AD1A 2KBFA 4MRNA 2J46A 4JVSB 4B3BA 4F4IA 3VX4A 1P9NA 2YC4C 5CDFE 2VHJA 3W6NA 1MR3F 4A36A 3ZGXA 1V5WA 1CEEA 2GZHA 4M0LA 3ADBA 5TB5A 3ZZTA 2V4ZA 1NIJA 1I2DA 1R4AA 2PZGA 4WBSA 5KHOC 1KTVA 2JLRA 4C0HA 1PUJA 3LXRA 2D7DA 1G18A 1NI3A 4FMDB 1Y3AA 3GLFA 1MV5A 2ORIA 5FUWA 4B3FX 1Z28A 2W6IA 4OHZA 1U9IC 3IQWA 3RS0A 2AWOA 5DN6A 2ZANA 2NIPA 2HJVA 3GMTA 3Q7PA 1UEIA 2QROA 3RRZA 3Q5DA 4LBWA 1N6IA 5FUVA 4LUCA 3VHLB 3H86A 1PLKA 4DHEA 1OLOA 3IHWA 2JASA 4II7A 4I1UA 5L3QA 4YXWA 2BMEA 3QXJA 1NBME 2ZYVX 4TMTA 5IRCD 3C5HA 1KJWA 2FE4A 2VSXA 3TQFA 3AKYA 4HAVA 1TMKA 2YINC 2EWVA 4JLMA 1Z6YA 4MA4A 4FI3C 4D26A 2O8BA 1OHHD 1KJZA 1NP6A 1FQKA 1N6OA 1YZGA 3R7WA 5JJLA 4B73A 3L43A 2D2EA 3VTKA 4FMCB 4CEHB 3AVYA 4BLQA 3QKSA 1CXZA 2FFQA 2FPLA 1XZQA 3G0HA 1GITA 4BZXA 3D6TB 4IDNA 2XZLA 1CTQA 4HDCA 5DI9A 1ZUNB 2HCJB 4F38A 3V4FA 3MGCA 1N5KA 1U8YA 2J1LA 1DO2A 4KHZA 2DWPA 4CGZA 4P32A 1Z6AA 2BHRA 1W4BA 1BO6A 1YQTA 3I3SR 4PAQA 4US1R 3CPJB 1Q21A 3DEFA 4CEHA 2ODNA 2C9CA 4BRUA 2F1IA 4BUJA 3BK7A 3C41J 3I5YA 2W2VA 1NKSA 3LQRA 1XPRA 5A0FA 3GJ8A 2YWGA 1T0JB 3U3MA 3EZ2A 2JDID 1WB9A 2FOLA 3VX3A 2WPDD 1LS6A 2IT1A 3ZDQA 1Z0DA 2C95A 2RGXA 1CRQA 5KSYA 1GKUB 1W4AA 2WSSD 4D0LB 4CEJA 1II8B 2ERYA 3PUWA 2TMKA 3REGA 4HLDA 3GLFB 3U44B 4Q18A 1KKLA 3QPVA 4MGKR 3C8UA 3BAFA 5JMTA 4W9MC 2IS2A 2FNAA 2C78A 4HYYA 3MSXA 1EFRD 1NIPA 3MG9A 1CKEA 3P27A 4DLUA 3LQQA 3IUYA 4GP6A 5TVKA 3SU8A 1GFIA 5KYKA 5JJIA 1JR3A 2BBTA 5HKKA 1S3SA 1R6BX 4DLXA 2OV2A 4OI4A 4QNMA 2QM8A 1IN6A 4DCVA 2IYXA 3DKPA 5JFGA 1FMJA 2D06A 3K70B 1KI9A 4DT1B 5GJCA 5AK0A 4OQLA 4RD4A 3A4LA 3RRYA 4PSVA 4RCYA 1L4UA 4UKDA 3P4XA 2VQSA 2O5VA 4IVPA 2CK3A 2OAQ1 1G3MA 2EVWX 2P67A 3TW4A 2H16A 1R2QA 3ZVRA 4LHXA 3CR8A 4Q47A 1NVWQ 3PENA 2IF2A 2N42A 1AS0A 3W5JA 2YWEA 4NH0A 3LY5A 1W5TA 1K6MA 1ZUIA 2C03A 5B30A 3DL0A 5ELXA 1C9KA 4M8NE 4QHTA 3A6PC 2ZRMA 4Q4LA 3TBKA 1HY3A 4GBMA 1MKYA 4NCHA 2A5FA 4D81A 3O8DA 3G82C 4V0OA 1LF0A 2FSGA 5KSZA 1VG8A 1YJ5A 3OAAA 1E2NA 1OB2A 1VYVA 5J4KA 4ILEA 4Q4HB 1AKYA 3GJ3A 5DISB 2NPIA 2WIBA 4JT4A 4EPRA 1N6HA 2FG5A 1W0KA 2PJZA 4ZCLA 1D5CA 1F2TA 3FTQA 1DAKA 1L8QA 2ATVA 3ZH9B 1KO4A 3GCGA 1Q1ZA 4KI0A 1E2KA 1LB1B 5EE5B 2O8FA 3BIFA 1N3BA 4UNPA 1G21E 4JL6A 1SVMA 1QRAA 3KXIA 2DFTA 2VHQA 1KDPA 3EA0A 1TADA 2QUZA 1E2MA 5DYIA 4HLUA 3RABA 2W6JD 3AVPA 2C9YA 1M7BA 4LYJA 5AJZA 2IYTA 1TTTA 1F2TB 1G5RA 4OJQA 3CNOA 4A0GA 4UQOA 5CM8B 1Q22A 2WWWA 3E2IA 1GRNA 5J4LA 3AP1A 2ZS7A 2IYSA 2VP0A 1V43A 5KNCA 3Q5EA 3AF1A 4G1UC 1WBDA 3PCRB 4F4JA 3IO5A 4C2UA 2DBYA 3EIQA 1J8YF 4UJ5A 1JI0A 2QI9C 1G3RA 3VFDA 1D2NA 4A15A 4TYNA 3EC1A 1Z08A 2ORWA 3I5XA 2QGNA 3NBXX 3P32A 3S1AA 2CBZA 1RIFA 1SKYB 3IQXA 5E7MA 2BEJA 2XB4A 4MKHA 1JBKA 5D3QA 5E7IA 2B7CA 4TSFD 1EWRA 1BOFA 4IW3B 4D4JA 2A3RA 1LNZA 3ZQ6A 1OFUX 2DB3A 3NH6A 5J4VA 3WYGA 1VDZA 4UNRA 4I1OA 2ZI7A 4PC6A 3ADDA 1XP8A 1RYFA 4UJ3A 3RDPA 4KFRA 1IN7A 2XNDA 1ZBDA 4XOIA 1KIMA 3GPLA 1R5OA 2Q3MA 3LNCA 4GRAA 4A82A 1TU3A 4M53A 3V00A 2AK2A 4KBFA 2OE2A 3B9PA 3U7GA 1S96A 2J0SA 4LDJA 1I2MA 2A5YB 2VP2A 2ZSAA 1O87A 2EFCB 1IN5A 1E1QD 1XZPA 3CNLA 4QKQA 3N2IA 3LW8A 1OFHA 1G3QA 3UG6A 1T9HA 2C2HA 2CNWA 4BGDA 2ATXA 4GZMA 4NYMR 3M6AA 3TQCA 4Y0AA 3QVUA 3B1WA 1YZTA 1F6BA 4JT2A 4V0ME 3OE7A 4CVNA 5CJ2A 2IYQA 3P20A 3RSLA 4E09A 4KU4A 2XNSA 5IF9A 3IDQA 5FUYA 1N2CE 1JJVA 1GM5A 3EX7C 3SHFA 4C0LA 3V9PA 4IDQA 1DAEA 721PA 1II8A 1NSFA 4CYMA 2ZRLA 1G5TA 4OQFA 1RZ3A 3OZXA 2P65A 3I62A 2ZROA 1COWD 1KI6B 4HB3A 2PBRA 2QMHA 1Q1BA 2XXAB 1TUEA 1GNPA 4Q9LA 4PO8A 4WXRA 4YC7A 1W0JD 2GJ9A 3EG5A 3I92A 4ZPXA 4BECA 2V7QA 4ZCIA 4AI6A 3AUXA 4DLVA 5L3SB 1FX0B 2H92A 1QZXA 2PH1A 5FBRB 1W2GA 2QPOA 3CZPA 3QQ5A 4Q7JB 5JCZA 3ICEA 3EASA 5BYJA 4D0GA 4LHZA 3SI7A 1SVKA 4LZZA 1R8QA 2OXRA 4NE2A 3MUFA 2O8DA 5JS7A 1JECA 1N25A 2NMVA 1X86B 2Q3HA 3K0FA 3DVLA 5P21A 3VR6A 3RS7A 1WCV1 1M34E 1Z0IA 2I3BA 2AKYA 2WWIA 2H5EA 4L9SA 1YZNA 4KFUA 2NO1A 2V6IA 3A1UA 3QXXA 1S9HA 4QGFA 4QBIA 1XEXB 2GKSA 4CT4B 1E1RA 5FPKA 1KYIA 4U7DA 2AX4A 4C0AC 3A37A 4C0KA 2OHFA 1J7KA 2QQEA 1LFDB 2B8TA 3IIKA 2ZEJA 3R7WB 5HTKA 5EP2A 3X1WA 5JI3E 3ZIAD 2AHOA 3RLFA 3CLVA 2W6JA 3CZQA 3U3OA 3L0OA 4Q9JA 3Q85A 1MO3A 