4FISA

The molecular structure of wild-type and a mutant fis protein: relationship between mutational changes and recombinational enhancer function or dna binding
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
73
structure length
73
Chain Sequence
PLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQPLLDMVMQYTRGNQTRAALMMGINRGTLCKKLKKYGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The molecular structure of wild-type and a mutant Fis protein: relationship between mutational changes and recombinational enhancer function or DNA binding.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
molecule keywords FACTOR FOR INVERSION STIMULATION (FIS)
total genus 26
structure length 73
sequence length 73
chains with identical sequence B
ec nomenclature
pdb deposition date 1991-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02954 HTH_8 Bacterial regulatory protein, Fis family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4fisA00
3FISA 2COBA 3RZOJ 2YS9A 3K2AA 2ZB9A 3ZQGA 2WB1N 1HOMA 3RKQA 1TWFJ 3CCYA 4QIWN 5M5YJ 2Y31A 1ZTRA 2CQQA 3BQZA 1ZGWA 2L9RA 2LLKA 3PM1A 1B72A 3S2DJ 1K61A 5K7FA 5EGOA 1UMQA 2FX0A 4RDUA 3GTGJ 1RESA 4IHWA 4D7NA 5GPAA 3FK6A 1BW6A 2ECBA 1GDTA 1RR7A 5DS9A 1JKPC 2M2EA 2OPTA 2EZHA 2XPWA 3H0GJ 1Z0XA 1NK3P 1HCRA 3HBLA 3TEDA 5M5XJ 3Q0WA 5IYCJ 1QRYA 1X2MA 2L7ZA 2EQRA 5J1YA 1K83J 1IC8A 1BA5A 5F08A 4A3CJ 2JWTA 1ETKA 2M8GX 5FKOA 1MBEA 4BY1J 3D1NI 2R0QC 1IDZA 1QVUA 1AKHB 1OCTC 1JT6A 4FE7A 1APLC 3JREA 1MSFC 4MFEA 1ETOA 1XS9A 1WPKA 2HDDA 2CQXA 1FIAA 4Y7NJ 1HDPA 5EG0A 3GTOJ 2R5ZA 5M3MJ 2XPVA 5FJ8J 4MLOA 1WI3A 2EBIA 1MNMC 2ME6A 2JA5J 3A01A 3JRHA 3M3YJ 1ZKGA 2LTPA 4Y52J 4M6VA 5IP9J 1MBFA 2CRGA 4A3EJ 4JX4A 4QSHA 2HXOA 2CJJA 2FQ4A 3O8HA 2XB0X 1ITYA 4LOCA 2JA7J 1YRNB 1Y1WJ 4J19A 2TCTA 2HQ5A 2VUMJ 3BG5A 4A3FJ 2NVTJ 5FKLA 3A02A 3I4MJ 4BBSJ 1SANA 4DW6A 5F1JA 2XRLA 4XRSG 2FD5A 3HEFA 1Y1VJ 3BR3A 3TP0A 1LE8B 4W1UA 5C44J 5J1UA 4CYCA 1NK2P 4XK4A 2IAIA 2Y9YA 1WCMJ 3WHBA 4UUSA 1GV5A 4DZJA 3TW6A 1UHSA 1JJ8C 4A3BJ 5E3MA 1ORKA 1FIPA 4IHVA 1H8AC 1UG2A 1F43A 3GBGA 1NTCA 1JGGA 3S15J 4DYCA 4IHXA 2DN0A 4FCYA 1ETWA 1I3QJ 2W48A 5E3NA 4C3IJ 4GFBA 1WGXA 2DMTA 5C4XJ 2CU7A 1E3OC 3HDDA 3HOXJ 3M4OJ 3E7LA 3JRDA 3CMYA 2R5YB 2L0KA 1ETVA 1IUFA 1GT0C 1Z77A 2DA2A 2DMUA 1VI0A 3RZDJ 1RKTA 2Y30A 4B1RA 4BY7J 3JR9A 1JT0A 3HOUJ 5IP6A 5E3OA 2GBYA 1JUPA 2D5VA 2KT0A 5IP7J 3LSRA 1P7IA 2IEKA 5K7ZA 2WAQN 3TP3A 5EZGA 3W6VA 2EZLA 3LNQA 5K7HA 2DA6A 2KDZA 1U9NA 2QF7A 2AO9A 3BG9A 3IH3A 3GTJJ 1T33A 3HOZJ 5IYBJ 1A5JA 2VKEA 4XRSA 1MH3A 3BR0A 1VF9A 2DA1A 4D5FA 3S17J 1H89C 3DEWA 2LVSA 1FTTA 1JTYA 1JKQC 1OCPA 3CQZJ 3F0CA 2DA5A 2CUEA 2E19A 1JUSA 1ZR4A 2JA6J 3C2BA 4UUSB 1VNDA 1HF0A 3HGYA 4AC0A 1TC3C 2H8RA 1A6IA 1X2NA 5BNGA 4AUXA 4C3HJ 5E3LA 1WH7A 2DMPA 4AYBN 2NVXJ 4EEFG 3GTLJ 3QPLA 1TWHJ 5C3EJ 3BT9A 2TRTA 1P7JA 3JRGA 1BL0A 2X9DA 2QCOA 5C4JJ 2R7ZJ 3FK7A 3HB9A 9ANTA 3BR5A 3RQIA 3MVPA 5IOYA 4JX5A 2IBDA 3JRFA 2GM4A 1POGA 5F27A 1W0TA 3LOCA 3WHCA 5IYDJ 4M3GA 1ETQA 4G12A 3BR1A 2XGDA 1YRNA 2ID3A 2R5ZB 1QVTA 1QPIA 4MIMA 2XPUA 3BTLA 3G1OA 4UUTA 1RPWA 2HXIA 2L7MP 5FLMJ 3B6AA 2HOTA 2CUFA 1U8BA 2XSDC 2NS8A 5M3FJ 2I10A 1JUMA 3A01B 3LSGA 4I6ZA 1AHDP 2LP0A 1MBHA 2ME0A 3S1MJ 4D7MA 3GTKJ 5F0HA 3S16J 5EG0B 4A3MJ 2JA8J 5JLWA 2LY9A 3LSPA 1G2HA 2K9QA 3SJMA 2EZIA 1LFBA 3JRIA 5IOZA 5GP9A 1VFCA 1AKHA 4FE4A 4A3LJ 3DCFA 4S0HB 2VI6A 5EF6A 2DJNA 3GTMJ 1AU7A 2DA7A 2HOAA 1FEXA 2K9SA 4M3EA 1ETXA 1IDYA 2H1KA 2DA3A 3QPSA 5HODA 4QTRA 3K7AJ 5GPCA 1RKWA 3GTPJ 5EYRA 2E1OA 1ZR2A 3JRBA 3UKGA 2XB5A 3L1PA 3O8GA 1GV2A 2Y0SN 2K9NA 4JP0A 4W97A 4L5EA 1IRZA 2O7OA 4B3AA 2E2IJ 1WH5A 1FJLA 3H3VK 5JLXA 3ZQFA 1HDDC 2ECCA 3Q3SA 1ZK8A 2WV1A 4M3FA 4M3DA 4XRMA 3NAUA 4CYCB 5EGOB 1W0UA 2ID6A 3IH4A 2LK2A 2NS7A 3MKLA 4RBOA 1LFUP 5EDNA 2E2HJ 3GTQJ 2HI3A 5FKMA 1BW5A 2VPRA 4XIDA 3JRCA 2DMNA 3VPRA 1B72B 2JN6A 2AHQA 5F0FA 2MGQA 2LR8A 2ELKA 4I76A 1OJLA 2JMWA 3PO2J 3S1RJ 1O4XA 1IJWC 1DU0A 1GVDA 4M3BA 2M34A 2NOGA 2MW8A 4DZPA 1TWGJ 2LFBA 3HGGA 5J3LA 4A3DJ 5FKNA 5IPAA 3BQYA 2GLOA 5F0CA 3ZQCA 1DU6A 1XG1A 2OF7A 5FLVA 2LKXA 1MBGA 1B8IB 4BKXA 3CDLA 3SFIA 2EH3A 3OIOA 1JKRC 3S1QJ 4D5CA 4A3IJ 2O9LA 1JKOC 3S2HJ 4C3JJ 3HOYJ 1BJZA 4V2FA 2YUSA 4BXXJ 1MBJA 1X58A 1D5YA 3HM5A 5F04A 3OSGA 5EZHA 4MO7A 2G0EA 2X48A 3NARA 1H88C 1FTZA 1IV6A 2X6OA 4IEJA 3LSJA 2DA4A 3IH2A 3S1NJ 1MBKA 2K40A 4JYKA 4NDLA 2M9HA 1PUFA 1IGNA 1TWCJ 2XGCA 1MSEC 4FISA 3FIWA 2Y2ZA 3BTIA 2PMZN 2RAEA 3S14J 2YU9J 5EEAA 1ZQ3P 1Q1VA 3BR6A 1SFOJ 1U9OA 3I4NJ 2LD5A 3SDGA 1ETYA 2HYJA 5FKKA 4X6AJ 1U78A 2DTZA 2O8KA 3BR2A 2XGEA 1PUFB 4B4CA 2NVYJ 1XC5A 4FTHA 1S7EA 2P81A 5J1RA 1I50J 1HLVA 2B63J 4A3JJ 2R5YA 2MSYA 3JRAA 4A69C 2JJ7A 2EZKA 3PO3J 1OFCX 2M0CA 3Q0VA 4JX6A 4A3GJ 3BG3A 3HOVJ 1JJ6C 5M5WJ 3A03A 4HNVA 2E2JJ 3ZQIA 3HOWJ 1CQTA 3BTCA 2HOSA 3TW7A 2DMQA 4A3KJ 3Q0UA 2NVQJ 4ABZA 3G1MA 2JK3A 4X1EA 2MG4A 2Y9ZA 2R92J 1RETA 3MN2A 3BTJA 3FKIJ 4DYQA 1MH4A 1F36A 1IG7A 1GUUA 3QQAA 4C2MJ 4XICA 4A93J 3IV5A 1ENHA 1I6HJ 1TWAJ 1LE8A 4V2GA 3OSFA 4DYRA 1B8IA 4IHYA 4MFDA 2L7FP 3OOUA 3B6CA 2FJ1A 5DTDA 2VKVA 2R93J 4BBRJ 1JTXA 3ZOBA 1R9TJ 1EF4A 3G1LA 3ZQHA 3ZQLA 1T56A 2N8GA 3HKZN
chains in the Genus database with same CATH superfamily
4HF1A 2O61A 2ZB9A 1P4WA 3V8KA 2JQ7A 3L2WA 2H09A 3QRFF 1FYMA 2CQQA 1IV8A 2LLKA 3PM1A 4CSWA 4HW0A 3BG6A 1K61A 5K7FA 3WTUC 1IN5A 4ZH4F 4N9HA 1U5TC 4KYWA 4IHWA 2VN2A 2P4WA 3BJ6A 4D7NA 1H0MA 1MMSA 1R1UA 1DP3A 1XSDA 1RUOA 4RM2A 2ECBA 1ULYA 1ZLJA 1GDTA 1FWZA 1RR7A 1KU7A 1YJWI 2OPTA 3DKYA 5CKTA 4IRIA 3BZ6A 1NK3P 2MYSA 4RAZA 5M5XJ 1QRYA 2ELHA 1YO5C 2GIVA 3I55I 2JPBA 5LD2C 1FOYA 2EQRA 1MMDA 2ZXHA 3TBIA 2R7DA 1WJEA 3NEUA 3E3VA 3GEZA 4KT6A 2HU9A 3WG9A 1A35A 1ETKA 2DXIA 5D5VB 4BDZA 3FWEA 2D1HA 1QA6A 2BYVE 3D1NI 3O6BB 1QVUA 4FE7A 1APLC 3ZN0A 3JREA 1MSFC 1K79A 3KX2A 1XS9A 3I56I 4G6TB 1LQ1A 4EM2A 2GXGA 5B1AH 4P5OA 4Y7NJ 2H8WA 3OIQA 1HDPA 5EG0A 2R5ZA 3DEEA 3HKZA 1WI3A 1VQ5I 2ME6A 1XN7A 4F93B 2JA5J 3OYBA 3W2AA 4S05A 3KYDB 2ETHA 1MDMB 3DP7A 4QPQA 2LTPA 1UAAA 4AVPA 5LRSA 1OMIA 4QSHA 1W7PD 4PFPA 2HXOA 3K2ZA 2CJJA 4CCJA 3J80K 1IXRC 3LSKA 1YRNB 3NQOA 4IJAA 3OYGA 4J19A 1Y1WJ 2W57A 2TCTA 3OOPA 2EIKH 1YG2A 4L18B 2QSGX 2NVTJ 2DQRA 3LFKA 4U7BA 5FKLA 1W4MA 1NG6A 4LG3A 4XRSG 2FD5A 2NS0A 3ZQQA 1D0ZA 1Y1VJ 3ZMVA 2F4MB 3OIPA 5C44J 4IOAF 2CV1A 3ZPLA 3GFJA 4XK4A 2CUJA 4F52A 3HOSA 1WCMJ 5B5EC 4UUSA 1MIJA 4PGGA 4DZJA 2A61A 3I58A 3WTSC 4UVBA 3RYRA 4M6XA 5E3MA 1JJ8C 3LSIA 5F64A 1TL8A 5J4YA 1UG2A 3G2BA 3GWZA 4MTDA 1BM9A 3MCZA 2PI0A 1J2XA 1OYWA 3GX4X 3H9QA 1FNNA 5IT3A 2FE3A 2P7VB 4RAFA 3E6CC 5FD6A 1R1VA 1UFMA 2OC6A 3C1DA 3QPTA 1VZ0A 1EV7A 2VBXA 4OMZA 5E3NA 4C3IJ 2EA4A 1WGXA 2OQGA 1B59A 2CU7A 3E97A 4A12A 2LY2A 3I53A 4J00A 1NH3A 1IO2A 1USTA 4LIUA 2ZNZA 4ZYGA 4XLNF 2PJPA 1YW9A 2VJIA 3IKVA 4BXUA 1RR8C 1J0RA 1YIJI 2L0KA 1IUFA 2M7BA 1GT0C 2E71A 2DA2A 4L0ZB 3A2KA 3F72A 4KT5C 3RZDJ 2ESNA 5LGNA 2EFPA 4BY7J 3ZCOA 1JT0A 3KP5A 1BOBA 1LKXA 2R7XA 2L02A 4G94A 1QHHD 5K7ZA 2CO5A 3GFMA 3WTZA 1RRJA 1A04A 2EZLA 3LNQA 2OTJI 3L7WA 3A0HC 2DA6A 2L01A 1U9NA 2QF7A 5FRNA 3LMMA 1OLTA 3FMSA 1FOWA 1P6RA 2OCCH 2XRNA 2FMLA 1B9MA 1LDDA 2PMZA 4PJNA 4D5FA 4II2A 2UZKA 3S17J 3HC7A 3I59B 1H89C 3DEWA 5J40A 1FTTA 1JTYA 2R7SA 4ESJA 1OCPA 3N05A 3TL4X 1BR2A 2E19A 4HSTA 2JA6J 3C2BA 1TC3C 4DBRA 4MNUA 5BNGA 3VWBA 3CC4I 4C3HJ 1WH7A 2MBFA 3H9GA 4FQGA 2NVXJ 2AXLA 1P7JA 3X2QH 5FRMA 3FXMA 1PP8F 3OYDA 5EEGA 2HDWA 1T0FC 1OCCH 5E18F 1TP4A 2JRMA 1Y6IA 3F8NA 3MVPA 3RQIA 3T8RA 3JRFA 1MKMA 3WHCA 2HTJA 3KZYA 3R0AA 2VB6A 5ILVA 1ZRCA 2X1EA 3MMYB 4G12A 2OCEA 5JHFA 2UV1A 4DGWB 1KQ8A 3F8MA 1QVTA 3TKYA 1QPIA 3BTLA 3PIPF 3I54A 1RPWA 2HVQA 3D0SA 3TOBA 2CUFA 1EH6A 2E34A 1ZREA 1EH8A 3K4BA 5AIPA 4KN7X 4UY8I 2XF7A 2I10A 3BROA 5DM7F 4Y17A 3FKJA 1YIOA 2JSPA 1Z67A 2K3FA 5IY5H 3FHZA 1WVRA 3TGNA 1TW3A 3JAMZ 5LLQA 1LEAA 5L3GA 2J5PA 2PFBA 4A0XA 3HSEA 4LB5A 4EJTA 1G2HA 1Y39A 3ZMTA 2G7HA 1U0JA 3BC8A 4BJTA 3M7GA 4A3LJ 3OL3A 1BI0A 4S0HB 2VI6A 4G9YA 5ICGA 1AU7A 1FEXA 3DTEA 3K10A 3J7YJ 2K9SA 1T38A 2H1KA 3S8PA 4O6JA 2KQRA 2X85A 4BQNA 2NXNB 1BR4A 2FXAA 1XGSA 4YIFA 5KCMA 2IVMA 1ZARA 1ZR2A 3W2VA 2CS3A 2Q2EB 1R58A 2R3SA 3MQ0A 3JRBA 3L1PA 3DKXA 1FBSA 1T08B 5DEQA 4LFUA 2X4HA 5HNHA 2DYSH 2BW3A 4B3AA 3KZZA 2FRHA 2E2IJ 1TBXA 2W1OA 4WXCA 2XKOA 4M3FA 3TMOA 1W0UA 2ID6A 4EJVA 3GTQJ 1HC8A 3EETA 5FKMA 5CVUA 4II3A 3JRCA 4P96A 5FLXZ 4EM1A 2ELKA 1ZRDA 2M4KA 3EYYA 4G8XA 3J80Z 5AIQA 3S1RJ 3CJRB 1FMVA 4ESBA 3LQQA 1G8XA 4XKBA 2MW8A 2LFBA 3K1NA 3MAJA 4NC8A 5J3LA 1XCVA 5FKNA 4B47A 1R7JA 5JI6A 3CMMA 1Y0NA 3K4CA 1FYKA 1OCRH 1FSEA 2OTLI 1G3YA 3I64A 1YITI 1Z05A 2EJRA 1XG1A 5E1WA 1B8IB 3V8LA 3H35A 3CDLA 1XGMA 3SFIA 1ODDA 1JKRC 1YHQI 4D5CA 4WXHA 2O9LA 4I7HA 2DFHA 3S2HJ 1YX3A 2OQRA 4C3JJ 4BQAA 1BJZA 4AVZA 2WY7Q 1FSHA 3K69A 6PAXA 1R49A 1X58A 1YW7A 1D5YA 2FBHA 2XAHA 3G6EI 1FP2A 4KNYA 3IHUA 3BWGA 3HXLA 4DNCA 2K3PA 2QENA 3DQVC 2X48A 2WAQA 1DQUA 3WGGA 2FA5A 1FTZA 5DCMB 2MD5A 3PJRA 1F4KA 1J5YA 3ZP5A 4QLCU 3IH2A 2K40A 4CCLA 4NDLA 2RQPA 5HLGA 2G9WA 4RGUA 3FIWA 4LG0A 4EM0B 1OQYA 1FY7A 1T39A 2KISA 1Z7LA 3I4NJ 2CV2A 1R4NB 2JSCA 3DBHB 2V1NA 4U0YA 3JSOA 1ETYA 3T5XA 5FKKA 4X6AJ 2LBFB 3K6GA 2VJ4A 2HWVA 2NVYJ 3PNVA 4HG2A 3VYSB 4ZDPA 2XIGA 4N9IA 5GAEJ 2KL4A 3FHNA 4FTHA 5J1RA 1HXDA 2V26A 3OS1A 2EILH 2R5YA 4G7ZF 3JRAA 3K0LA 3V7SA 5J6XA 4ZZDA 3VSLA 4UHTA 2PBIA 4EJOA 2E7XA 2I8DA 3H36A 5BMZA 2VT3A 3FXOA 3PO3J 4M74A 3JW4A 3VFZA 4E4HA 2EK5A 1IRFA 3BG3A 4E7KA 1D8KA 2KDOA 1IXCA 2ZMEA 3JCUC 3CJQB 1ZAOA 3GXOA 4BE0A 2OJED 4Y4RA 2E1CA 1Q1HA 2DMQA 4YFKF 4RLQA 4ABZA 2K9LA 2KMUA 1Y56A 2JK3A 3FBNB 1R00A 4YIRX 4M71A 2R92J 1U6GA 3KP2A 1QZYA 1TQMA 2BHZA 2E5NA 3SYTA 4ZYAA 3KEOA 3L09A 3WE2A 1MH4A 1F36A 3DBRB 1IG7A 1OISA 3IKTA 3QQAA 4XM3A 1ZG3A 1ENHA 1PYVA 3HUGA 3IV5A 4ZYEA 1TWAJ 3CO6C 4V2GA 3FX3A 1SVMA 3SEZA 2IA2A 1AA7A 2FEZA 5E8GA 2FF4A 3OOUA 1D1BA 3B6CA 1HW5A 3CF2A 3U2RA 1A31A 4L9VA 2Z3YA 2L5QA 2KIFA 2WC2A 2VE9A 4HA8A 1R9TJ 4IRGA 3OYKA 3A0BC 3G1LA 3ZQHA 3BG7A 3GMEA 3ASOH 4WXDA 2YS9A 2HQAA 4LITA 2WB1N 4I01A 4XQFA 1HOMA 2RREA 3R6SA 1ACIA 2H94A 4XL9A 4N4NB 3WGIA 3M8FA 4IVNA 1RNLA 3QU6A 3SZPA 3MD2A 5CVIA 3QOPA 3OYEA 3BLYA 3VYRB 1EJ9A 1U8RA 4CICA 1YS7A 3WU2C 2F5CA 1UMQA 1TTYA 4I09A 2F5FA 1UJ8A 4XLHA 1TT0A 4B09A 1BW6A 5LFAA 4OAZA 1G6NA 3IC7A 3H0GJ 2V7FA 3REOA 3ROUA 3HBLA 4WK8F 3TEDA 1HCRA 4Y13A 5JFRA 3NRVA 1MNDA 4G6DA 2V9VA 1K83J 3CD6I 5KHDA 2A6EF 3BCBA 3CCJI 1BA5A 3CESA 4PJMA 5F08A 4PDKA 1V4RA 2JWTA 4PSXA 2EB7A 4MQ9F 1EA3A 1XB4A 1SAUA 4UV8A 3D5LA 5AONA 5L3BA 1VQ9I 2QLZA 1T6SA 3GO5A 1ETOA 2W4SA 3ZMSA 2HDDA 4KJZA 2CQ7A 1SFUA 2D1VA 2FNAA 2A3SA 5M3MJ 2V6EA 2HYFA 4U88A 3AL0B 2EBIA 3LQRA 4OIRF 3ABLH 3CDHA 2AQEA 3KP4A 4E7IA 2EFQA 3HSFA 4PGHA 3QYFA 2JPCA 2ZMEC 3F6VA 5CLSA 2VKHA 4C2UA 2XB0X 3AG1H 4I02A 5B66C 2WBMA 2G7UA 1H9GA 2DT5A 5BPIA 2VUMJ 1VQMI 3RPUD 3BG5A 2Q0OA 2LF8A 4IF4A 2EIJH 3A02A 1BN5A 3O3KA 3QP5A 1YLFA 1K7AA 4BBSJ 5B3SH 2XRLA 2KIUA 2JRTA 3Q5FA 1Z6RA 4BNCA 1LE8B 2E1MB 2XASA 1MJBA 5J1UA 3DTKA 3DTIA 2IGMA 3ABKH 4P9FA 1NK2P 5E17F 4NC6A 1DGRM 2M1BA 4HDUA 2CMPA 4DJAA 1GV5A 1XD7A 2KRFA 5CVVA 3TW6A 2DO7A 1UHSA 3RDIA 5J8CA 2XVCA 4KITB 2KRCA 1Z6TA 1H8AC 3KIOA 1F43A 1HSTA 1X4PA 3GBGA 3FXLA 1NTCA 3S15J 4LLLA 1KQ9A 2F48A 4CUGA 5HLTA 2C6YA 1ETWA 1U3EM 4GFBA 4XORA 1W5TA 2LBFA 5TRDA 3PNYA 1W5SA 5JVTA 1O3SA 5HLHA 3V7RA 5DDGA 1KYZA 3OY9A 2BE5F 3EQLF 2RQQA 3ZMDA 4XLAA 3V42A 3OS2A 2VC0A 3W6JB 3QU3A 2M4GA 1T2KA 3HRTA 1R22A 1G3TA 3RPQA 1Z77A 2Y30A 3ABUA 2VC1A 3CMAI 2V6CA 3JR9A 5CVRA 5K5QA 2LKSA 5IP6A 2ISYA 2EWNA 4HNTA 2GBYA 3WTWC 3LSRA 4ZDOA 2IEKA 3RIRA 4GDFA 2H1LA 1FYLA 1PJRA 1FZPB 5EZGA 1P92A 2IT0A 5K7HA 3I71A 1DUXC 3GTJJ 4RMNA 3HOZJ 1YFHA 1A5JA 3HTUA 4FETA 2VKEA 3OYCA 4ESFA 4GO1A 1ON2A 1SEUA 5BS6A 3ZN1A 5J8FA 1V55H 2DA1A 4EJUA 1O7FA 2BBYA 2MABA 4L9JA 2ZJQF 2J5OA 2FU4A 1LEBA 