2D7CA 4HLQB 2BOVA 3B7GA 3PUYA 4JKYA 3BD9A 2BMJA 5FL7D 2QAGB 1F3OA 3PUXA 4DBLC 5HZKA 4L15A 3EW9A 5TV2A 3WNCA 1W49A 1YR7A 121PA 3UWKA 1KMHA 3CIOA 1E98A 4E03A 3I32A 4GFDA 1WP9A 2ZQ5A 4NDZA 4BFVA 1CJVC 3Q7QA 1NMZA 1Z6XA 2HXSA 2WM9B 3GJ4A 1PVOA 1M2OB 1T3LA 1R10A 2Z43A 2WJJA 4DSTA 1Z47A 5FOUA 4BZPA 1GRRA 4TT3A 2E87A 2W58A 3FKSD 2QSZA 1E2IA 3D3QA 2RB4A 2OBNA 4IOMA 5IHPA 2VBCA 3VR1A 4Q7KA 1PJRA 5TDHA 3U4QB 2FV8A 4RKEA 5G53C 1XU4A 3UXMA 2J87A 1OH5A 4LJ6A 3IBGA 3W9YA 4B6FA 2EYQA 4GT1A 3MD0A 4M4SA 1P60A 4C0QC 1OIVA 2GCPA 1G7CA 4IFEA 3NWJA 3CRVA 4M2LA 3K0AA 4PC2A 3K70D 2PLRA 2GESA 3HR8A 3IEVA 1P9RA 2IF0A 1D8TA 2WBLC 4V0NA 4QL3A 2D3WA 2IS1A 3LO5A 3K8YA 1QF9A 1XTQA 3FDIA 1SVLA 3B85A 4A92A 1KKMA 2GEVA 5H8WA 5DN6D 1XXHE 3BH0A 3WRYC 4NTZA 1KJYA 3KXKA 1WMSA 4M9QA 1E99A 1Q3TA 3DDCA 1YHNA 3QXHA 3LH5A 4PQYA 3SJBA 1WE2A 1DAIA 621PA 3ND9A 2NO0A 1DTSA 2CHGA 3E1SA 2IX3A 3U6BA 4P33A 4PAOA 4HUTA 4B3DA 1HURA 4LBZA 2JJ2D 4N0EA 3R20A 4A9AA 4BASA 1CP2A 4ZDIA 2OZEA 3SHWA 1M8PA 2CCKA 2KBEA 2JDIA 2ZRKA 3AKCA 1XD2B 1EX7A 1E9RA 2R62A 4IEEA 5J4YA 5JZVA 1P2VA 3CX8A 1OHHA 2IXFA 2R6CA 1ZD9A 2XTNA 5DHAA 5FPTA 1IM2A 4ACAA 4A8JA 1C4OA 5J40A 3NVAA 4NZYA 1Z06A 1P4SA 3EIHA 2YNMA 2RGBA 4JLOA 2ZU6A 4DB2A 1E9SA 4HLCA 4G5GA 5GJVC 3ZZUA 1NN1A 3K09A 1P73A 2AXPA 2FZLA 1KY2A 5BN3A 1KO8A 4B32A 3SYLA 3ZVNA 1ODFA 5K8TA 4LHWA 3GJ5A 1E4YA 5JSZB 3NXSA 4DDWA 4HZIA 2RH5A 2YV5A 1LV7A 1GNQA 2VRWA 2O8CA 4QBGB 3Q3JB 4Q01A 2CLSA 2JLQA 4ABYA 1GL6A 2NO9A 4Q21A 5CJPA 2WWYA 2ZAMA 1OXUA 4G3XA 4EPYA 3KQKA 221PA 4MKIA 4LC1A 2W00A 4BFZA 4JBWA 4A0HA 4M21A 2UVQA 1L7VC 2HYDA 1E79D 5SZKB 3VU9B 4QC2A 2YWHA 3FB4A 1U98A 3BXZA 5DI3B 4QJ5A 1GZSA 3AQ4A 3PEWA 2ZE7A 1KI1A 5FBQB 1LF5A 5BQ5A 1G19A 2BJWA 2ZI4A 2G0NA 2ANBA 4HB4A 1F2UB 1G8HA 2ZUCA 4KBGA 2Z5FA 3QY0A 5EZ6B 3FMOB 3QPWA 1EFCA 2Z6VA 4KV9A 4DUGD 3QUSA 1QBKC 1OB5A 4B3GA 4YMVA 1VKJA 2ZRCA 4P31A 4OI1A 5DSZA 3PR1A 3R8CA 3F3YA 2MSDB 3SN6A 3GFTA 3SZRA 4ACBA 5JRZA 1R0WA 1ZC3A 2QN6A 3BORA 1KOFA 3LBIA 3KQNA 5C4GB 1TAGA 3I73A 2FH5B 1ETUA 2K5UA 3OEEA 4DLTA 2F1RA 5FBLB 4EJSB 3KQHA 2QQ0A 3G5UA 4PQRA 2IS4A 3T12A 3BGWA 4DB4A 4IOLA 3KQUA 5DIFA 5EXSA 1L2TA 2ZJYA 1G4AE 4C0BA 4ESHA 4URWR 5EUMA 4WXPA 3CRQA 3W34A 1QHSA 1WA5A 2IHBA 1Q12A 2GCNA 4TLCA 5J47A 1VCOA 3FKSA 2SHKA 4P4SB 2ZRBA 4KLZA 4TYWA 1HE8B 4OBEA 5BN4A 3ASZA 2BMDA 3WYFA 5F9HA 1VHTA 1XRJA 5GVRA 3T34A 2IW3A 5GJWC 3U3JA 1UDWA 2NO7A 5LPNA 2AWNA 2C99A 4O25A 1OFIA 3CBQA 1CJTC 1NLFA 2ZJZA 1BKDR 4TMWA 1TF7A 2ZJ5A 3SFVA 4A0FA 3THWA 3THYB 3FGNA 4PX9A 5GJBA 1XBTA 2VTKA 1RKBA 4KFTA 3LAWA 2CDNA 2QENA 4IEIA 1SXJE 3KJIA 3L8ZA 2J0UA 3L8YA 3ND8A 2H8KA 4EPWA 4AKGA 4QNRA 3REFA 3LRPA 2QAGC 2IXEA 3NBYC 3AGQA 4OYHA 1ZNYA 2HEIA 3TSWA 1Z0JA 3KXLA 2RGGA 1JXOA 2OFXA 2AR7A 1JPJA 1Z07A 4LY6A 1IN4A 1QHHB 1KAGA 5FOWA 1KI4A 1JQJC 1ZVQA 1W2HA 2C77A 1A1VA 2XOKD 3VMFA 4QJ3A 1YE8A 4F7WA 3EPHA 3Q72A 1U90A 1QHNA 2FF7A 4B3CA 4DEYA 4FD2A 2RGNC 3MRSA 4MYTA 3KFVA 4MRRA 2ZYWX 3GEHA 3BJIC 1NN5A 3I8SA 2VPPA 5TARA 4LJ9A 2FFBA 2XJ9A 1IONA 2G77B 3KKMA 2RHDA 1T3SA 1US8B 1SHKA 4FW9A 2FSFA 2Q9CA 5CK5A 4HI0E 3NHBA 1NRJB 4A2PA 2OFWA 3PJRA 2GCOA 2WICA 4JL5A 2ZREA 4OL0A 4YMUA 2UZ3A 1CULC 3OHMA 2XTMA 4NYIQ 2OAP1 2I4IA 4F92B 2UZIR 5F2EA 3GEIA 1N5IA 2GJSA 2EFEB 2O52A 1Z22A 1CR4A 2FGJA 3FOZA 1E0AA 1QVRA 4M1YA 4NBSA 5KOYA 1W44A 2UKDA 4AC9A 2IYZA 3ADKA 2VF7A 4MKGA 4M1WA 3SR0A 3UMSA 5B57C 1GNRA 5CB6A 1G291 4JLBA 3ZLJA 1G6OA 4RFSB 1SHZA 5LBIA 4Q4JA 2GA8A 4GI7A 5FOTA 1NL3A 1N6PA 4OK3A 4DJTA 1IXRC 4JLAA 4EUNA 5LDDC 3WP1B 4A6PA 4DVGA 3TKLA 1ZNXA 3GLGE 1PUIA 1DAHA 3EC2A 4DC9A 4ZI3A 3GJ6A 3U3RA 4NU0A 1NBMD 2IYWA 3L82B 2KB0A 5EUQB 3RS3A 3K0CA 3OE7D 1U2RA 3R8FA 1JR6A 2ZIAA 2ZSBA 1Z5ZA 3BB3A 3CF0A 2NG1A 1MO5A 4IXNA 4ON9A 3SQWA 3O8RA 2HYIC 3KKQA 1FMLA 3SJAA 2CJWB 4KSCA 2OM2A 3AF4A 1XB2A 2F3TA 5AUQA 4JIMA 2F7SA 3EWAA 3KFXA 4OKSA 2RGDA 4GPTA 1N6KA 1G1MA 1T5LA 1UJ2A 2VP4A 1QDEA 1E4VA 2BWJA 2BIFA 2ANCA 4JLDA 5EJEA 2CXXA 2OCAA 3GFPA 2D4HA 2FZ4A 3AVOA 4JBYA 4KVAA 4C30A 2ZE5A 3LBNA 3KTAA 4Q1BA 2ZJBA 1XMJA 4DSOA 1OIWA 2IWHA 3MWYW 1TPZA 2VF8A 3LWNA 4XVUA 1LY1A 1GUAA 2ZJAA 2KI5A 