2KPMA 1JKQC 2W82A 3RKWA 3T1BA 1ZR4A 1JUSA 3PQKA 4PFOA 4AC0A 3C3WA 2H8RA 1O3TA 1A6IA 1X2NA 3ECHA 5F1RA 4NB5A 2VJJA 4CZCA 2LDUA 4EEFG 2CWEA 2M8EA 3K4MA 2DU9A 1TWHJ 5C3EJ 1BL0A 2TRTA 2A6HF 1FOKA 1SFKA 2QCOA 4LMYA 1S5LC 2WTEA 4BHBA 1BC7C 4BYYA 1HBXG 3HHHA 2QGUA 1T8IA 1I5ZA 3BR5A 4JX5A 2IBDA 1MDMA 3GYHX 2GM4A 1W0TA 2O03A 1SD4A 3DBLB 3HIFA 1ETQA 4M72A 3ML6A 1MZBA 1JHHA 3EUAA 3OR2C 1YRNA 3CCVI 3M1EA 3RCOA 3G1OA 3WG7H 4BQOA 3L2QA 3E0JB 3VODA 2BOLA 1EH7A 1S7AA 2E35A 2VXZA 4HLYA 4RS8A 1OKRA 5J47A 1U8BA 3H1CA 1LVKA 2NS8A 1K78A 4D1QA 1DP7P 1IN4A 1JUMA 3K70C 2F5VA 4YELA 2L9VA 3I0TA 3S16J 5FD5A 4PUSA 5LBQA 2LY9A 3LSPA 1H9TA 2EPFA 2GWRA 2QEXI 1TNSA 1LFBA 3JRIA 2E7WA 1CGPA 2CQKA 1AKHA 1ZGJA 4BE1A 4FE4A 1T98A 1R36A 3DCFA 3WU0A 1BI1A 4WCGA 3DLAA 3RYPA 2Z2SB 2HVRA 1QQIA 1XMKA 2LREA 3LSMA 3PQJA 1RI7A 2YU3A 4M3EA 4ASNA 1KU9A 2DA3A 3QPSA 4R79A 3K7AJ 3GTPJ 2B7EA 2ZFUA 2NOJB 1TQIA 3R4KA 3Q9VA 1GV2A 3M07A 1BOAA 1IRXA 3WTTC 3E6DA 4HX8A 2OD5A 4JP0A 3GLXA 2QVOA 1BI3A 3CLQA 4W97A 1TNTA 4XBFA 5HDNA 2DODA 1FJLA 5LHIA 5HLIA 4BS9A 4KICA 2WV1A 3ERED 2P5LC 3NWTA 4M3DA 5D5XB 2FBKA 3IH4A 2NS7A 3MKLA 5GAGJ 4RBOA 1LFUP 2HI3A 2VPRA 3GLLA 3C18A 2O3FA 3VPRA 3CCQI 2JN6A 1SVLA 4A5NA 2WV0A 4P1WA 4F3QA 2DOEA 1N75A 1OCOH 2JMWA 3BJOA 3PO2J 3KZIC 3KLNA 2H6CA 2ADUA 4BE2A 3K1PA 2QBYA 1DU0A 1GVDA 2M34A 2RC4A 2NOGA 2QZ8A 3V8JA 2M45A 2GOXB 2IPQX 4DZPA 4OMYA 1TWGJ 1IW7F 2K4BA 2GLOA 2IA0A 5F0CA 1X1PA 3ASNH 3BZCA 1XSXA 4BUPA 2Z5UA 3C2HA 3PL8A 2LKXA 1BIAA 4HQEA 2EFWA 1S3JA 1X1CA 4BKXA 4WWCA 3WGHA 4E7ZA 2EH3A 2AS5F 1R4MB 4N0BA 5HOOA 4HAMA 1JKOC 2QA4I 1IN6A 2CSOA 2KIQA 3HOYJ 4XSXF 4BXXJ 1MBJA 1ZLKA 3HM5A 2A6TA 5F04A 4L0YB 5EZHA 2G0EA 3VSKA 2CUZA 1H88C 2XAQA 4JBAA 4J01A 4NNJA 5D5WB 1IV6A 2XAFA 3LFUA 1R1TA 2HGCA 3EDPA 3FDYA 4IEJA 5ICCA 3OYJA 1MBKA 4JYKA 3ZMUA 3IAM2 4HQMA 1PUFA 2VT2A 2PJRB 1S29A 2XGCA 4ANJA 2R7RA 2R7VA 3FXJA 2RAEA 3RJPA 3V7CA 5EEAA 2JZYA 1E2XA 1SVOA 1YYVA 3QYEA 1YTYA 2B0LA 1W7PB 4ENNA 1SAXA 2DDAA 4Q48A 2DLLA 3SDGA 2STTA 2HYJA 1USSA 4E7SA 2UUZA 4GRIA 4HX7A 1FOXA 2DTZA 2OAZA 4N4OB 4NQWB 2JVHA 3TQNA 4B4CA 2OBPA 2F5EA 1ZN2A 4RA2A 4M9SA 5A2QZ 1QU3A 1HW1A 3CUQB 5D6FA 2ZJRF 1W7PA 4RGXA 4A3JJ 2XROA 5HVQC 1IRGA 3FM5A 4EJWA 2EZKA 4OOIA 2M0CA 4BQQA 1FBQA 1W5CC 2EIMH 4AD9A 1W1WE 1QBJA 3HOVJ 1ZGAA 4HNUA 4XN0A 1JJ6C 1Y0UA 2E2JJ 2CW7A 3ESWB 3SXYA 1VTNC 3ZQIA 4F7ZA 3HOWJ 2HOSA 4KIFA 4ENMA 1S7OA 4CCKA 3MZ8A 2ISZA 3G1MA 2W85A 3LA3A 2PX9A 4X1EA 2MG4A 2NNNA 2Y9ZA 1KA8A 3PIOF 4XSZF 3WTYC 2K9MA 2O6GE 1DPRA 3MN2A 3FKIJ 2ZXWH 3G71I 3KYLA 2BXYA 3KCCA 3DLLF 1JI8A 3CC2I 4XICA 1I6HJ 4EQQA 3DV8A 2NYXA 1LE8A 2AXTC 2V79A 3T0YA 3OYIA 1GXQA 5BQTA 1X19A 1NG7A 2R7UA 2FJ1A 2K4JA 3C2GA 4R1HA 2VKVA 4IQ4A 5DTDA 4X0GA 5GADJ 4BBRJ 5HDGA 1JTXA 2F6CA 1EF4A 5K5OA 2CQNA 1VQLI 1WRJA 4MGRA 5F6FA 2R7TA 1SC7A 1N25A 1DPUA 5BOXA 3BDDA 2COBA 4XLEA 1V5FA 4KIBA 3ZMZA 3K2AA 2HS5A 3A4CA 3ZQGA 3L00A 4I2OA 3RKQA 4HBLA 4U0VA 4L9NA 3CCYA 4QIWN 3VOEA 1V5EA 5J4VA 2JUGA 4I0BA 2DBBA 5LEJA 2HNHA 3EPZA 5HNFA 1ZGWA 2H27A 1B72A 2RV8A 3S2DJ 4AU7A 5ED4A 2ESHA 3FXKA 2FX0A 4RDUA 2VIXA 1LDKB 4EGYA 3GFIA 3LSHA 3K70D 2E36A 2M2EA 3HRUA 4Y15A 1MD0A 3SZTA 4OIOF 3IRQA 2CFOA 2A5YB 1BC8C 1R5GA 3FMQA 1OR7A 3LA7A 3W6KB 1IC8A 2MH9A 3BJAA 4A3CJ 2WWYA 4B48A 5E1ZB 2LG4A 2L4AA 1STZA 5FKOA 1MBEA 2Z1DA 3FMRA 5DYMA 4BY1J 3DPTA 4KIGA 1F9NA 3TDZC 1D0YA 1IDZA 4A2UA 1K78B 1AKHB 2M3AA 1JT6A 1WJBA 1X1DA 3ZR8X 3F21A 4MFEA 4DQ2A 1S6LA 1WPKA 2Y0SA 1Z91A 2A5WA 1YJ9I 3WTVC 2JA2A 2XDVA 2CQXA 3KYCB 1FIAA 4XKWA 3JAMK 1SFEA 5HS9A 4CZZA 2GA2A 3DF8A 4MLOA 4BGDA 1XDUA 3P7NA 4HF0A 4XOPA 5CQEA 3A01A 3H0DA 4XLFA 3M3YJ 3F8FA 1ZKGA 1B9NA 4M6VA 1DGWY 1Y8QB 1O3QA 3E5QA 3TO7A 2CRGA 5JVGF 3ONQA 4YFXF 4JX4A 4A3EJ 3H5RA 1QZZA 4HLXA 3HOTA 2P8TA 4E7HA 4V19K 4LOCA 1YS6A 4BEHA 4M9XA 2QQ9A 2P7CB 3CMEI 1TLHB 1VQ8I 3SHFA 3OYMA 5CYVA 4A3FJ 1KQ0A 5IT9Z 2X1CA 3DFGA 2QWWA 3I4MJ 4DW6A 5F1JA 4GCVA 4GGGA 1YJNI 1K6OA 3HEFA 3R0JA 2KJCA 3BR3A 3HHGA 1J09A 2XSJC 3TP0A 1G4DA 3U9GA 2IGNA 4W1UA 4QWQA 3IL2A 4DIQA 2IAIA 4HSRA 4IHTA 1MJ9A 3P9IA 2ZO4A 1LB2A 4QPOA 2PEXA 1U5TA 1ORKA 2W7NA 1Z1DA 3ECOA 3Q9SA 2R4GA 3ABTA 4Y33A 2KZVA 3L2RA 5TJJA 1RUNA 1JGGA 2BY3A 4CO8A 3CCSI 3ZXSA 4C30A 3WTXC 1PVEA 3B73A 2W48A 3OYLA 2ZMEB 4U87A 1G3SA 4CA0A 1SD5A 3I9V2 2DMTA 2QM3A 3S3NA 3HDDA 1AWCA 4KA4A 3JTGA 3F8CA 2WADA 3B02A 3M4OJ 2XKPA 1I27A 1OPCA 3OYNA 2GIZA 2OZ6A 3GZNB 3J81Z 4IXAA 2Q1ZB 2F4IA 3CMYA 2R5YB 3PUBA 1OR7C 3FZVA 5HS8A 3ZRGA 4GYGA 1HSJA 2YPRA 4AM3A 2BZTA 2DOFA 1KU3A 2DT7B 3R61A 2KHMA 4B44A 2M0MA 1QO0D 1HKQA 2NAZA 2QSFX 2FBIA 3HOUJ 2HQNA 2QYOA 4PCQA 5E3OA 2QUFA 2K85A 1ZRFA 1JUPA 2CV0A 4F55A 1QGPA 1N77A 1ZG5A 2KT0A 5IP7J 1B4AA 2WAQN 3TP3A 3HL2A 2GQQA 2FOWA 5K1YA 3E6MA 3LSTA 5D5UB 2VL8A 3R60A 3IH3A 1T33A 2LMDA 1X1AA 4ZDLA 2DPUA 5IYBJ 3MKZA 1ZELA 3L9FA 2JVGA 1O3RA 1MH3A 3PFYA 4O5VA 1LDJA 5EJCA 3JTHA 2HPMA 4XMYA 2RDPA 3AAFA 1OYIA 2LVSA 3KEYA 3AG3H 1O7LA 2L9SA 2VQCA 4D9JA 3LAPA 2DA5A 1ZHFA 2VKDA 3BCAA 1FP1D 3HGYA 2P6TA 1YI2I 3H3UA 1L0OC 1Z3XA 2UXNA 2LRDA 2KP6A 2IXSA 1CF7A 3PFIA 3OL4A 2QBYB 3GTLJ 4ETSA 3QPLA 3JRGA 2X9DA 5FROA 4U7DA 3CCLI 4UV9A 3FK7A 4I98B 9ANTA 4L5JA 5IOYA 2OUMA 5FFZA 1R71A 4BHCA 2K7LA 4TV7A 5H6QA 5IYDJ 4ZTJA 1Z21A 3QP6A 3BR1A 4ZTFA 2VQLA 2Y0MA 2FMYA 3I3LA 3WE3A 2ID3A 4ZYHA 1PP7U 3UNGC 5L3DA 1P9QC 2GAUA 4YFNF 2FUG2 2L7MP 3TO9A 2HOTA 3IUOA 3GFLA 3OR1C 1E3HA 3SDBA 4CH7A 2MD0A 5M3FJ 2DAOA 2Y69H 3FM3A 5E79C 1UCRA 4AIKA 2VONA 5L3CA 3LSGA 4I6ZA 1IF1A 2IS4A 2LP0A 4UUVA 4D7MA 4IRHA 5F0HA 1XGOA 2Z99A 3PSIA 3W2WA 2IGKA 3V4GA 4A3MJ 2NRAC 5JLWA 3QWLA 2K9QA 4WX9A 2RKHA 2EZIA 2WAFA 1WFXA 4OAYA 5GP9A 5IOZA 1VFCA 3MZYA 2DQLA 1L3LA 1ON1A 1K6YA 3SZGA 4MEXF 3P9KA 2DJNA 3GTMJ 2L2OA 5D8KB 1WWXA 1FMWA 2ZJPF 2UWMA 1ETXA 1IDYA 2EV0A 2LNBA 3BZKA 3RKXA 5HODA 1WZ2A 4PSWA 2M7AA 2WB1A 1TZLA 4UVCA 3HTSB 3DPLC 2E1OA 3TOAA 4KDPA 2QKLB 4EMSA 3E5XA 1XMAA 2KLOA 2PLYA 3DEUA 2LY1A 3ZGKA 5D4SA 4ITVA 1IRZA 2O7OA 5GTHC 1WH5A 2EV6A 3CF5F 2VASA 3K4NA 5JLXA 3BY6A 1HDDC 3Q3SA 4KISA 4CDGA 3QAHA 4XRMA 3NAUA 1WSUA 5EGOB 2X6WA 2E2HJ 1UG0A 1ERDA 2DYRH 3FXRA 4ON0A 3F22A 4XIDA 2VJ5A 2DMNA 3CCMI 3CJTB 4RLFA 4JQFA 2DFIA 1WJCA 1D8JA 2MGQA 3M1CA 4BJ5C 4I76A 2STWA 4XRFA 1QPMA 2FOKA 1K4TA 1O4XA 4UXNA 1JXSA 1GXPA 2MA3A 4BJ6C 5EEHA 1OYYA 2PN6A 2VPLA 3VYTB 3HGGA 1FLIA 3KFWX 5L3EA 4A3DJ 3JSPA 2A05A 4KMUX 2JT1A 5IPAA 5IT9K 2EA2A 4PJLA 1S72I 5BPDA 3KLOA 4E7JA 2E1NA 2OF7A 1MBGA 3NWSA 2X0LA 3HRSA 1CF7B 1MGTA 2K27A 3OIOA 3HUGB 5ICEA 3T8TA 5D4RA 2KIMA 5DUKA 2O5RA 3PSFA 2L9NA 2V9PA 2DFEA 5K5RA 2VLAA 2IRFG 2YUSA 2IJLA 1ZH5A 1P4AA 2X6YA 2GZWA 1LPQA 3KP7A 2O0YA 2DCEA 2HOEA 2ZJ2A 3CP2A 3U21A 2X6OA 1LNWA 1T0FA 3K9TA 3SEQA 2Z16A 4C2TA 2DA4A 4NBQA 2HYGD 2M9HA 1QNTA 2PMUA 2V9KA 2HZDA 4PK4A 1MSEC 3K4KA 4FT8A 4GYIA 3CZ6A 2Y2ZA 2R7OA 3BTIA 3F23A 4ZJZA 2L3DA 2PMZN 3M8JA 4Q47A 3OWTA 3OMYA 2WAEA 1HKSA 4A6EA 4XLPF 2ZCWA 3BR6A 3VDXA 4CCNA 1SFOJ 2VQHA 2MC3A 1FT9A 2LD5A 4LG0B 3DXJF 5DV5A 2HR3A 1U78A 4XONA 2O8KA 2XGEA 4DBQA 5DD8A 4HV6A 3HJEA 3VEPA 3J7ZI 1HW2A 4EGZA 1S7EA 4LD5A 4LK0F 4XN3A 1I50J 3C7JA 2ZXIA 5LGTA 2BEOA 2OV7A 2MSYA 5LEKA 1B6AA 2W84A 3AFHA 3OYFA 3BOQA 2A69F 3AL0C 1OFCX 3Q0VA 5GTIC 1SMTA 2DK8A 4A3GJ 2Z9OA 1E0EA 1IN8A 1C0WA 2DDBA 4HNVA 1VQNI 1W36C 4OU0A 4CGZA 1J7KA 1CQTA 1I3AA 1V3FA 2VE8A 5DCMA 3TW7A 4AYBA 3GZ6A 4A3KJ 5DUIA 3Q0UA 2NVQJ 3IRRA 2NVUB 4FHTA 1JGSA 4RAYA 1NHAA 2F2EA 4E6KG 3K4JA 4GXOA 3ERMA 2CW0F 1MMNA 1U5TB 1XTAA 2ZSHB 5LRRA 1XMXA 1VQOI 3ZQ7A 4DYQA 4M9ZA 1GUUA 5KAIC 4A93J 3KE2A 1BIBA 2HPIA 4LJZF 2JTVA 3OSFA 2B9SA 1IUYA 1KONA 4DYRA 1B8IA 2BGCA 3S3MA 5TGTA 2E1MC 2P5KA 2R93J 1JHFA 2P5VA 4OINF 4I99C 1TQPA 3CUQC 4OWRB 2ZC2A 4IX7A 1FPQA 3BPVA 2GXAA 3ZQLA 3FXUA 4UB6C 2N8GA 1R5HA 3PUFA 3HKZN 1I1SA 3FISA 3GUDA 2DW4A 2EFOA 2ICWG 3RZOJ 1IN7A 1J9IA 3CCRI 1YW8A 1TWFJ 1WI9A 2BW3B 1IXSB 2XHKA 3SQNA 5M5YJ 2Y31A 1ZTRA 2CH0A 3BQZA 2L9RA 1WQ2A 1S9HA 3IWFA 2Q2EA 3S32A 1D1CA 1QHGA 3D5RC 1VQKI 2UXXA 1YQAA 1BR1A 4MEYF 3VB2A 3H92A 5EGOA 2IS6A 3GTGJ 2BVMA 1RESA 2QKMB 5GPAA 3UR3C 4KUMA 4Q4ZF 1GLNA 1KU2A 2EFNA 5FO5A 3FK6A 2Z33A 3F9KA 2PG4A 4F92B 1JKPC 5DS9A 2EZHA 2XPWA 2PMHA 1Z0XA 5IYCJ 2F5DA 3Q0WA 3S93A 5KVRA 1BBYA 1X2MA 2HQRA 2L7ZA 5J1YA 3LL7A 4EV0A 3BP8A 1K4SA 2RN7A 1T95A 1D0XA 4P9UA 4BDYA 4YIIA 2P6SA 2KKOA 4NC7A 2M8GX 3QPHA 2GOMA 1WKMA 1PDNC 2Y48A 3J7AY 1KZHA 2R0QC 1WJFA 3F6OA 3GF2A 3H5AA 4IO9F 2DT6A 4XKVA 1OCTC 4HX4A 2YX4A 2O8XA 4C9YA 3EUKL 1JE8A 2KZGA 3GTOJ 1KGSA 4NUBA 2DOAA 2XPVA 5FJ8J 5E20A 1MNMC 3RQ4A 3A1YA 4PJJA 3W3CA 4HF2A 4B43A 4HDVA 4UNOA 2X51A 4B3XA 2DJIA 2VBZA 3JRHA 4Y52J 1V5GA 5IP9J 1MBFA 3VYUB 4YEJA 3CCEI 3N4MA 1YX5A 4KMFA 5DD4A 3H5NA 5B1BH 4D0PA 2KJBA 2FQ4A 3EYIA 2IA1A 3O8HA 3OV8A 4Y3OA 1ITYA 3CDIA 5HS7A 2JA7J 3GW2A 2BHYA 3L2CA 2HQ5A 1XCBA 4IPAA 2MLGA 4R8HA 5ERIA 1U2WA 4JK1X 1R6RA 3AG4H 3S3OA 2PQ8A 3KPHA 3P9CA 1TW2A 4OIQF 1SANA 2L54A 4RGRA 5LHGA 3O2PE 2IGOA 5TISC 2BY1A 4AIJA 4CXFA 4A0ZA 2VODA 3BPXA 2Y9YA 1I6XA 3CCUI 3WHBA 1DDNA 1FX7A 3GCMA 2L7KA 3L2UA 4HRIA 4IHSA 4A3BJ 1FIPA 3TO6A 4DOZA 1ZG1A 4IHVA 1HKTA 2ZFWA 1XPXA 2A68F 4E7LA 4BL0B 2M30A 3I59A 4LGWA 4DYCA 4LIVA 3HZJA 4IHXA 2GXBA 4O3MA 4BXFA 2DN0A 4FCYA 1I3QJ 3E5UA 1WJDA 4XOTA 1BI2A 5KK1A 4I0AA 5C4XJ 1E3OC 1RIOH 3HOXJ 2COMA 3EUHC 3CTAA 3MFKA 3E7LA 4IL6C 4UB8C 3JRDA 2HDCA 1MW7A 2DFFA 3CP8A 4RB1A 4M73A 3KP6A 4RB3C 1ETVA 2KRHA 4A6DA 2ZBKA 2ZNYA 1LFPA 1A6QA 2RNGA 2W25A 3P5JA 3OS0A 2DMUA 3IAS2 1VI0A 1M1EB 1RKTA 4G6QA 1QZEA 4B1RA 2OA4A 5ILSA 1LUJB 3OYAA 1VQ4I 3DU6A 2QQ8A 2HFHA 2ELJA 3H3ZA 2XF6A 5A2QK 4CYDA 2D5VA 1P7IA 3W6VA 1N78A 2M5WA 2LC2A 5FB2A 2Y75A 2MC4A 3G3ZA 1GVJA 2KDZA 3N97A 2ACJA 2AO9A 3BG9A 1GHCA 2PJRA 1MMAA 3HYIA 3DPUA 3K4LA 4AIDA 4A0YA 4MHGA 3AKZA 4XRSA 1XSVA 3BR0A 4LB6B 1RC9A 1YE9A 2XAGA 1VF9A 1UELB 5H2FC 4S04A 3IWZA 4L9TA 3CQZJ 1YOVB 3F0CA 3U1KA 1W36D 2CUEA 4M6YA 3FF5A 4UUSB 2V1UA 1VNDA 1HF0A 5GAHJ 4H4KC 4ZC3A 3HRMA 3MKYB 2BXZA 2LF7A 4BEHB 1Z9CA 2OZUA 4AUXA 5E3LA 4EATA 1X3WB 2DMPA 4AYBN 2VXDA 5JR3A 2VOOA 1BJAA 3BT9A 3M9AA 3G73A 4FX4A 4P55A 4U0WA 4ZYDA 2IS2A 5C4JJ 2R7ZJ 3HB9A 1I39A 3S2WA 2HEOA 2XAJA 1Z7UA 1POGA 5F27A 1X3ZB 2CYYA 3LOCA 1IAWA 4LLGF 2DI3A 4M3GA 1SD6A 2XGDA 1R5ID 2CG4A 2R5ZB 3KP3A 3MEXA 4RB0A 4MIMA 2XPUA 1B1BA 3KETA 4RGSA 4HZFA 4AIHA 2CGPA 4UUTA 2HXIA 5FLMJ 4XNFA 4AWXB 4CCMA 3B6AA 3DWLE 3WU1B 2EV5A 2XSDC 4PJ0C 3H9JA 5FFXA 3A01B 1P4XA 1AHDP 5FGMA 1MBHA 2ME0A 3S1MJ 3GTKJ 4XR6A 4HPQA 1WJ5A 2XGXA 5EG0B 2H6BA 1S8NA 3J7AO 2JA8J 2I5UA 3KEQA 3RKYA 2BVLA 4K2EA 5LGUA 3COAC 3FBIB 3SJMA 2BV6A 1X1BA 4XKCA 3U1DA 2A07F 1Z3YA 3HPGA 1D3YA 1XDSA 5EF6A 2DA7A 4ZZLA 3ISPA 2HOAA 1LJ9A 2V4JC 4G7HF 4G7OF 1XX5A 3IP4B 4BU2A 5KAFC 3QYBA 2FQ3A 5DM6F 5DCFA 4QTRA 3DU5A 5GPCA 1RKWA 2L4MA 2D45A 1EKEA 2WA0A 5EYRA 4LLNA 3UKGA 2XB5A 3EUHA 5JHUA 3O8GA 2ZKZA 2BY2A 2Y0SN 4A5MA 2K9NA 4NHJA 3D5SC 4OIPF 4L5EA 4FASD 3GVAA 1IZ1A 1WJAA 2HKXA 2YSRA 5H20A 2R7FA 3H3VK 1I1GA 2HZTA 3OYHA 1SFXA 2LSOA 3AG2H 3ZQFA 2ZSIB 2ECCA 1ZK8A 2HTSA 3PNTA 5KNLA 2OU2A 2LH9A 2XUBA 4CYCB 2FSWA 2LK2A 4BHPA 2E60A 2XAUA 5EDNA 2VOPA 3RI4A 1BW5A 4MQVA 3ELKA 4H0EA 1Y8RB 4EVIA 4KN4X 2BY0A 1ONVA 4ENKA 1G3WA 1B72B 2AHQA 2M87A 5F0FA 4BACA 1E3PA 2DPDA 2LR8A 3HSRA 4YRVA 3TDUC 1OJLA 5ILUA 1IJWC 4M3BA 1UZCA 1F1ZA 4UVAA 4IKFA 3RTRA 1R23A 3HPHA 1MMGA 5LHHA 3BQYA 1KYWA 2AQFA 5E8IA 1UHWA 3CLOA 4HYEA 3ZQCA 1DU6A 5FLVA 1SD7A 4IOCF 2K86A 4JOMA 2R7QA 4WF2A 2MFZA 1PUEE 1LVAA 2CW8A 3S1QJ 2YX7A 4A3IJ 1UB9A 3MKWB 1E17A 2HKOA 2QQAA 2E5ZA 2W24A 4V2FA 2RVCA 3E6BA 2VBWA 4HEA2 2XC7A 3MWMA 3OSGA 5ICFA 4MO7A 1D1AA 1O57A 2LYCA 3NARA 1V54H 1OCZH 2K5CA 3I4PA 3K1MA 3MZHA 3CUQA 4Z2YA 1P2FA 3LSJA 3M8EA 3S1NJ 1J75A 1A36A 4NQWA 1XGNA 5D8LB 1IGNA 1TWCJ 5H6RA 4FISA 2XF5A 2LKPA 5CVJA 3L2VA 1SMYF 4F91B 3S14J 5CQGA 2YU9J 1AOYA 1ZQ3P 1D5VA 1Q1VA 3J81K 1U9OA 2V1XA 3CUOA 2F4OB 4Z6YA 5HDKA 3CC7I 3SFZA 2RNJA 4CCOA 4FX0A 4B8XA 3BR2A 1PUFB 3DKWA 1G59A 2QSHX 3FXQA 2D2WA 1XC5A 2P81A 5L3FA 1X4OA 1HLVA 2B63J 1WHUA 5D6EA 2V1DA 4E70A 1FC3A 4RM3A 1VQPI 1HQCA 2VBYA 1X3UA 4LK1F 4A69C 2HVSA 2JJ7A 1VQ6I 2ZXJA 2JUCA 1HA8A 3QOEA 2TDXA 3CJNA 1MNEA 3ABMH 4JX6A 4CHUA 3E1SA 1J59A 2QQBA 4XLCA 2CFXA 3LAJA 2R7WA 5M5WJ 2KFDA 3A03A 4BAYA 2DK5A 3RPUA 2YR2A 4HV5A 4PZJA 3G4SI 2X1DA 4IQJA 2IW5A 3BTCA 3HG9A 1TT5B 2DTRA 1REPC 1RZ4A 2GA1A 2WY8Q 4KFCA 1FBUA 1F5TA 2MLKA 4Q5SF 1RETA 2IP2A 3BTJA 4IZZA 5CJ9A 1MJAA 2VQGA 2X6XA 1UHMA 5E1XA 3LA2A 3ULQB 4YG2F 3LWFA 4L5IA 4C2MJ 2P0WA 2XV4S 2K02A 3I5UA 4RB2C 4RAGA 4IHYA 2EINH 4MFDA 2L7FP 3GZ5A 2FNPA 4HOBA 3F8BA 2NNYA 4BH9A 2Q8KA 4MTEA 3ZOBA 1VQ7I 3WODF 3RSNA 2LOOA 5CPRB 2IS1A 2W00A 2MH2A 4ENJA 5FLXK 1ZYRF 3QODA 1T56A 2RGVA 3CO7C 4CYCA 3F3XA