1T4GA 3Q8XB 4LRWA 4QHSA 5B64A 2J0QA 2BJVA 1JPNA 3EZ9A 1ZM9A 3T35A 5AJYA 4P4UA 2JJ2A 3ADCA 1JALA 3PUZA 3TMKA 3EIEA 2QG6A 4QM6A 4ARZB 4B71A 3LVQE 1N0WA 3LA6A 4Z8YA 4MRPA 1X8LA 5L3VA 1FUUA 1FFHA 1RRGA 2N1BA 4QXAA 4JLVA 5JS8A 4B2IA 4NKRA 4DRZA 3J81k 4LHVA 1RRPA 4HDQB 1N5JA 4M9SA 1UM8A 2ZI6A 4BLSA 1CLUA 3TAUA 1ZD1A 3W3ZB 1AZSC 2BC9A 2BBWA 1P9WA 3T06B 4OJKA 4ZI2A 4FMBB 4LX0A 3BH7A 2JLVA 4EJSC 1TX4B 2WIAA 4XTRA 4NCIA 3FHTA 2ZSDA 3QF4B 1NKTA 4CEIA 1ONBA 2GXSA 2ZVQX 1EFTA 4Q4AA 3FMIA 4KXFB 2OO7A 2NPFA 2IS6A 4HUQA 5SZJA 1ANKA 2ZM5A 4U02A 1QG2A 5CYPA 5JWOA 3TR5A 2XX3A 1JEDA 2DY1A 3TK1A 5FTKA 1ZC4A 1YZLA 1B23P 1W0KD 3NEYA 4B74A 4JLKA 2EQBA 1D6JA 5SZHB 2F43A 2OEPA 4V0MA 2R44A 3AP2A 2CL7X 4RD6A 5CIWA 2GRJA 2XB2A 3AUYA 2DR3A 3VKGA 3FE2A 1WBBA 4EQ6B 3U5ZB 4IKEA 1MRSA 4KJZA 3T1QA 4HZUA 4BLTA 5E95A 1EK0A 4LPSA 3KJHA 1P72A 5FTJA 5LD2C 1JQLB 4QBFA 4YMSA 1JAIA 4NHOA 2YWFA 5JCPA 4PC7A 3SOPA 4TYYA 1XCGB 4TQ9A 2OCYC 2WOOA 1DOAA 2ZS9A 3DHWC 4XWKA 2WWGA 4LYHA 3W6OA 3FWYA 3LXXA 5HE8A 2WJIA 2CHQA 3K0EA 4DLWA 1E2HA 3W6PA 5F98A 3PG5A 5EQTA 2J45A 1ZNZA 5H70A 1Z0AA 4C7OB 4HAXA 3SFZA 3B60A 5TXGA 5KUTA 4EQ6A 1DE0A 4TZ0A 3K9HA 1U0LA 2D2FA 3MAAC 1G8PA 2CHVA 2F43B 1D9XA 4ASUA 4HDOB 4UXIA 2NZ8A 4R98A 4JVLA 3GQBA 3OIWA 2H18A 4C9BA 1E2LA 3RNLA 2WZQA 4MQBA 5DHFA 2QTHA 4LCBA 4LJAA 4M1TA 1BIFA 4Q1DA 1KDOA 2W2TA 3EZFA 4HUQB 4NYJQ 3DOEA 2KSQA 2RHMA 1A2BA 2PEYA 4QGGA 1BMFD 2MSCB 3QF4A 4TLEA 1GDDA 2VYFA 3CB4A 4PPNA 5D3MA 2P5TB 5BN5A 3C14C 5CK4A 4HB2A 3F0TA 2GEDA 3GLIB 2MMGA 4TLDA 3UKDA 2PL3A 2FEMA 4TYQA 4UXJA 3IO3A 4FIDA 1II9A 2IYYA 4Q1FA 2F9LA 1G64A 2J7KA 3C15C 1JR3E 1LW7A 5E3HA 5CB8A 3VR5A 2C96A 1HA3A 2DHRA 4D80A 1SXJB 4PPFA 3SYKA 4ZIRA 3ZVLA 5FBVB 2QBYA 2ZRAA 1T3HA 1XCPA 2IUSA 3NG1A 3T61A 3O47A 1UEJA 3PIRA 1T0HB 2ZE8A 2ZR9A 4L5BA 4TL6A 3QENA 5JRJA 4BZQA 4DIDA 4DDTA 1Q1EA 1J99A 4TQAA 2FA9A 1AKEA 4W5JA 4E22A 2O0JA 4Z1MD 1XXHB 4V02A 3H2YA 5EE0A 3M0EA 4UNNA 4AD8A 5AUOB 3MJRA 1CJKC 3N5CA 5KPDA 5A5GA 4DWJA 1AGPA 2Q6TA 5EE1A 5EE9A 1ZM4A 4O2RA 2JJ8A 2JLWA 3CNNA 1E32A 1GL9B 3GD7A 4KYUA 5JLJA 2VHUA 1KK1A 2VSOA 1TEXA 4NYJR 2I1VB 1JNYA 1IHUA 1SZPA 2YVUA 2B8WA 2X1VA 2RGNA 2JLSA 1XX6A 3QPUA 1WRBA 5FR2A 1N6LA 4MGIR 2CLDX 4Q9KA 2JAQA 1RC8A 2QEQA 4URUR 4EKDA 2REXB 3QKRB 5K8IA 1KHTA 1NMYA 1XCMA 4IVQA 3GLHB 5EP3A 1LVGA 3EPLA 1ZRHA 5AR1A 3WXMA 3U60B 3W3AA 4BQSA 4CT5A 1R0XA 3KKOA 4URXR 3KUDA 5CM9C 1G4UR 1RE0A 3ICQB 2PCJA 3ONWA 1NMXA 4CF7A 3B1YA 4W7SA 4B33A 3U3KA 2V3CC 5KPJA 3FHCB 2IHYA 4BLPA 4RZXA 1TL7C 1IY2A 3HWSA 1SXJC 1YU9A 2Y8EA 1XEWX 4TMXA 1OIXA 2HF9A 4YQFA 3LX8A 2HV8A 2QMOA 3O8BA 3TSOA 2B6HA 4ZO4A 1QG4A 1KSGA 5FTMA 3GLIE 3E5HA 3QJYA 2HDNB 5EXPA 4KFSA 1KK3A 4PHFA 4AURA 1OJLA 2ASEA 3OFNA 4I99A 1H8EA 3BE4A 5F9FA 2C04A 1MT0A 1ELOA 1G7RA 3DKVA 3MJHA 3PVSA 1YZUA 3IPYA 3EZ6A 2DFKB 2ONJA 2GDJA 1YKSA 4Z54A 2IEZA 1AN0A 3JVVA 2XEXA 3T1TA 4LOAA 4LBYA 4XD7A 3GLGA 4B75A 3T1OA 4GL2A 2R6GA 3ASYA 4DKXA 3JVUA 2IYUA 2J41A 3BFXA 3X2SA 3CUEF 1NG1A 3AB3A 1XMVA 1L4YA 4G5SA 1AA9A 5BXQC 5GADl 1MO6A 2NO6A 4IFBA 3A1VA 4D4MA 2H7VA 1TUIA 1G8GA 2GILA 2C5LA 1KK2A 3IGFA 3DZDA 4TT3D 4TLBA 2O8EB 2QNRA 5FPHA 3HR7A 4LV6A 1VYUA 4AG5A 4QM7A 2CLCX 4GSYA 5EZ5A 3RSOA 1OH7A 2XTZA 4FINA 1KO1A 1XDBA 4RZ2A 2DYKA 2WMOB 5IDVA 1SVSA 1G16A 3PUVA 1U0JA 2YYZA 5M04A 1XEFA 2QRNA 3D8BA 1IY0A 1GWNA 1VECA 2FN4A 2J7PD 1GTVA 1PLJA 4PPQA 3DZ8A 1AQUA 4LI0A 5DH9A 4MGYR 1N0UA 2VHCA 4TLAA 4YMTA 1E3MA 3LW7A 2CL0X 2X2FA 3QIAA 4BRWA 1NSTA 1GVNB 3IBYA 1E9EA 1EGAA 4B43A 3THXB 4WAUA 2A5GA 4EJSA 2IYVA 2IUUA 1DG3A 1ZM2A 3LX5A 4XWOA 4ZIRB 1BH2A 1X3SA 1A2KC 1T8UA 3LD9A 2P5SA 1AS2A 3MMPA 5KO2A 4NCKA 1G9XA 1YRBA 2ZAOA 5FUXA 3R9IA 1FL9A 1R8SA 2HUPA 4QOSA 1KDTA 3AP3A 2REBA 3C7KA 1KO5A 2FPKA 3A36A 4IDOA 2R9VA 1KSJA 4AK9A 2VA8A 1DS6A 1F2UA 1KK0A 2OUKA 1ZIOA 1OKKD 1W1WA 2B21A 2XZOA 4ZDWA 4EFMA 1AGRA 3PITA 1LS1A 3THXA 3QEJA 2XSZA 4A1FA 1SKQA 3QXSA 4LHYA 3ZS8A 1VPLA 4LV5B 3VU9A 1XTRA 4DCTA 3AF0A 2GAOA 4DLRA 3TUIC 2JLUA 1H8HA 3WHLA 4MITA 1K8RA 2GHIA 1GKIA 3EAQA 1E2DA 3Q9LA 3FHOA 1ZM7A 1W46A 2ZRPA 4AYXA 2RKOA 4CZ2A 5KDDA 1NBMA 1ZIPA 2Q3FA 2O8CB 