chains in the Genus database with same CATH topology
3FISA 2COBA 3RZOJ 2YS9A 3K2AA 2ZB9A 3ZQGA 2WB1N 1HOMA 3RKQA 1TWFJ 3CCYA 4QIWN 5M5YJ 2Y31A 1ZTRA 2CQQA 3BQZA 1ZGWA 2L9RA 2LLKA 3PM1A 1B72A 3S2DJ 1K61A 5K7FA 5EGOA 1UMQA 2FX0A 4RDUA 3GTGJ 1RESA 4IHWA 4D7NA 5GPAA 3FK6A 1BW6A 2ECBA 1GDTA 1RR7A 5DS9A 1JKPC 2M2EA 2OPTA 2EZHA 2XPWA 3H0GJ 1Z0XA 1NK3P 1HCRA 3HBLA 3TEDA 5M5XJ 3Q0WA 5IYCJ 1QRYA 1X2MA 2L7ZA 2EQRA 5J1YA 1K83J 1IC8A 1BA5A 5F08A 4A3CJ 2JWTA 1ETKA 2M8GX 5FKOA 1MBEA 4BY1J 3D1NI 2R0QC 1IDZA 1QVUA 1AKHB 1OCTC 1JT6A 4FE7A 1APLC 3JREA 1MSFC 4MFEA 1ETOA 1XS9A 1WPKA 2HDDA 2CQXA 1FIAA 4Y7NJ 1HDPA 5EG0A 3GTOJ 2R5ZA 5M3MJ 2XPVA 5FJ8J 4MLOA 1WI3A 2EBIA 1MNMC 2ME6A 2JA5J 3A01A 3JRHA 3M3YJ 1ZKGA 2LTPA 4Y52J 4M6VA 5IP9J 1MBFA 2CRGA 4A3EJ 4JX4A 4QSHA 2HXOA 2CJJA 2FQ4A 3O8HA 2XB0X 1ITYA 4LOCA 2JA7J 1YRNB 1Y1WJ 4J19A 2TCTA 2HQ5A 2VUMJ 3BG5A 4A3FJ 2NVTJ 5FKLA 3A02A 3I4MJ 4BBSJ 1SANA 4DW6A 5F1JA 2XRLA 4XRSG 2FD5A 3HEFA 1Y1VJ 3BR3A 3TP0A 1LE8B 4W1UA 5C44J 5J1UA 4CYCA 1NK2P 4XK4A 2IAIA 2Y9YA 1WCMJ 3WHBA 4UUSA 1GV5A 4DZJA 3TW6A 1UHSA 1JJ8C 4A3BJ 5E3MA 1ORKA 1FIPA 4IHVA 1H8AC 1UG2A 1F43A 3GBGA 1NTCA 1JGGA 3S15J 4DYCA 4IHXA 2DN0A 4FCYA 1ETWA 1I3QJ 2W48A 5E3NA 4C3IJ 4GFBA 1WGXA 2DMTA 5C4XJ 2CU7A 1E3OC 3HDDA 3HOXJ 3M4OJ 3E7LA 3JRDA 3CMYA 2R5YB 2L0KA 1ETVA 1IUFA 1GT0C 1Z77A 2DA2A 2DMUA 1VI0A 3RZDJ 1RKTA 2Y30A 4B1RA 4BY7J 3JR9A 1JT0A 3HOUJ 5IP6A 5E3OA 2GBYA 1JUPA 2D5VA 2KT0A 5IP7J 3LSRA 1P7IA 2IEKA 5K7ZA 2WAQN 3TP3A 5EZGA 3W6VA 2EZLA 3LNQA 5K7HA 2DA6A 2KDZA 1U9NA 2QF7A 2AO9A 3BG9A 3IH3A 3GTJJ 1T33A 3HOZJ 5IYBJ 1A5JA 2VKEA 4XRSA 1MH3A 3BR0A 1VF9A 2DA1A 4D5FA 3S17J 1H89C 3DEWA 2LVSA 1FTTA 1JTYA 1JKQC 1OCPA 3CQZJ 3F0CA 2DA5A 2CUEA 2E19A 1JUSA 1ZR4A 2JA6J 3C2BA 4UUSB 1VNDA 1HF0A 3HGYA 4AC0A 1TC3C 2H8RA 1A6IA 1X2NA 5BNGA 4AUXA 4C3HJ 5E3LA 1WH7A 2DMPA 4AYBN 2NVXJ 4EEFG 3GTLJ 3QPLA 1TWHJ 5C3EJ 3BT9A 2TRTA 1P7JA 3JRGA 1BL0A 2X9DA 2QCOA 5C4JJ 2R7ZJ 3FK7A 3HB9A 9ANTA 3BR5A 3RQIA 3MVPA 5IOYA 4JX5A 2IBDA 3JRFA 2GM4A 1POGA 5F27A 1W0TA 3LOCA 3WHCA 5IYDJ 4M3GA 1ETQA 4G12A 3BR1A 2XGDA 1YRNA 2ID3A 2R5ZB 1QVTA 1QPIA 4MIMA 2XPUA 3BTLA 3G1OA 4UUTA 1RPWA 2HXIA 2L7MP 5FLMJ 3B6AA 2HOTA 2CUFA 1U8BA 2XSDC 2NS8A 5M3FJ 2I10A 1JUMA 3A01B 3LSGA 4I6ZA 1AHDP 2LP0A 1MBHA 2ME0A 3S1MJ 4D7MA 3GTKJ 5F0HA 3S16J 5EG0B 4A3MJ 2JA8J 5JLWA 2LY9A 3LSPA 1G2HA 2K9QA 3SJMA 2EZIA 1LFBA 3JRIA 5IOZA 5GP9A 1VFCA 1AKHA 4FE4A 4A3LJ 3DCFA 4S0HB 2VI6A 5EF6A 2DJNA 3GTMJ 1AU7A 2DA7A 2HOAA 1FEXA 2K9SA 4M3EA 1ETXA 1IDYA 2H1KA 2DA3A 3QPSA 5HODA 4QTRA 3K7AJ 5GPCA 1RKWA 3GTPJ 5EYRA 2E1OA 1ZR2A 3JRBA 3UKGA 2XB5A 3L1PA 3O8GA 1GV2A 2Y0SN 2K9NA 4JP0A 4W97A 4L5EA 1IRZA 2O7OA 4B3AA 2E2IJ 1WH5A 1FJLA 3H3VK 5JLXA 3ZQFA 1HDDC 2ECCA 3Q3SA 1ZK8A 2WV1A 4M3FA 4M3DA 4XRMA 3NAUA 4CYCB 5EGOB 1W0UA 2ID6A 3IH4A 2LK2A 2NS7A 3MKLA 4RBOA 1LFUP 5EDNA 2E2HJ 3GTQJ 2HI3A 5FKMA 1BW5A 2VPRA 4XIDA 3JRCA 2DMNA 3VPRA 1B72B 2JN6A 2AHQA 5F0FA 2MGQA 2LR8A 2ELKA 4I76A 1OJLA 2JMWA 3PO2J 3S1RJ 1O4XA 1IJWC 1DU0A 1GVDA 4M3BA 2M34A 2NOGA 2MW8A 4DZPA 1TWGJ 2LFBA 3HGGA 5J3LA 4A3DJ 5FKNA 5IPAA 3BQYA 2GLOA 5F0CA 3ZQCA 1DU6A 1XG1A 2OF7A 5FLVA 2LKXA 1MBGA 1B8IB 4BKXA 3CDLA 3SFIA 2EH3A 3OIOA 1JKRC 3S1QJ 4D5CA 4A3IJ 2O9LA 1JKOC 3S2HJ 4C3JJ 3HOYJ 1BJZA 4V2FA 2YUSA 4BXXJ 1MBJA 1X58A 1D5YA 3HM5A 5F04A 3OSGA 5EZHA 4MO7A 2G0EA 2X48A 3NARA 1H88C 1FTZA 1IV6A 2X6OA 4IEJA 3LSJA 2DA4A 3IH2A 3S1NJ 1MBKA 2K40A 4JYKA 4NDLA 2M9HA 1PUFA 1IGNA 1TWCJ 2XGCA 1MSEC 4FISA 3FIWA 2Y2ZA 3BTIA 2PMZN 2RAEA 3S14J 2YU9J 5EEAA 1ZQ3P 1Q1VA 3BR6A 1SFOJ 1U9OA 3I4NJ 2LD5A 3SDGA 1ETYA 2HYJA 5FKKA 4X6AJ 1U78A 2DTZA 2O8KA 3BR2A 2XGEA 1PUFB 4B4CA 2NVYJ 1XC5A 4FTHA 1S7EA 2P81A 5J1RA 1I50J 1HLVA 2B63J 4A3JJ 2R5YA 2MSYA 3JRAA 4A69C 2JJ7A 2EZKA 3PO3J 1OFCX 2M0CA 3Q0VA 4JX6A 4A3GJ 3BG3A 3HOVJ 1JJ6C 5M5WJ 3A03A 4HNVA 2E2JJ 3ZQIA 3HOWJ 1CQTA 3BTCA 2HOSA 3TW7A 2DMQA 4A3KJ 3Q0UA 2NVQJ 4ABZA 3G1MA 2JK3A 4X1EA 2MG4A 2Y9ZA 2R92J 1RETA 3MN2A 3BTJA 3FKIJ 4DYQA 1MH4A 1F36A 1IG7A 1GUUA 3QQAA 4C2MJ 4XICA 4A93J 3IV5A 1ENHA 1I6HJ 1TWAJ 1LE8A 4V2GA 3OSFA 4DYRA 1B8IA 4IHYA 4MFDA 2L7FP 3OOUA 3B6CA 2FJ1A 5DTDA 2VKVA 2R93J 4BBRJ 1JTXA 3ZOBA 1R9TJ 1EF4A 3G1LA 3ZQHA 3ZQLA 1T56A 2N8GA 3HKZN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FIS A;  2COB A;  3RZO J;  2YS9 A;  3K2A A;  2ZB9 A;  3ZQG A;  2WB1 N;  1HOM A;  3RKQ A;  1TWF J;  3CCY A;  4QIW N;  5M5Y J;  2Y31 A;  1ZTR A;  2CQQ A;  3BQZ A;  1ZGW A;  2L9R A;  2LLK A;  3PM1 A;  1B72 A;  3S2D J;  1K61 A;  5K7F A;  5EGO A;  1UMQ A;  2FX0 A;  4RDU A;  3GTG J;  1RES A;  4IHW A;  4D7N A;  5GPA A;  3FK6 A;  1BW6 A;  2ECB A;  1GDT A;  1RR7 A;  5DS9 A;  1JKP C;  2M2E A;  2OPT A;  2EZH A;  2XPW A;  3H0G J;  1Z0X A;  1NK3 P;  1HCR A;  3HBL A;  3TED A;  5M5X J;  3Q0W A;  5IYC J;  1QRY A;  1X2M A;  2L7Z A;  2EQR A;  5J1Y A;  1K83 J;  1IC8 A;  1BA5 A;  5F08 A;  4A3C J;  2JWT A;  1ETK A;  2M8G X;  5FKO A;  1MBE A;  4BY1 J;  3D1N I;  2R0Q C;  1IDZ A;  1QVU A;  1AKH B;  1OCT C;  1JT6 A;  4FE7 A;  1APL C;  3JRE A;  1MSF C;  4MFE A;  1ETO A;  1XS9 A;  1WPK A;  