3TW8B 2CCJA 4PPGA 1AJEA 3IEUA 3QOFA 4MKFA 5JSZA 2GNOA 2GF9A 1ZUHA 2O8EA 4L8GA 2QZ4A 4JLNA 1BMFA 1GL7A 1XD9A 5KDOA 1KSFX 1J2JA 2C98A 2JIZA 1OFTA 5C1BA 4YLGA 3K0SA 2BKUA 1OXTA 2AK3A 2YHSA 2RGCA 3KX2A 1KNQA 1Z0FA 5FFMA 1GOTA 4HEJA 1J70A 2GZAA 2X19A 4PANA 2HLDD 2PT5A 4M1MA 2EW1A 4JL8A 4A8JB 4R2HA 2QU8A 4XSGA 3H4MA 4JMPA 1COWA 1E9BA 4U00A 3WYAA 4KITB 1I4DD 1JR3D 2LWIA 3K9NA 3U7EB 3IILA 421PA 1D2MA 1S9DA 1Q3HA 1HV8A 2GJ8A 2QY9A 3FMFA 4QGAA 4DSUA 1CJUC 3PV0A 2WAXA 3CH4B 3FKQA 1DG1G 1U99A 1Z29A 5FI0B 1Z6GA 1P5ZB 4Q19A 2GK7A 4IDHA 1OYYA 3SYNA 5C18A 3LFUA 3SJZA 2FFHA 3PQCA 3WBKA 1I4TD 1SQ5A 2QT1A 3TUJC 4JS0A 1MABB 4RZUA 1KI3A 2QT0A 2HJGA 4HATA 3AM1A 2GF0A 1KDRA 5HZHA 3I72A 5HR5A 2W0MA 2Q9AA 4PO1A 1RVDA 1DELA 1G8FA 2MMCA 1TQ4A 3VQTA 4ZV4A 2FEOA 4W5WA 3BRWD 3SEAA 3OEHD 2WKQA 3VR3A 4GOJA 2ZI5A 4IOKA 4B6EA 1NLZA 3U4QA 3GLHA 3QI2A 1SVWA 2ECKA 4IJMA 2QORA 1A7JA 2ZITA 4PZYA 3X1DA 3V4RA 3RS5A 2ZS8A 3ZZ0A 4ASUD 3QKRA 3B13B 3NBFA 1ZU5A 4YONB 2RCNA 2WOJA 4HAZA 3MWKA 3HDTA 3A1WA 3OF5A 3L0PA 1FP7A 4C4PA 1KZ7B 4LSGA 2QE7A 5JJKA 3QG5A 1SXJD 2WKRA 2QGZA 4PXAA 4BFTA 2Z4SA 1RRCA 3NBZC 3OIUA 1UBCA 2OBMA 4IDPA 1A5TA 2FPMA 1X1SA 2WJHA 3CKLA 5L3RA 2WHXA 4JVNA 2GK6A 4P4TA 5CLLA 1KY3A 1DARA 3K53A 3C5CA 1TF5A 1UFQA 1II0A 1KMHB 1GP2A 1NN3A 5G3YA 1XXHA 2YJTD 3D7MA 4PZZA 2VH5R 2QL6A 2X77A 3DM5A 2QPTA 1ZJ6A 4X8HA 3CR7A 2ORVA 1E0KA 1NJGA 2W0SA 5LD2B 2IUTA 1R7RA 4TMVA 3BC1A 1G6HA 3FYHA 2R65A 3O8CA 3HU3A 3U7HB 4D25A 3B2EA 3RC3A 2QBYB 1UKVY 1P3JA 3FPAA 4OK5A 1DAMA 4TMKA 4G5RA 1GILA 4AKIA 4JYCA 4I4LA 4MUAA 2IBMA 4FCWA 4D82A 5J5CA 1W47A 2P6RA 2XSZD 1YR6A 2GVZC 1XEXA 2YKGA 3LLMA 1VMAA 5CDFA 1T91A 1NJFA 2BBSA 4JBXA 3RS2A 1OXSC 2E9SA 5FOVA 5SZIA 4XD7D 2JLZA 4TSFA 2OT3B 4L4UA 3QF7A 521PA 3GFOA 2VSFA 3H1TA 4B48A 3W8NA 1R0ZA 1ZU4A 5FBWB 2R6FA 3QEOA 3N2EA 4LJ7A 1SULA 2JA1A 3IIMA 1M6NA 3GLIA 2GCOB 3F5FA 1MABA 2G6BA 3GLFE 2EFHB 4TTQA 2DFNA 1OH6A 3L0IB 1HYQA 4CIDA 2ZJOA 4PSAA 1FX0A 4Q1CA 3U2QA 4TTRA 2ZUBA 3IPXA 2GETA 2ZU0C 2CL6X 1E0SA 2RAPA 4XIGS 1QVAA 1DAGA 5JHGB 2G83A 3P26A 1HQYE 2ZYUX 3ZJYA 2O0KA 2GVDC 2P6UA 1QHIA 4IOJA 1E2EA 4TL7A 3UIEA 4DXAA 1G17A 4CRWB 5A4JA 1ZAKA 3PXGA 3R9WA 4Q02A 4M22A 3VR4A 1GIAA 1FQJA 1OSNA 1XPUA 4EPTA 5BWMA 3A4MA 1XTSA 2PMKA 2J0UB 1E1QA 4DZZA 2MSEB 1VG9B 3RC8A 2PEZA 3OIVA 1HTWA 4H1UA 2CNWD 3KJEA 4R2IA 3OIYA 2A9KA 3THWB 4Q1EA 4DLSA 3AKEA 1T6NA 2G1JA 1Z3IX 4HZUB 3SC3A 3QG1A 2H1LA 3OESA 3BS4A 3I4LA 2EWWA 1UADA 3NEJA 4TWZA 4DLYA 4Q66C 1NVUQ 1UBGA 4BE7B 1MO4A 2ZETA 2H57A 3B6EA 1VG0B 5DE3A 3LVRE 4EFNA 1OKKA 4BEJA 1K5GA 1SVIA 4J0QA 3SDZA 1I4LD 1P75A 2QA5A 1S0UA 1UKEA 4MUBA 2FWRA 4CDGA 2JCSA
chains in the Genus database with same CATH superfamily
4LRYA 4RKWA 2ZT5A 1UPCA 3R74A 3T94A 2PUJA 1MU0A 1RWOA 1AU9A 1D09A 1XHLA 1E2PA 1LDNA 3G88A 1FRFS 3O9VA 1NUQA 5FWAA 2OENG 4PLYA 4AJ1A 1QBGA 2GQ0A 3TGPA 2D6FA 1L8AA 3D3EA 3F8TA 3O4IA 5ANRB 4JP8A 4TQUS 3C3YA 5KU1A 4TTPA 3V1UA 5G3ZA 4KPEC 4N4AA 1JSCA 1QYIA 4JJZA 4B4DA 5IJ9B 1QK5A 3CF6R 4BPBA 3Q7TA 3CZCA 3OPVA 3PE6A 1OLUA 1PU2A 2CVHA 2VI5A 2VUIB 4TV8A 3GNTA 3UYKA 4B4OA 1D03A 1VJCA 1EU1A 1TEVA 5E7JA 4J4HA 3KBOA 1BSVA 3PR2B 5IABA 1EWQA 2V0NA 2WYVA 4US0R 5BWCA 2CNKA 3TLZA 3BMQB 4ND7A 1I5EA 4F7DA 1JWAB 2GHRA 1IOLA 1EDOA 4DQVA 2AFHE 2JG3A 2YYSA 3EVGA 2PR2A 2CN1A 1JFFA 2IHKA 2R7NA 3K2EA 3JWJA 4B76A 5AESA 2CV2A 1Z73A 3NDJA 2QTRA 2LD4A 4NZNA 4B6JA 4ZKEA 1NF3A 4A2WA 1KAQA 4DC0A 5ADUS 2A0UA 3HBMA 2WAOA 2ZDGA 3H9GA 4Y2SA 5ALIA 1ZXXA 4S1VA 5REQB 2B20A 1BYUA 1KI2A 1NP3A 2IYEA 2QLNA 4MLDA 4KO8A 4RPJA 4K1XA 2ZSFA 4RK6A 5T67A 3DGEC 2AFIE 3KB1A 3P9KA 4Z4QA 3A6JA 2GLUA 4MDEA 1XG5A 4YFVA 1TOAA 2FWPA 1TLFA 2H4WA 2WVJA 2R8RA 4EMBA 1NU8A 3M8KA 3GRAA 4US2R 1FUKA 1UKCA 4M0CA 4N3NA 4B6SA 3CNHA 4PX5A 3N0TA 4EHHA 3KKNA 4FYJA 5JYEA 3LUKA 4AFNA 1W7AA 2C4NA 4FN4A 5DM4A 5EZSA 1U02A 3V7FA 3BERA 2XD9A 3Q15C 1JV2B 3C3AA 2YXDA 2GEUA 3LCJA 2C88A 3WA6A 4GOOD 5H3LA 5ECDA 1Y5MA 5LYYA 2VDQB 4Q93A 1Z6PA 5E8JA 5EJFA 3RRJA 2H51A 1HT1E 2HQ1A 1HEUA 4LQLA 5SYMA 5E9WA 2ZIUB 4W1RA 4DLKA 1I33A 3Q0IA 1OD6A 1RCUA 4CMBA 1X7HA 3H3JA 4D0NA 3QE3A 4ENTA 4R83A 1DUVG 1FXUA 3AHGA 1KMMA 5IT5A 1QAOA 4FBGA 3O38A 1PBNA 4CUJA 5EEHA 4OQDA 1M0TA 2IXGA 2Y0BA 3JQBC 2PBFA 2BCJQ 4KWEA 4O5AA 2BGLA 1EBUA 3V3TA 4ZEVA 3V1LA 1WHSB 1I0LA 3QNUA 4YN3A 2PWZA 2QW1A 3PRYA 4JLJA 2P2ZA 4P0PB 1DOZA 2L82A 1BCRA 4Q3EA 4UDYX 2CSXA 4LJ4A 1JKIA 3FVVA 2NQTA 2HWUA 3HBFA 1SD1A 3IQZA 3HVJA 4ZJYA 3C16C 1N8TA 2VQ6A 2YY6A 3RYFB 2WD9A 1Y80A 3RANA 2IUFA 4MJXA 1HMPA 4NCJA 3QA9A 4AYWA 2ZXFA 4J7CA 1MH1A 1E0JA 4CM7A 2FFRA 3FDFA 1GAJA 4BGIA 3AKDA 3HRIA 5GVSA 1UMBA 3TR0A 1NQTA 5TQ0A 5JBQA 5DW3A 1Z63A 3ZK7A 1E3QA 1JG3A 3K92A 3RVMA 2ATCA 2QM7A 4TRMA 2PGIA 2ZZKA 1P2SA 1S4QA 2ZYDA 1IB0A 4Y1RB 2HMUA 1X1RA 2CZQA 1E2FA 2Q4EA 2Z2XA 3P2OA 3MCAA 1P7VA 2WHQA 4UHJA 4WVLA 4OHBA 2R6R1 1E2GA 1XJ0A 3C85A 4MVJP 3AR9A 4EY3A 1SBYA 2RMKA 2ZUDA 1TDJA 3H11A 3VVCA 1RWPA 1U2DC 2EARA 3K0KA 4I50F 1E7MA 5AVQA 4YJ3B 4P3KA 4DMUB 4UUAA 3TJZA 3BTVA 4KFCA 2IY7A 4UBOA 3STTA 5GOZA 3DPUA 2I80A 2J9RA 3OJOA 4G0ZA 1KAOA 4EL0A 1GJRA 1FDOA 4N0MA 1K8ZB 4OXKA 3TMAA 5H4HA 1EFLA 3B70A 3O1JC 4HSGA 2CLKB 1CU1A 4IS3A 3FKJA 4L74A 2YZMA 4AKEA 2IA5A 4TLLB 3L18A 4DZRA 2DR2A 4AJKA 5F3WB 3L8HA 4MPDA 1KYXA 1XJCA 3N2KB 1SQ0A 4HDKB 4I1PA 1WDWB 3GARA 3MFYA 1PRYA 3A1NA 3C6QA 3D1LA 4QG7A 3P1JA 4ZARA 5GM1A 4V0SA 4KR6A 3D1JA 4EG1A 3D31A 4PBTA 4GIBA 4L2IA 3WMEA 3H1GA 4L5IA 3OKPA 5KYUB 1FDVA 1KMIY 3TPFA 1TPYA 1QO7A 4Q3NA 3O95A 2EERA 1GCAA 3IBCA 5EP4A 1PLLA 1CR1A 3FVQA 2EBHX 4IIEA 2QUIA 1HBJA 3V8RA 1J2RA 2IW1A 1MNAA 4M8LA 4BWYA 1PK7A 3H2ZA 4Z7NB 5A9RA 1SXJA 5CDGA 4V2IA 4BZWA 5F4BA 4I9UA 1SNYA 1V11B 4PHTA 4Q9IA 2ZPTX 5J4HA 3VR2A 3H2SA 2XB8A 3PPWA 4O8ZA 4BMSA 1YSCA 2E1RA 2C4UA 3FZQA 2I4NA 4DXDA 3OFND 4CWAA 5ILGA 2UUBB 2I7VA 3FOFC 3AL0C 1Y8QB 4U3JB 3NHSA 2FHPA 3TRDA 1L5ZA 2MYPA 4IRXA 3K0FB 2DLDA 1W8IA 2QRVA 3D8SA 3TEJA 4N18A 2K2QB 5LZ9A 3UEOA 1RPAA 2FKAA 3KEOA 5COBA 1EP2B 1DU4A 4DR4B 4IV8A 1RBMA 3V7YA 1NXOA 2FPXA 2P9ZA 4ZVKA 3V8NA 3KSMA 3UG7A 2FMXA 5B7QA 4WDQA 2WMNB 3HKDB 1QFJA 4IRMA 3ER6A 3T5DA 2YW2A 1JTVA 3OSZA 5K6AC 1G2PA 2HADA 1XC7A 3FM9A 3IR5A 5L3QB 1P2UA 1RJFA 4AY3A 2WU1A 1NJ8A 5LZ4A 4O3MA 3ZGVA 2C8VA 1OU0A 5EIBC 4C06A 3E7WA 1JIUA 3O7WA 1VMEA 1RYNA 3CF2A 3FUUA 4HL6A 4JSYA 4AMYA 2YC2C 1K6EA 5CA1B 4ZWNA 4AKHA 4WJLA 4XDZA 5KDLA 2O7SA 3FHLA 8MHTA 1SKAA 3DF7A 3V8BA 4EKGA 1MQSA 2YWRA 3R9XA 3W2EA 3KVOA 1CIPA 1CUBA 2HNKA 3GPDG 1WF3A 3QOXA 4GAEA 4CF6A 5MN5A 3VNSA 5AW7A 5JI2E 1N2BA 5A4FS 1Q0SA 2XT9A 4IHQA 2BM1A 2RGAA 1CR2A 4F5EA 1P0PA 4K6HA 4IIJF 4RSMA 1OX4A 5IMBA 4D3FA 1U9IA 1TAQA 4PCVA 3BL5A 1SIUA 2BFFA 3IAM1 2ZTLA 3M4NA 3NM6B 1LLUA 1QVZA 2WUDA 3CSDA 1XLTC 3ONVA 4MWZA 3DEYX 4DIBA 5BUZA 1UDRA 1R5NA 2IHTA 5D85A 4C0SA 3E9MA 3CWZA 3SNHA 1J07A 3IHKA 4R1OA 3TLGB 2O3SA 3FDXA 3P2EA 4YXWD 5JCXA 1NSYA 1T36B 2PBLA 4TOIA 1RXVA 4LK3A 1W8DA 5ELLA 2CE2X 4D6YA 3KU4A 3LUBA 3OUTA 3SVTA 4MIKA 2QJWA 3GBSA 1ZUD1 1RRKA 5C51B 4EPVA 5TQJA 4RKRA 2J67A 2QE7D 4QSHA 3SYTA 1V7PC 3AFHA 4WA7A 4BC0A 3OJCA 1M2WA 2P9BA 2XGGA 3DO8A 4RTQA 5JEDA 4QA9A 4S04A 1RRMA 2PT9A 3NM4A 3PQDA 5MHTA 3TLAA 3EEIA 1Z83A 3S2SA 4UUBA 1NY6A 2XMRA 3OCJA 4Q4AB 4B47A 1L4EA 1DX4A 2BDTA 3JZMA 1TQ2A 4G56A 4CEIB 1FF9A 5G0SA 3B3QA 1R66A 3ECSA 1WQ4A 3LKZA 3PA6A 3KKZA 5AP9A 2PXHA 1K7XB 4MIEA 3S2YA 3VNAA 2HIHA 1Q84A 3WQRA 1MX1A 1SG0A 4Y9SA 4XWWA 2OFFA 1ZZEA 1VG1A 5CNJA 4HPWA 1WW2A 2VH1A 4PN3A 4HGZA 1OVGA 3VJRA 1RBYA 2I67A 3NHPA 3QMWA 4YJ2A 2FRXA 4KXMA 2NP7A 3Q98A 4PC1A 4H59A 4IINA 4O2LA 1GNVA 1YCDA 4EGAA 3WNZA 4Q5IA 4QDKA 5EHIA 3UY4A 3IPRA 4YMWA 2FQQA 3ZWPA 3EIFA 1JQDA 2LKCA 3WGVA 2OSBA 4J0EA 4NMMA 4W8HA 1L5NA 3UJ8A 5DGCA 4FWTA 3VKHA 2I6XA 4PZUA 5CFMA 1DCTA 4I2NA 4G8BA 4UREA 3KTDA 4NBWA 4PFSA 4Y9TA 5FPYA 3C6ZA 4R3WA 5DLQC 2F55A 1OBOA 3OCVA 4JC0A 4WBNA 1Y9AA 5AVTA 3VJMA 4V0KA 4QG3A 1ZI9A 1VCIA 2DXIA 4OHWA 1K97A 1OT3A 3FDJA 4ND8A 3TAHA 1BX3A 1DEKA 2CK3D 3W9BA 3DLPX 3FGOA 4XA8A 4MVJE 2AMLA 3QE4A 4CM5A 4UOZA 3K70C 2FDCA 4JXZA 1KYQA 2DQZA 1FNNA 2C20A 3R6WA 2ROQA 3AU8A 4JDUA 1Q6ZA 5DWVA 1YAHA 2E3JA 4PPYA 4Y2JA 4TZ6A 3O2NA 4FFBB 1MXFA 2RGRA 3PWZA 2H29A 1L6IA 2A9VA 2O8FB 1Z39A 3C4JA 2AN9A 2O2DA 2FR1A 3EEYA 4J0KA 1SPXA 5SV2A 2PUFA 1RJ9A 5C2JB 2QVYX 4CM1A 5FWYA 