2HDD A;  2CQX A;  1FIA A;  4Y7N J;  1HDP A;  5EG0 A;  3GTO J;  2R5Z A;  5M3M J;  2XPV A;  5FJ8 J;  4MLO A;  1WI3 A;  2EBI A;  1MNM C;  2ME6 A;  2JA5 J;  3A01 A;  3JRH A;  3M3Y J;  1ZKG A;  2LTP A;  4Y52 J;  4M6V A;  5IP9 J;  1MBF A;  2CRG A;  4A3E J;  4JX4 A;  4QSH A;  2HXO A;  2CJJ A;  2FQ4 A;  3O8H A;  2XB0 X;  1ITY A;  4LOC A;  2JA7 J;  1YRN B;  1Y1W J;  4J19 A;  2TCT A;  2HQ5 A;  2VUM J;  3BG5 A;  4A3F J;  2NVT J;  5FKL A;  3A02 A;  3I4M J;  4BBS J;  1SAN A;  4DW6 A;  5F1J A;  2XRL A;  4XRS G;  2FD5 A;  3HEF A;  1Y1V J;  3BR3 A;  3TP0 A;  1LE8 B;  4W1U A;  5C44 J;  5J1U A;  4CYC A;  1NK2 P;  4XK4 A;  2IAI A;  2Y9Y A;  1WCM J;  3WHB A;  4UUS A;  1GV5 A;  4DZJ A;  3TW6 A;  1UHS A;  1JJ8 C;  4A3B J;  5E3M A;  1ORK A;  1FIP A;  4IHV A;  1H8A C;  1UG2 A;  1F43 A;  3GBG A;  1NTC A;  1JGG A;  3S15 J;  4DYC A;  4IHX A;  2DN0 A;  4FCY A;  1ETW A;  1I3Q J;  2W48 A;  5E3N A;  4C3I J;  4GFB A;  1WGX A;  2DMT A;  5C4X J;  2CU7 A;  1E3O C;  3HDD A;  3HOX J;  3M4O J;  3E7L A;  3JRD A;  3CMY A;  2R5Y B;  2L0K A;  1ETV A;  1IUF A;  1GT0 C;  1Z77 A;  2DA2 A;  2DMU A;  1VI0 A;  3RZD J;  1RKT A;  2Y30 A;  4B1R A;  4BY7 J;  3JR9 A;  1JT0 A;  3HOU J;  5IP6 A;  5E3O A;  2GBY A;  1JUP A;  2D5V A;  2KT0 A;  5IP7 J;  3LSR A;  1P7I A;  2IEK A;  5K7Z A;  2WAQ N;  3TP3 A;  5EZG A;  3W6V A;  2EZL A;  3LNQ A;  5K7H A;  2DA6 A;  2KDZ A;  1U9N A;  2QF7 A;  2AO9 A;  3BG9 A;  3IH3 A;  3GTJ J;  1T33 A;  3HOZ J;  5IYB J;  1A5J A;  2VKE A;  4XRS A;  1MH3 A;  3BR0 A;  1VF9 A;  2DA1 A;  4D5F A;  3S17 J;  1H89 C;  3DEW A;  2LVS A;  1FTT A;  1JTY A;  1JKQ C;  1OCP A;  3CQZ J;  3F0C A;  2DA5 A;  2CUE A;  2E19 A;  1JUS A;  1ZR4 A;  2JA6 J;  3C2B A;  4UUS B;  1VND A;  1HF0 A;  3HGY A;  4AC0 A;  1TC3 C;  2H8R A;  1A6I A;  1X2N A;  5BNG A;  4AUX A;  4C3H J;  5E3L A;  1WH7 A;  2DMP A;  4AYB N;  2NVX J;  4EEF G;  3GTL J;  3QPL A;  1TWH J;  5C3E J;  3BT9 A;  2TRT A;  1P7J A;  3JRG A;  1BL0 A;  2X9D A;  2QCO A;  5C4J J;  2R7Z J;  3FK7 A;  3HB9 A;  9ANT A;  3BR5 A;  3RQI A;  3MVP A;  5IOY A;  4JX5 A;  2IBD A;  3JRF A;  2GM4 A;  1POG A;  5F27 A;  1W0T A;  3LOC A;  3WHC A;  5IYD J;  4M3G A;  1ETQ A;  4G12 A;  3BR1 A;  2XGD A;  1YRN A;  2ID3 A;  2R5Z B;  1QVT A;  1QPI A;  4MIM A;  2XPU A;  3BTL A;  3G1O A;  4UUT A;  1RPW A;  2HXI A;  2L7M P;  5FLM J;  3B6A A;  2HOT A;  2CUF A;  1U8B A;  2XSD C;  2NS8 A;  5M3F J;  2I10 A;  1JUM A;  3A01 B;  3LSG A;  4I6Z A;  1AHD P;  2LP0 A;  1MBH A;  2ME0 A;  3S1M J;  4D7M A;  3GTK J;  5F0H A;  3S16 J;  5EG0 B;  4A3M J;  2JA8 J;  5JLW A;  2LY9 A;  3LSP A;  1G2H A;  2K9Q A;  3SJM A;  2EZI A;  1LFB A;  3JRI A;  5IOZ A;  5GP9 A;  1VFC A;  1AKH A;  4FE4 A;  4A3L J;  3DCF A;  4S0H B;  2VI6 A;  5EF6 A;  2DJN A;  3GTM J;  1AU7 A;  2DA7 A;  2HOA A;  1FEX A;  2K9S A;  4M3E A;  1ETX A;  1IDY A;  2H1K A;  2DA3 A;  3QPS A;  5HOD A;  4QTR A;  3K7A J;  5GPC A;  1RKW A;  3GTP J;  5EYR A;  2E1O A;  1ZR2 A;  3JRB A;  3UKG A;  2XB5 A;  3L1P A;  3O8G A;  1GV2 A;  2Y0S N;  2K9N A;  4JP0 A;  4W97 A;  4L5E A;  1IRZ A;  2O7O A;  4B3A A;  2E2I J;  1WH5 A;  1FJL A;  3H3V K;  5JLX A;  3ZQF A;  1HDD C;  2ECC A;  3Q3S A;  1ZK8 A;  2WV1 A;  4M3F A;  4M3D A;  4XRM A;  3NAU A;  4CYC B;  5EGO B;  1W0U A;  2ID6 A;  3IH4 A;  2LK2 A;  2NS7 A;  3MKL A;  4RBO A;  1LFU P;  5EDN A;  2E2H J;  3GTQ J;  2HI3 A;  5FKM A;  1BW5 A;  2VPR A;  4XID A;  3JRC A;  2DMN A;  3VPR A;  1B72 B;  2JN6 A;  2AHQ A;  5F0F A;  2MGQ A;  2LR8 A;  2ELK A;  4I76 A;  1OJL A;  2JMW A;  3PO2 J;  3S1R J;  1O4X A;  1IJW C;  1DU0 A;  1GVD A;  4M3B A;  2M34 A;  2NOG A;  2MW8 A;  4DZP A;  1TWG J;  2LFB A;  3HGG A;  5J3L A;  4A3D J;  5FKN A;  5IPA A;  3BQY A;  2GLO A;  5F0C A;  3ZQC A;  1DU6 A;  1XG1 A;  2OF7 A;  5FLV A;  2LKX A;  1MBG A;  1B8I B;  4BKX A;  3CDL A;  3SFI A;  2EH3 A;  3OIO A;  1JKR C;  3S1Q J;  4D5C A;  4A3I J;  2O9L A;  1JKO C;  3S2H J;  4C3J J;  3HOY J;  1BJZ A;  4V2F A;  2YUS A;  4BXX J;  1MBJ A;  1X58 A;  1D5Y A;  3HM5 A;  5F04 A;  3OSG A;  5EZH A;  4MO7 A;  2G0E A;  2X48 A;  3NAR A;  1H88 C;  1FTZ A;  1IV6 A;  2X6O A;  4IEJ A;  3LSJ A;  2DA4 A;  3IH2 A;  3S1N J;  1MBK A;  2K40 A;  4JYK A;  4NDL A;  2M9H A;  1PUF A;  1IGN A;  1TWC J;  2XGC A;  1MSE C;  4FIS A;  3FIW A;  2Y2Z A;  3BTI A;  2PMZ N;  2RAE A;  3S14 J;  2YU9 J;  5EEA A;  1ZQ3 P;  1Q1V A;  3BR6 A;  1SFO J;  1U9O A;  3I4N J;  2LD5 A;  3SDG A;  1ETY A;  2HYJ A;  5FKK A;  4X6A J;  1U78 A;  2DTZ A;  2O8K A;  3BR2 A;  2XGE A;  1PUF B;  4B4C A;  2NVY J;  1XC5 A;  4FTH A;  1S7E A;  2P81 A;  5J1R A;  1I50 J;  1HLV A;  2B63 J;  4A3J J;  2R5Y A;  2MSY A;  3JRA A;  4A69 C;  2JJ7 A;  2EZK A;  3PO3 J;  1OFC X;  2M0C A;  3Q0V A;  4JX6 A;  4A3G J;  3BG3 A;  3HOV J;  1JJ6 C;  5M5W J;  3A03 A;  4HNV A;  2E2J J;  3ZQI A;  3HOW J;  1CQT A;  3BTC A;  2HOS A;  3TW7 A;  2DMQ A;  4A3K J;  3Q0U A;  2NVQ J;  4ABZ A;  3G1M A;  2JK3 A;  4X1E A;  2MG4 A;  2Y9Z A;  2R92 J;  1RET A;  3MN2 A;  3BTJ A;  3FKI J;  4DYQ A;  1MH4 A;  1F36 A;  1IG7 A;  1GUU A;  3QQA A;  4C2M J;  4XIC A;  4A93 J;  3IV5 A;  1ENH A;  1I6H J;  1TWA J;  1LE8 A;  4V2G A;  3OSF A;  4DYR A;  1B8I A;  4IHY A;  4MFD A;  2L7F P;  3OOU A;  3B6C A;  2FJ1 A;  5DTD A;  2VKV A;  2R93 J;  4BBR J;  1JTX A;  3ZOB A;  1R9T J;  1EF4 A;  3G1L A;  3ZQH A;  3ZQL A;  1T56 A;  2N8G A;  3HKZ N; 
#chains in the Genus database with same CATH topology