2GLXA 4MARA 4WZAB 3DE2X 1UXIA 2QVCA 4BJ6A 4EZIA 5IUJC 3HPQA 1E59A 1OH8A 2AMYA 4UNSA 1FXWF 2ZRJA 2YHIA 4CL0A 1YJXA 4N65A 4KAXA 5LDGA 3RU3A 5DGHA 4MGEA 4ESVA 3UMRA 3PHHA 3RIEA 3GRUA 3ZH2A 2OVFA 2BZGA 4PRKA 2FETA 2PD4A 3G68A 3ZV3A 3EW7A 3JQBA 4IF6A 4L4YA 2I66A 5FQNA 3WIUA 4EW2A 1ADYA 1I01A 4E6EA 2Q5LA 3NNSA 5B2ZA 1I6KA 3G8CA 4M1OA 1HFEL 1XJQA 2RONA 1DXQA 3RQSA 1YC5A 2LDBA 3BWXA 4WV3A 1SXGA 4DBLE 2BBOA 2HWKA 3QBEA 4NQRA 3RAEC 2DMRA 4UZSA 1RQGA 3SQDA 5HJ5A 1JLLB 3DWIA 3EXAA 4HMOA 3ZHVA 5BVHA 2Z2IA 4DUGA 4JN6B 1G9SA 1OLXB 1PE0A 1CUCA 4OOFA 3RG2A 2O2XA 2ODQA 1I2BA 3QX7A 1Z5PA 5J5VA 3DHVA 4QUEA 2I8AA 4W5HA 1FOEB 4HAUA 3CXUA 3WLAA 4ZOCA 2X22A 4G01B 4M9XA 1K3FA 1E8DA 4D44A 4JJAA 4DDVA 4FC6A 1QU3A 3PHCA 2GZDA 3COPA 4CM3A 1VE3A 1XMPA 1ZOLA 2BEKA 2GA9A 4CT0A 3DQQA 2WE7A 2YVLA 4BVBA 1NQ5A 1A1SA 3NHZA 3RVJA 4KO1S 4OJTA 3A1EA 4LRXA 3AOGA 3PEVA 4JC4A 4R9UC 4C0JA 1CUWA 1KR5A 2OUIA 2C5GA 2NO5A 4EG4A 1K4KA 3IBFA 1RBQA 3QVLA 3D6VA 4JYBA 2ACWA 3UJHA 4PR0A 3D2AA 1WXEA 1NI4B 2JZNA 4MS4A 3FSGD 1N5LA 4X7RA 2VYQA 4WJZA 2XWPA 2J6BA 3EDYA 4Y2YA 5JWHA 5G40A 3LT1A 2NV0A 4YAWA 3K6KA 4FDUA 2VK8A 3NALA 1PZFA 3LQ1A 1HOTA 3AFNA 3MXTA 4L57A 3NWOA 4KGZA 1X6VA 4BRSA 4C7MA 2A5JA 1JKJA 3N6XA 3E0XA 4JUAA 5CX4A 4Q12A 2HI0A 1OE0A 4MQ4A 1LWNA 2WK1A 4LGYA 1YZKA 3K6JA 4G1BA 4Y2UA 3WHKA 1DLJA 4FDMA 3IXMA 4K9QA 2OBBA 2PVCA 3C70A 3CRMA 5CP8A 2G9NA 1ZMTA 1E2QA 4XI9A 4YREA 1ZQ1A 1F5NA 4OXNA 4L16A 3O0TA 3UT0A 2PGNA 3M1IA 2JIRA 1E2JA 1KKUA 3T9EA 1UDBA 4K0KB 1PJBA 2QRKA 1VJ5A 3EVNA 3KR1A 4K3VA 3HM2A 3PFIA 3FN4A 4EF5A 3SQXA 4E94A 4JUCA 4M3NA 2G07A 4P4SA 2OYCA 3Q10A 1LTKA 2ICAA 4C5CA 2GD2A 3CG0A 1VCMA 4E08A 1IXSB 3N2GB 4LS3A 2IITA 4B6PA 4RV9A 2OP1A 3BFKA 4HF7A 1CY4A 2A6PA 4K81B 4QECA 4E14A 4YUYA 4F93B 2VZEA 4HVCA 1XTZA 4TL9A 4DG5A 1AQYA 4HNQA 3CB2A 4TXMA 5DNCA 2ONKA 4FXPA 4Y9DA 5AK3A 1UDXA 2PLAA 4F8EA 4A23A 1RXUA 2WIDA 2P6PA 2C4VA 3ZTWA 3RTDA 4ZJUA 3GVIA 3TNFA 3I34X 4NONA 1PJZA 2Q45A 2VRNA 4K6KA 1YL6A 5EAIA 2Q4RA 1AS3A 1MX5A 2M6KA 5LB2A 2YV4A 4Q3BA 4R1SA 2RAUA 2C2YA 3G2LA 3CVOA 4URYR 1SB8A 1YRLA 2AXNA 1PWHA 4B0OA 2R11A 3MELA 1YR9A 5BRNA 1LRKA 7ABPA 2QHXA 1QR2A 3P9RA 4BNXA 1KORA 4OD0A 3BXGA 4REMA 2Z4RA 2MCFA 3A1SA 1XV5A 3WIDA 1CQJB 2A94A 1GT6A 4UNQA 4B6GA 3U6KA 3BDIA 3U9SA 4FX5A 1HQCA 3WLEA 3M4YA 1UMDB 4FCCA 4G4IA 4MRMB 3R5KA 3PT5A 2IHNA 4CCWA 4D41A 1SUSA 3PD0A 2GZ1A 4XH9B 5IAOA 2ZVPX 3QX3A 2C5SA 2WSMA 2F1JA 1NUTA 4H1VA 2JFGA 2DWQA 4DLZA 1TEHA 3WMFA 3G5TA 4N3CA 2A30A 1N32B 3R0IA 4YJFA 4LPKA 1ZMXA 3B6IA 2CEKA 4IWXA 5THXA 4E5KA 2V1XA 2VUUA 4NAVA 2L0XA 4KI7A 2JVIA 1UOEA 3SNKA 3ZU3A 1P77A 3K9GA 5B2FA 4EB6A 2ZTHA 3BWDD 2O2IA 3R7DA 1WKVA 1Z2AA 3RBXA 4DR2B 1QXSA 1M1YB 1T5IA 2WR8A 2P3SA 1CRPA 2C94A 3AI3A 2X5OA 2FG7C 1HNXB 2BFBA 2P1RA 3KKPA 2EZUA 4L85A 3E9CA 2A1TR 5BSWA 3Q8MA 3ITDA 3S5JA 3LDAA 4FQ5A 3TB6A 4YRAA 1JLRA 2ZM6B 1QK3A 3WDSA 1ML3A 3F73A 3E9ZA 3EQ8A 4RCVA 1T15A 3B8HA 3GLHE 4Q4HA 2X23A 4P83A 1E1RD 3ESAA 4KLCA 4OMCA 4CUKA 3VTFA 1EK1A 1HLGA 3EOZA 3F97A 4KNWA 4PZ9A 4F4DA 4PNHA 2FSHA 2R00C 4Q7LA 5JLAA 1ZWKA 4FMDF 4S0ZA 1EP1B 1G20E 1LK0A 1P1CA 4HY3A 4O2AB 1Z18A 3N70A 3OQJA 2GDZA 3I9FA 5LL6P 2WUGA 2PUDA 5AUPB 2ZI3A 2I6FA 5BO5A 2LCFA 3SSNA 3HJGA 3HR4A 5E6SA 1YBMA 2DPHA 1VLQA 3FLAA 4BVAA 4KVGA 1EBFA 3HU2A 1U6IA 4M49A 1WY5A 5K6RA 4J0HA 1X1BA 4UCWA 5IVHA 3A4YA 4MYCA 3UJPA 5FDFA 2ZBEA 2BMFA 2O07A 2AFIB 1W36D 2DEUA 1J90A 3M6IA 3DUFB 1YR8A 4RGVA 1S1CA 1LLDA 1ZHHA 4FOTA 4Q3KA 4V03A 4AT1A 3ZGYA 1Q57A 2WYHA 4RHTA 2CGEA 2YRXA 3AV0B 3KAKA 1ZD2P 1MB9A 4OMDA 1R16A 4M0UA 3H1EA 3VPSA 3ZE8A 2F6RA 5EXTA 1ESNA 1K8YB 2KM1A 2BMWA 3HJNA 4FMCF 2BLLA 3T3PB 4C3ZA 3RVBA 2BUCA 3L2OB 1QTNA 4LGMA 2OCIA 3PTZA 3S0JA 4ARSA 4X6YA 1EFVB 4S35A 4BNFA 7YASA 2VCYA 4CLRA 5ED4A 1TGVA 3NIWA 4I4TB 4KC0A 4P36A 8OHMA 1ZH6A 1KTIA 4EGQA 4QJ4A 3F1LA 1QMPA 5AHRA 4RJLA 1Y3DE 4CMCA 3NM5A 4ER5A 1FW6A 2RCYA 2AN4A 3E5NA 4Q1AA 5HCIA 2QYTA 2KBFA 1S3FA 2HMYB 1BOOA 3KT0A 1ZO8A 4MRNA 4GPD1 2ES4A 4PRZA 4WGGA 5D2CA 5H7XA 3WKBA 3WQHA 2VXCA 5IYZB 1TQHA 1VLLA 1BNCA 2YC4C 3F7OA 2VHJA 5F9MA 1L3IA 5C34B 5F64A 2P77A 4ZEOA 3ZBPA 5B2EA 