 4HF1 A;  2O61 A;  2ZB9 A;  1P4W A;  3V8K A;  2JQ7 A;  3L2W A;  2H09 A;  3QRF F;  1FYM A;  2CQQ A;  1IV8 A;  2LLK A;  3PM1 A;  4CSW A;  4HW0 A;  3BG6 A;  1K61 A;  5K7F A;  3WTU C;  1IN5 A;  4ZH4 F;  4N9H A;  1U5T C;  4KYW A;  4IHW A;  2VN2 A;  2P4W A;  3BJ6 A;  4D7N A;  1H0M A;  1MMS A;  1R1U A;  1DP3 A;  1XSD A;  1RUO A;  4RM2 A;  2ECB A;  1ULY A;  1ZLJ A;  1GDT A;  1FWZ A;  1RR7 A;  1KU7 A;  1YJW I;  2OPT A;  3DKY A;  5CKT A;  4IRI A;  3BZ6 A;  1NK3 P;  2MYS A;  4RAZ A;  5M5X J;  1QRY A;  2ELH A;  1YO5 C;  2GIV A;  3I55 I;  2JPB A;  5LD2 C;  1FOY A;  2EQR A;  1MMD A;  2ZXH A;  3TBI A;  2R7D A;  1WJE A;  3NEU A;  3E3V A;  3GEZ A;  4KT6 A;  2HU9 A;  3WG9 A;  1A35 A;  1ETK A;  2DXI A;  5D5V B;  4BDZ A;  3FWE A;  2D1H A;  1QA6 A;  2BYV E;  3D1N I;  3O6B B;  1QVU A;  4FE7 A;  1APL C;  3ZN0 A;  3JRE A;  1MSF C;  1K79 A;  3KX2 A;  1XS9 A;  3I56 I;  4G6T B;  1LQ1 A;  4EM2 A;  2GXG A;  5B1A H;  4P5O A;  4Y7N J;  2H8W A;  3OIQ A;  1HDP A;  5EG0 A;  2R5Z A;  3DEE A;  3HKZ A;  1WI3 A;  1VQ5 I;  2ME6 A;  1XN7 A;  4F93 B;  2JA5 J;  3OYB A;  3W2A A;  4S05 A;  3KYD B;  2ETH A;  1MDM B;  3DP7 A;  4QPQ A;  2LTP A;  1UAA A;  4AVP A;  5LRS A;  1OMI A;  4QSH A;  1W7P D;  4PFP A;  2HXO A;  3K2Z A;  2CJJ A;  4CCJ A;  3J80 K;  1IXR C;  3LSK A;  1YRN B;  3NQO A;  4IJA A;  3OYG A;  4J19 A;  1Y1W J;  2W57 A;  2TCT A;  3OOP A;  2EIK H;  1YG2 A;  4L18 B;  2QSG X;  2NVT J;  2DQR A;  3LFK A;  4U7B A;  5FKL A;  1W4M A;  1NG6 A;  4LG3 A;  4XRS G;  2FD5 A;  2NS0 A;  3ZQQ A;  1D0Z A;  1Y1V J;  3ZMV A;  2F4M B;  3OIP A;  5C44 J;  4IOA F;  2CV1 A;  3ZPL A;  3GFJ A;  4XK4 A;  2CUJ A;  4F52 A;  3HOS A;  1WCM J;  5B5E C;  4UUS A;  1MIJ A;  4PGG A;  4DZJ A;  2A61 A;  3I58 A;  3WTS C;  4UVB A;  3RYR A;  4M6X A;  5E3M A;  1JJ8 C;  3LSI A;  5F64 A;  1TL8 A;  5J4Y A;  1UG2 A;  3G2B A;  3GWZ A;  4MTD A;  1BM9 A;  3MCZ A;  2PI0 A;  1J2X A;  1OYW A;  3GX4 X;  3H9Q A;  1FNN A;  5IT3 A;  2FE3 A;  2P7V B;  4RAF A;  3E6C C;  5FD6 A;  1R1V A;  1UFM A;  2OC6 A;  3C1D A;  3QPT A;  1VZ0 A;  1EV7 A;  2VBX A;  4OMZ A;  5E3N A;  4C3I J;  2EA4 A;  1WGX A;  2OQG A;  1B59 A;  2CU7 A;  3E97 A;  4A12 A;  2LY2 A;  3I53 A;  4J00 A;  1NH3 A;  1IO2 A;  1UST A;  4LIU A;  2ZNZ A;  4ZYG A;  4XLN F;  2PJP A;  1YW9 A;  2VJI A;  3IKV A;  4BXU A;  1RR8 C;  1J0R A;  1YIJ I;  2L0K A;  1IUF A;  2M7B A;  1GT0 C;  2E71 A;  2DA2 A;  4L0Z B;  3A2K A;  3F72 A;  4KT5 C;  3RZD J;  2ESN A;  5LGN A;  2EFP A;  4BY7 J;  3ZCO A;  1JT0 A;  3KP5 A;  1BOB A;  1LKX A;  2R7X A;  2L02 A;  4G94 A;  1QHH D;  5K7Z A;  2CO5 A;  3GFM A;  3WTZ A;  1RRJ A;  1A04 A;  2EZL A;  3LNQ A;  2OTJ I;  3L7W A;  3A0H C;  2DA6 A;  2L01 A;  1U9N A;  2QF7 A;  5FRN A;  3LMM A;  1OLT A;  3FMS A;  1FOW A;  1P6R A;  2OCC H;  2XRN A;  2FML A;  1B9M A;  1LDD A;  2PMZ A;  4PJN A;  4D5F A;  4II2 A;  2UZK A;  3S17 J;  3HC7 A;  3I59 B;  1H89 C;  3DEW A;  5J40 A;  1FTT A;  1JTY A;  2R7S A;  4ESJ A;  1OCP A;  3N05 A;  3TL4 X;  1BR2 A;  2E19 A;  4HST A;  2JA6 J;  3C2B A;  1TC3 C;  4DBR A;  4MNU A;  5BNG A;  3VWB A;  3CC4 I;  4C3H J;  1WH7 A;  2MBF A;  3H9G A;  4FQG A;  2NVX J;  2AXL A;  1P7J A;  3X2Q H;  5FRM A;  3FXM A;  1PP8 F;  3OYD A;  5EEG A;  2HDW A;  1T0F C;  1OCC H;  5E18 F;  1TP4 A;  2JRM A;  1Y6I A;  3F8N A;  3MVP A;  3RQI A;  3T8R A;  3JRF A;  1MKM A;  3WHC A;  2HTJ A;  3KZY A;  3R0A A;  2VB6 A;  5ILV A;  1ZRC A;  2X1E A;  3MMY B;  4G12 A;  2OCE A;  5JHF A;  2UV1 A;  4DGW B;  1KQ8 A;  3F8M A;  1QVT A;  3TKY A;  1QPI A;  3BTL A;  3PIP F;  3I54 A;  1RPW A;  2HVQ A;  3D0S A;  3TOB A;  2CUF A;  1EH6 A;  2E34 A;  1ZRE A;  1EH8 A;  3K4B A;  5AIP A;  4KN7 X;  4UY8 I;  2XF7 A;  2I10 A;  3BRO A;  5DM7 F;  4Y17 A;  3FKJ A;  1YIO A;  2JSP A;  1Z67 A;  2K3F A;  5IY5 H;  3FHZ A;  1WVR A;  3TGN A;  1TW3 A;  3JAM Z;  5LLQ A;  1LEA A;  5L3G A;  2J5P A;  2PFB A;  4A0X A;  3HSE A;  4LB5 A;  4EJT A;  1G2H A;  1Y39 A;  3ZMT A;  2G7H A;  1U0J A;  3BC8 A;  4BJT A;  3M7G A;  4A3L J;  3OL3 A;  1BI0 A;  4S0H B;  2VI6 A;  4G9Y A;  5ICG A;  1AU7 A;  1FEX A;  3DTE A;  3K10 A;  3J7Y J;  2K9S A;  1T38 A;  2H1K A;  3S8P A;  4O6J A;  2KQR A;  2X85 A;  4BQN A;  2NXN B;  1BR4 A;  2FXA A;  1XGS A;  4YIF A;  5KCM A;  2IVM A;  1ZAR A;  1ZR2 A;  3W2V A;  2CS3 A;  2Q2E B;  1R58 A;  2R3S A;  3MQ0 A;  3JRB A;  3L1P A;  3DKX A;  1FBS A;  1T08 B;  5DEQ A;  4LFU A;  2X4H A;  5HNH A;  2DYS H;  2BW3 A;  4B3A A;  3KZZ A;  2FRH A;  2E2I J;  1TBX A;  2W1O A;  4WXC A;  2XKO A;  4M3F A;  3TMO A;  1W0U A;  2ID6 A;  4EJV A;  3GTQ J;  1HC8 A;  3EET A;  5FKM A;  5CVU A;  4II3 A;  3JRC A;  4P96 A;  5FLX Z;  4EM1 A;  2ELK A;  1ZRD A;  2M4K A;  3EYY A;  4G8X A;  3J80 Z;  5AIQ A;  3S1R J;  3CJR B;  1FMV A;  4ESB A;  3LQQ A;  1G8X A;  4XKB A;  2MW8 A;  2LFB A;  3K1N A;  3MAJ A;  4NC8 A;  5J3L A;  1XCV A;  5FKN A;  4B47 A;  1R7J A;  5JI6 A;  3CMM A;  1Y0N A;  3K4C A;  1FYK A;  1OCR H;  1FSE A;  2OTL I;  1G3Y A;  3I64 A;  1YIT I;  1Z05 A;  2EJR A;  1XG1 A;  5E1W A;  1B8I B;  3V8L A;  3H35 A;  3CDL A;  1XGM A;  3SFI A;  1ODD A;  1JKR C;  1YHQ I;  4D5C A;  4WXH A;  2O9L A;  4I7H A;  2DFH A;  3S2H J;  1YX3 A;  2OQR A;  4C3J J;  4BQA A;  1BJZ A;  4AVZ A;  2WY7 Q;  1FSH A;  3K69 A;  6PAX A;  1R49 A;  1X58 A;  1YW7 A;  1D5Y A;  2FBH A;  2XAH A;  3G6E I;  1FP2 A;  4KNY A;  3IHU A;  3BWG A;  3HXL A;  4DNC A;  2K3P A;  2QEN A;  3DQV C;  2X48 A;  2WAQ A;  1DQU A;  3WGG A;  2FA5 A;  1FTZ A;  5DCM B;  2MD5 A;  3PJR A;  1F4K A;  1J5Y A;  3ZP5 A;  4QLC U;  3IH2 A;  2K40 A;  4CCL A;  4NDL A;  2RQP A;  5HLG A;  2G9W A;  4RGU A;  3FIW A;  4LG0 A;  4EM0 B;  1OQY A;  1FY7 A;  1T39 A;  2KIS A;  1Z7L A;  3I4N J;  2CV2 A;  1R4N B;  2JSC A;  3DBH B;  2V1N A;  4U0Y A;  3JSO A;  1ETY A;  3T5X A;  5FKK A;  4X6A J;  2LBF B;  3K6G A;  2VJ4 A;  2HWV A;  2NVY J;  3PNV A;  4HG2 A;  3VYS B;  4ZDP A;  2XIG A;  4N9I A;  5GAE J;  2KL4 A;  3FHN A;  4FTH A;  5J1R A;  1HXD A;  2V26 A;  3OS1 A;  2EIL H;  2R5Y A;  4G7Z F;  3JRA A;  3K0L A;  3V7S A;  5J6X A;  4ZZD A;  3VSL A;  4UHT A;  2PBI A;  4EJO A;  2E7X A;  2I8D A;  3H36 A;  5BMZ A;  2VT3 A;  3FXO A;  3PO3 J;  4M74 A;  3JW4 A;  3VFZ A;  4E4H A;  2EK5 A;  1IRF A;  3BG3 A;  4E7K A;  1D8K A;  2KDO A;  1IXC A;  