2GZHA 1KPHA 1E18A 1YZ3A 2CD9A 4RDCA 5IAGA 4D8XA 4ZGWA 3ADBA 3L4KA 5I01A 3U09A 1IUKA 1NIJA 5HJ2A 4ITUA 1WSDA 1QU2A 3H5NA 1L4LA 1JQAA 1D8AA 2R6HA 3C7TA 4R2JA 4S3MA 3SC4A 2BP7A 1G18A 2GJ4A 4CG2A 1ZHOA 2D7DA 4QGSA 2BJHA 3GLFA 1Z56C 1Q0QA 5LWQA 1DRUA 1Z28A 2O3JA 5JQGB 4OHZA 2VCHA 3H42B 2ZUTA 2AWOA 5TS2A 3OTHA 2NIPA 4BNWA 3E9RA 1UEIA 1S4MA 1V8DA 5IASA 2XMZA 1N6IA 5FUVA 3ETCA 5F2NA 3E48A 1SHJA 1LPPA 5EJ9A 4YT2A 4YJ2F 2AA3A 2I7DA 5CURA 4NEHB 5CEEA 1PTJA 5DRTA 4BKUA 1OLOA 5C80A 4M98A 1VSTA 4FUQA 1N1MA 3IHWA 4PZ0A 5JAHA 2JCXA 5JW6A 1J42A 2JASA 3DZKA 1UZNA 4I1UA 3ZWOA 5A03A 5KTKA 4GXQA 2BMEA 5D8DA 1TU0A 1XRQA 1NBME 2VDKB 2ZYVX 5DYTA 1KJWA 1S2IA 2FE4A 2OFPA 3AKYA 3IV9A 4MV1A 1TMKA 1C7RA 1ISGA 1HDZA 2X40A 3EGXA 4ZCTA 1N92A 4FI3C 5EZYB 4D26A 3BL8A 4HFMA 1ISSA 4JY7A 1FQKA 2XTJA 2JANA 4UE6A 4YO7A 3TCNA 2D2EA 1E2UA 4PWZA 2QG9A 3BIWA 4BLQA 4Z7OB 5CPFA 1RQPA 5FD8A 2XHZA 1L5KA 1O08A 1FYVA 2MSWA 4YBRA 2O5EA 3NJRA 1GITA 3PFHA 1X9HA 4TTIA 4IDNA 2XZLA 2YXEA 4HDCA 2Q2WA 1NATA 4ZI7A 2YS6A 3FCEA 5AW2A 4Z53A 4EJFA 4F38A 3O3CA 3HM9A 4GKJB 5ILQA 3V4FA 2RGUA 3MGCA 3OKFA 1U8YA 4EY6A 1DO2A 5M5BA 4R40A 1SUBA 2OV8A 1UP7A 2NSYA 3G2QA 4CGZA 3RSCA 3H83A 4BHTA 5K0EA 1T13A 5AQEA 1YQTA 3SZUA 3K6SA 5AM0A 4O4JF 3W2IA 4N49A 1MXHA 1PT7A 1OQAA 4QTUB 4U7HA 4EVSA 4ZVOA 1Z4IA 3S1LA 4CL3A 3GWZA 5I9SA 3E9DA 1TJ4A 2PQ0A 3EGXB 2GPAA 4A03A 2W2VA 4CKEB 1Q7EA 1PR6A 1EHYA 1VGRA 2D59A 4CE6A 4P92A 1T0JB 1NNUA 3S28A 3BXXA 4I46A 4F84A 3GLUA 3VX3A 1HTTA 1UWCA 1T2NA 2WPDD 4EW6A 2VT3A 2LVBA 1LS6A 1JHQA 3KZCA 1W94A 3TIXB 1MA3A 1Z6QA 1IEXA 2C95A 2IZOA 1ZJJA 2JIMA 3F5QA 4BKQA 2WSSD 4CEJA 1GNLA 1TM4E 3V4ZA 3ZCRA 2ERYA 3PUWA 4ZKDA 3E8SA 1M2EA 1P5JA 3OZFA 4XUCA 3D5QA 3MT7A 3REGA 3J7AC 3GLFB 4U4AA 3UUGA 3U44B 1LBIA 1U7OA 4D9KA 3OJXA 5LR6A 2BSQA 4IDAA 2Q49A 3AJ8A 3SY8A 4R5MA 1EFRD 2WU8A 4YAEA 3ROPA 5LYJB 4RIHA 1AKUA 1ITZA 1CKEA 4P84A 5F1KA 1IM8A 3LQQA 3P9PA 4RHUA 5K0LA 2WNHA 4HDAA 1O95A 5TVKA 3SU8A 1XDGA 2XI4A 4RJIA 1NKVA 4GGOA 3T3EA 5HKKA 4Y3UA 2QVZX 2YIVX 2WIJA 2J3LA 1X9IA 3OE4A 3S99A 4QNMA 4AAYA 5CA0F 2QM8A 4Z5XA 4GR9A 4DCVA 3BWMA 3DKPA 3MTGA 3LPAA 4L3VA 8ABPA 2PUWA 1ZXBA 1JA0A 2N47A 1CY6A 1U1CA 2XKKA 4DT1B 3BVPA 3GN1A 3VR2D 4OQLA 4QYMA 3A4LA 3DLAA 4RD4A 3W2GA 6ADHA 5CD1A 4CF3A 3B6KA 4E5SA 2W2LA 2A9QA 2C3OA 3TBFA 1HE3A 2VQSA 2JPDA 4S05A 1G3MA 2MIIA 4JCOA 2H16A 2UAGA 4QEDA 5BOSA 5LZ5A 1R2QA 3P2KA 1HDCA 4WFIA 1TYCA 1ESDA 2QD3A 3FPHA 1FK8A 3HC7A 3LVFO 3OJWA 2R1TB 4DMCA 3E53A 2PD6A 4R51A 3QHPA 5CLIA 4DTIA 2IV2X 4KDFA 2IF2A 1QJ4A 3WLOA 2N42A 2JFHA 3DUFA 3W5JA 1H2RS 2YWEA 3FAKA 4NH0A 4EA6A 3JQQA 4JEMA 2AI3A 3F49S 4HQOA 3NX4A 2C9MA 2C03A 1RDFA 3DL0A 1A2OA 5TQ2B 4DAEA 1OI4A 3HGMA 5ELXA 1KBZA 3WX0A 3CLTC 1NVFA 1QZUA 1ZNQO 1YOVA 4M8NE 1W1UA 1CQPA 2CNLA 2DUMA 5JJLA 1YIAA 1BEZA 1RHRA 3IT0A 4RQAA 1D2RA 1SK8A 2ZRMA 3UKJA 5IC5A 3A6PC 1TAUA 1Z25A 1GPAA 4NCHA 2WDPA 5K0GA 4JJGA 2GWRA 3K4QA 4YBZA 4YRGA 4HQ6A 3G1UA 1D3AA 2GM3A 4QLAA 4YAGA 2FSGA 1VIMA 4WZBA 2YZKA 3JQGB 2M1XA 4HVLA 1E2NA 4FFLA 4MROA 3LL7A 4W5TA 4Q4HB 3TAXA 3GJ3A 5AVUA 4WKBA 4MWDA 1NV9A 3X2FA 3SFTA 4DR5B 3SX0A 1W52X 3AC0A 4V1CI 5DV9A 1DKOA 1F2TA 2QR2A 1M2JA 1UK9A 4QU0A 1CSEE 1KZ1A 3IELA 3BM5A 5IG2A 3KAJA 1XQXA 3GCGA 1L7BA 1Q1ZA 2WMDA 3K9QO 4JC5A 2W2KB 1E2KA 3N3BC 3PI6A 3AYZB 5EIWA 3ZV7A 2VNAA 5C5IA 2HMTA 2A7XA 2O7RA 3WMXA 3RB8A 1N0IA 1WDKA 3LP5A 3O4GA 4JL6A 4DWOA 5CLFA 2MSLA 3KXIA 1J9GA 5GAJA 2YZ7A 2AYYA 3V2IA 1LFAA 9LDTA 3FTDA 1TADA 1M1ZA 1PZXA 1E2MA 5DYIA 5ES3A 3RTGA 1NLMA 2CLHB 2DZDA 4Q24A 3O8QA 2IYTA 3IVAA 4A0GA 1YGPA 3OD1A 2CV1A 3TJMA 1XJWA 4UQOA 2AVDA 1E3LA 4JXXA 4F60A 1NJ5A 4PLVA 5BYAA 1B6TA 1CZNA 1GPKA 2J33A 4NEGA 1UMDA 3ZG6A 4G0VA 1M5RA 2CD7A 7REQA 2XYRA 3AF1A 3TGLA 2EFYA 3JD2A 3E05A 1BXRB 4F4JA 5IEJA 3SX4A 5LJLA 2NU7B 4UJ5A 1J8YF 3OX4A 1SU7A 3N2NA 1H23A 3VFDA 1USIA 1D2NA 4TYNA 5F33A 3TECE 3EC1A 1Z08A 2YN2A 1P33A 2QGNA 1XKLA 3S1AA 3IE0A 4R84A 1SB9A 2CBZA 1YB2A 2HQSA 4KGDA 4WN9A 3DV0A 1SKYB 4C22A 1TM2A 4XEHA 3DEAA 3K30A 3PL1A 4PG4A 5CH8A 5E7MA 3WYDA 1Z38A 8ADHA 4PXYA 1CFZA 3SFVA 2NYAA 3EXG1 3RASA 1T0PA 4IW3B 4PGGA 4OLBA 4D4JA 3ER8A 5DSXA 4GMFA 2GAIA 2W93A 4UDOA 5F23A 1KAEA 1QGDA 5DFAA 1IH8A 1TQ8A 3P8ZA 1KRXA 4R31A 2DB3A 3WLHA 5A7HA 3LIIA 1NMSA 3UA4A 5F12A 4I1OA 1JHPA 4DW8A 1CZUA 4OUDA 1E9VA 3EMBA 4UJ3A 4KFRA 4M7OA 4YECA 1RAIA 1RXSA 2LV8A 4GSLA 2VJBA 4XOIA 5TMBA 3E3OA 1KIMA 4B87A 2Q3MA 2R5NA 3LNCA 3LZCA 1XWFA 3DL4A 2ZT8A 4GRAA 4O4HB 1OOEA 4E88A 3ACBA 1UM9B 3ISJA 3KM0A 3M81A 4KBFA 4LDRA 4P0QB 1FJGB 4RZIA 3DE5X 1OCEA 3V8VA 2A5YB 3ZTTA 1SUDA 1IN5A 1E1QD 3WSWA 2A14A 3H2JA 3BCUA 3GR6A 2BD0A 4HWOA 4I3FA 2PX5A 5BT9A 4CTKA 4CQMB 1T9HA 1CNFA 1B8PA 1QWSA 2W6MA 3V34A 6AT1A 2I4LA 1CRZA 4FI3F 5MDHA 5DM70 4FNAA 4JT2A 2W48A 4BOYA 4G8CA 2IYQA 3LOUA 4KU4A 1QPBA 4RESA 1N2CE 3NHUA 1JJVA 4P3XA 3EX7C 4TKVB 1V9LA 3RKSA 1K0UA 3PICA 4NU6A 5E6UB 1CK4A 1X7ZA 1W59A 4O63O 5GINE 1XZDA 1LJ8A 4ZREA 1U2TA 1DAEA 3OQ6A 1II8A 1R9MA 5HF8A 721PA 1H4TA 2I7XA 1L7PA 4P7JA 2YNMC 3KR2A 1RZ3A 2P65A 5LDHA 2ZROA 1T2VA 1B2LA 2I6GA 1NI4A 2SKCA 2X6TA 3MS7A 3U60B 2O14A 2OD7A 4PVDA 2YRFA 1Q1BA 1Q92A 3TXVA 1TUEA 1GNPA 1QFMA 4RHFA 4S1PA 4UAVA 5EKDA 2D00A 4WXRA 3A25A 3F7MA 1WUKS 2P2YA 3IKVA 4J90A 1CX9B 1YH3A 3FX2A 4N0PA 5JT1A 1DKPA 4DLVA 2NZWA 1FX0B 2PH1A 4ZHQF 1IPFA 5J58A 3FOEC 4LVUA 3HYLA 3QQ5A 1R4ZA 3SHOA 5JD6A 3ICEA 1U9JA 1PEKE 2PS3A 4D0GA 1RHKA 3G89A 1VZ3A 5EIXA 1JR2A 3O6VA 4DGSA 4ZRNA 1IN1A 4Q9AA 3MUFA 3CTPA 3DNMA 3CXRA 3ZHBA 4D3DA 3BXFA 1B00A 2I0FA 4O2AF 3U7QA 2Q3HA 4D9BA 2D4AA 5A2GA 4W5QA 3RS7A 1RLMA 1T5TA 1M34E 2JRLA 2WWIA 2AKYA 2C8KA 5CYFA 1MORA 4CU2A 5BVHB 1ZUNA 5H81A 3OLZA 1VSUA 2XGSA 3TOZA 2NO1A 2V6IA 1JLLA 1NU6A 3PCTA 2YASA 1NUHA 2EZ8A 4EO9A 5KOIA 4MVJD 4X95A 3RG8A 1G98A 3DR3A 4QBIA 3D4IA 3KEGA 2V7EA 3L1KA 3WRXA 2BTOA 1KYIA 3ILVA 2AX4A 4BEWA 5FPKA 2XEDA 3ID6C 4X41A 3FWHA 1J7KA 1HQDA 3IEMA 4CLOA 3DMRA 3QV1A 2VJMB 3ESBA 5HTKA 4R54A 2AHOA 3KJQA 3AR3A 3CZQA 3BQNB 4CG1A 3A3PA 1QONA 2YHIB 4F4UA 3WZ2A 4G26A 3GFVA 2P69A 1QB7A 3FW1A 4JKYA 1F14A 4M37A 3SPXA 5FWYB 2E85A 5AW3A 3ZY6A 5MF6A 1YB4A 2CWDA 2QAGB 4EYSA 2F67A 1VBNA 3IDZA 3W8FA 2AXQA 2HIMA 2WVAA 1P4HA 3KP1A 2Z56A 3G7NA 4JWKA 4MV4A 1W581 1EEXB 3EW9A 4NQZA 5EMJA 2XDQA 1QF6A 3WNCA 2OQIA 3W06A 2OHHA 4LQDA 5C7YA 5EPUA 1TM1E 4FFBA 3UWKA 1KMHA 1E98A 5CNKA 4E03A 5EHGA 4E6PA 2R5FA 1O54A 4P4GA 3RSFA 3TOCA 4Y9RA 5K8VA 4MICA 1NMZA 1L7MA 1EX9A 1U7WA 4C76A 2CZCA 5KJEA 3UF0A 2ZQYA 1U7XA 1Z0SA 1I3NA 4INPA 2Z43A 4WZZA 4DSTA 5FOUA 4OM7A 1GRRA 4RDHA 3CNEA 1ORHA 3FKSD 4H0NA 4IG4A 5DNDA 2QSZA 3FPEA 4MWCA 1E2IA 3JYQA 2W6QA 3D3QA 3NV7A 1L9KA 1QIIA 2FVYA 2HB6A 2JK0A 3GRYA 2HTEA 3I9KA 3QKWA 4IOMA 5CW1A 5LN1A 2E89A 1VLHA 4J16A 3S8EA 3HJUA 5G1PA 4TZKA 5B4VA 1DINA 2EJCA 2H1WA 3E81A 4JBGA 1KC1A 2Q3BA 1J8FA 3M6WA 4WCDA 4FSHA 3AF6A 2NZXA 1QKIA 2VAWA 5G53C 1XU4A 1B14A 3FBWA 3PR3A 3ZBTA 3DXYA 3ZKWA 1TYZA 2OOSA 4LJ6A 4X1OA 5EJ5A 5DTMA 4B6FA 1ATIA 2GH1A 4GT1A 2ZJFA 4LWQA 1RLJA 4YJ2B 5ICMA 3F6PA 5IJ0B 3QWBA 4KH0A 4OOEA 2O1EA 2Z30A 4PCAA 2WG0A 2ADFA 3F4BA 4L5AA 1T1GA 4PC2A 4K5QA 4AW9A 4D8VA 2CLOB 3B20A 3NXKA 5G0VA 1P9RA 1V7ZA 4FOPA 4GL4A 1HNZB 2JCYA 3TTWA 3K8YA 2UVDA 2QY6A 4XPIA 2A0XA 3CE6A 4ZQCB 3LF2A 4YCMA 1FQWA 1E2BA 3G7UA 1LCIA 2GEVA 1V0JA 2XOXA 3RIXA 3G9TA 2JGDB 3L07A 4QXOA 5CGZA 4WMLA 5IFLA 1ZGZA 3BFJA 1Q95A 3EZGA 4L73A 4NTZA 3RSHA 1ISMA 4M9QA 5EYPA 1ISJA 1E99A 3DDCA 4DR7B 4D98A 5AVZA 1WJGA 2CHGA 3Q8WA 2XUZA 2IXTA 3UMBA 4PAOA 3VYWA 4B3DA 5DB4A 5IXYA 2CXNA 3VU0A 4N0EA 4BNIA 1A50B 3L9WA 5E4JA 3GAFA 4ZDIA 2HREA 2P5UA 3OM9A 4N8EA 3T7KA 4J9VA 3TLGA 3W05A 1XD2B 3M5DA 3KQSA 3L49A 2FR8A 1P2VA 2XTNA 4GMKA 2WSYB 4DMFA 4ACAA 1BKSB 2NZ2A 1F5SA 2P9TA 4RYDA 4O4JB 3MERA 4J1NA 4M7WA 2DG2A 3UJBA 2Q0QA 3EIHA 3BMOA 2YNMA 1KJ9A 1GTL1 4UMFA 3KPUA 2AG1A 2IX9A 3EVBA 4NJOA 4PEVA 1SXIA 1GAEO 5H16A 3WB1A 4DPLA 1EE1A 1KFBB 5C4IA 3BULA 1OREA 1HYBA 1NZDA 3JQ7A 3JASA 4DUPA 2D5LA 1Z2DA 5G4KB 4B32A 5ICGA 5HKBA 5HNKA 2ZIWB 1EVIA 1UXOA 3WDMA 3GNLA 3L0ZA 2VG8A 2RH5A 1TCAA 2YV5A 4JQCA 1MQ8B 5T6BA 3O3MB 4WINA 5T7BA 2CLSA 2WILA 3DXFA 1UKAA 2NO9A 4RQTA 5CJPA 2Q07A 5CA1A 1OXUA 3EDCA 1J24A 1DRVA 3KQOA 1FUIA 2BM9A 3GN2A 3IQDB 3LFHA 2AUNA 2VDMB 3PXXA 4MKIA 3TSYA 4ER7A 3HKCA 1QS0A 4E13A 4YWJA 2HX1A