2ZME A;  3JCU C;  3CJQ B;  1ZAO A;  3GXO A;  4BE0 A;  2OJE D;  4Y4R A;  2E1C A;  1Q1H A;  2DMQ A;  4YFK F;  4RLQ A;  4ABZ A;  2K9L A;  2KMU A;  1Y56 A;  2JK3 A;  3FBN B;  1R00 A;  4YIR X;  4M71 A;  2R92 J;  1U6G A;  3KP2 A;  1QZY A;  1TQM A;  2BHZ A;  2E5N A;  3SYT A;  4ZYA A;  3KEO A;  3L09 A;  3WE2 A;  1MH4 A;  1F36 A;  3DBR B;  1IG7 A;  1OIS A;  3IKT A;  3QQA A;  4XM3 A;  1ZG3 A;  1ENH A;  1PYV A;  3HUG A;  3IV5 A;  4ZYE A;  1TWA J;  3CO6 C;  4V2G A;  3FX3 A;  1SVM A;  3SEZ A;  2IA2 A;  1AA7 A;  2FEZ A;  5E8G A;  2FF4 A;  3OOU A;  1D1B A;  3B6C A;  1HW5 A;  3CF2 A;  3U2R A;  1A31 A;  4L9V A;  2Z3Y A;  2L5Q A;  2KIF A;  2WC2 A;  2VE9 A;  4HA8 A;  1R9T J;  4IRG A;  3OYK A;  3A0B C;  3G1L A;  3ZQH A;  3BG7 A;  3GME A;  3ASO H;  4WXD A;  2YS9 A;  2HQA A;  4LIT A;  2WB1 N;  4I01 A;  4XQF A;  1HOM A;  2RRE A;  3R6S A;  1ACI A;  2H94 A;  4XL9 A;  4N4N B;  3WGI A;  3M8F A;  4IVN A;  1RNL A;  3QU6 A;  3SZP A;  3MD2 A;  5CVI A;  3QOP A;  3OYE A;  3BLY A;  3VYR B;  1EJ9 A;  1U8R A;  4CIC A;  1YS7 A;  3WU2 C;  2F5C A;  1UMQ A;  1TTY A;  4I09 A;  2F5F A;  1UJ8 A;  4XLH A;  1TT0 A;  4B09 A;  1BW6 A;  5LFA A;  4OAZ A;  1G6N A;  3IC7 A;  3H0G J;  2V7F A;  3REO A;  3ROU A;  3HBL A;  4WK8 F;  3TED A;  1HCR A;  4Y13 A;  5JFR A;  3NRV A;  1MND A;  4G6D A;  2V9V A;  1K83 J;  3CD6 I;  5KHD A;  2A6E F;  3BCB A;  3CCJ I;  1BA5 A;  3CES A;  4PJM A;  5F08 A;  4PDK A;  1V4R A;  2JWT A;  4PSX A;  2EB7 A;  4MQ9 F;  1EA3 A;  1XB4 A;  1SAU A;  4UV8 A;  3D5L A;  5AON A;  5L3B A;  1VQ9 I;  2QLZ A;  1T6S A;  3GO5 A;  1ETO A;  2W4S A;  3ZMS A;  2HDD A;  4KJZ A;  2CQ7 A;  1SFU A;  2D1V A;  2FNA A;  2A3S A;  5M3M J;  2V6E A;  2HYF A;  4U88 A;  3AL0 B;  2EBI A;  3LQR A;  4OIR F;  3ABL H;  3CDH A;  2AQE A;  3KP4 A;  4E7I A;  2EFQ A;  3HSF A;  4PGH A;  3QYF A;  2JPC A;  2ZME C;  3F6V A;  5CLS A;  2VKH A;  4C2U A;  2XB0 X;  3AG1 H;  4I02 A;  5B66 C;  2WBM A;  2G7U A;  1H9G A;  2DT5 A;  5BPI A;  2VUM J;  1VQM I;  3RPU D;  3BG5 A;  2Q0O A;  2LF8 A;  4IF4 A;  2EIJ H;  3A02 A;  1BN5 A;  3O3K A;  3QP5 A;  1YLF A;  1K7A A;  4BBS J;  5B3S H;  2XRL A;  2KIU A;  2JRT A;  3Q5F A;  1Z6R A;  4BNC A;  1LE8 B;  2E1M B;  2XAS A;  1MJB A;  5J1U A;  3DTK A;  3DTI A;  2IGM A;  3ABK H;  4P9F A;  1NK2 P;  5E17 F;  4NC6 A;  1DGR M;  2M1B A;  4HDU A;  2CMP A;  4DJA A;  1GV5 A;  1XD7 A;  2KRF A;  5CVV A;  3TW6 A;  2DO7 A;  1UHS A;  3RDI A;  5J8C A;  2XVC A;  4KIT B;  2KRC A;  1Z6T A;  1H8A C;  3KIO A;  1F43 A;  1HST A;  1X4P A;  3GBG A;  3FXL A;  1NTC A;  3S15 J;  4LLL A;  1KQ9 A;  2F48 A;  4CUG A;  5HLT A;  2C6Y A;  1ETW A;  1U3E M;  4GFB A;  4XOR A;  1W5T A;  2LBF A;  5TRD A;  3PNY A;  1W5S A;  5JVT A;  1O3S A;  5HLH A;  3V7R A;  5DDG A;  1KYZ A;  3OY9 A;  2BE5 F;  3EQL F;  2RQQ A;  3ZMD A;  4XLA A;  3V42 A;  3OS2 A;  2VC0 A;  3W6J B;  3QU3 A;  2M4G A;  1T2K A;  3HRT A;  1R22 A;  1G3T A;  3RPQ A;  1Z77 A;  2Y30 A;  3ABU A;  2VC1 A;  3CMA I;  2V6C A;  3JR9 A;  5CVR A;  5K5Q A;  2LKS A;  5IP6 A;  2ISY A;  2EWN A;  4HNT A;  2GBY A;  3WTW C;  3LSR A;  4ZDO A;  2IEK A;  3RIR A;  4GDF A;  2H1L A;  1FYL A;  1PJR A;  1FZP B;  5EZG A;  1P92 A;  2IT0 A;  5K7H A;  3I71 A;  1DUX C;  3GTJ J;  4RMN A;  3HOZ J;  1YFH A;  1A5J A;  3HTU A;  4FET A;  2VKE A;  3OYC A;  4ESF A;  4GO1 A;  1ON2 A;  1SEU A;  5BS6 A;  3ZN1 A;  5J8F A;  1V55 H;  2DA1 A;  4EJU A;  1O7F A;  2BBY A;  2MAB A;  4L9J A;  2ZJQ F;  2J5O A;  2FU4 A;  1LEB A;  2KPM A;  1JKQ C;  2W82 A;  3RKW A;  3T1B A;  1ZR4 A;  1JUS A;  3PQK A;  4PFO A;  4AC0 A;  3C3W A;  2H8R A;  1O3T A;  1A6I A;  1X2N A;  3ECH A;  5F1R A;  4NB5 A;  2VJJ A;  4CZC A;  2LDU A;  4EEF G;  2CWE A;  2M8E A;  3K4M A;  2DU9 A;  1TWH J;  5C3E J;  1BL0 A;  2TRT A;  2A6H F;  1FOK A;  1SFK A;  2QCO A;  4LMY A;  1S5L C;  2WTE A;  4BHB A;  1BC7 C;  4BYY A;  1HBX G;  3HHH A;  2QGU A;  1T8I A;  1I5Z A;  3BR5 A;  4JX5 A;  2IBD A;  1MDM A;  3GYH X;  2GM4 A;  1W0T A;  2O03 A;  1SD4 A;  3DBL B;  3HIF A;  1ETQ A;  4M72 A;  3ML6 A;  1MZB A;  1JHH A;  3EUA A;  3OR2 C;  1YRN A;  3CCV I;  3M1E A;  3RCO A;  3G1O A;  3WG7 H;  4BQO A;  3L2Q A;  3E0J B;  3VOD A;  2BOL A;  1EH7 A;  1S7A A;  2E35 A;  2VXZ A;  4HLY A;  4RS8 A;  1OKR A;  5J47 A;  1U8B A;  3H1C A;  1LVK A;  2NS8 A;  1K78 A;  4D1Q A;  1DP7 P;  1IN4 A;  1JUM A;  3K70 C;  2F5V A;  4YEL A;  2L9V A;  3I0T A;  3S16 J;  5FD5 A;  4PUS A;  5LBQ A;  2LY9 A;  3LSP A;  1H9T A;  2EPF A;  2GWR A;  2QEX I;  1TNS A;  1LFB A;  3JRI A;  2E7W A;  1CGP A;  2CQK A;  1AKH A;  1ZGJ A;  4BE1 A;  4FE4 A;  1T98 A;  1R36 A;  3DCF A;  3WU0 A;  1BI1 A;  4WCG A;  3DLA A;  3RYP A;  2Z2S B;  2HVR A;  1QQI A;  1XMK A;  2LRE A;  3LSM A;  3PQJ A;  1RI7 A;  2YU3 A;  4M3E A;  4ASN A;  1KU9 A;  2DA3 A;  3QPS A;  4R79 A;  3K7A J;  3GTP J;  2B7E A;  2ZFU A;  2NOJ B;  1TQI A;  3R4K A;  3Q9V A;  1GV2 A;  3M07 A;  1BOA A;  1IRX A;  3WTT C;  3E6D A;  4HX8 A;  2OD5 A;  4JP0 A;  3GLX A;  2QVO A;  1BI3 A;  3CLQ A;  4W97 A;  1TNT A;  4XBF A;  5HDN A;  2DOD A;  1FJL A;  5LHI A;  5HLI A;  4BS9 A;  4KIC A;  2WV1 A;  3ERE D;  2P5L C;  3NWT A;  4M3D A;  5D5X B;  2FBK A;  3IH4 A;  2NS7 A;  3MKL A;  5GAG J;  4RBO A;  1LFU P;  2HI3 A;  2VPR A;  3GLL A;  3C18 A;  2O3F A;  3VPR A;  3CCQ I;  2JN6 A;  1SVL A;  4A5N A;  2WV0 A;  4P1W A;  4F3Q A;  2DOE A;  1N75 A;  1OCO H;  2JMW A;  3BJO A;  3PO2 J;  3KZI C;  3KLN A;  2H6C A;  2ADU A;  4BE2 A;  3K1P A;  2QBY A;  1DU0 A;  1GVD A;  2M34 A;  2RC4 A;  2NOG A;  2QZ8 A;  3V8J A;  2M45 A;  2GOX B;  2IPQ X;  4DZP A;  4OMY A;  1TWG J;  1IW7 F;  2K4B A;  2GLO A;  2IA0 A;  5F0C A;  1X1P A;  3ASN H;  3BZC A;  1XSX A;  4BUP A;  2Z5U A;  3C2H A;  3PL8 A;  2LKX A;  1BIA A;  4HQE A;  2EFW A;  1S3J A;  1X1C A;  4BKX A;  4WWC A;  3WGH A;  4E7Z A;  2EH3 A;  2AS5 F;  1R4M B;  4N0B A;  5HOO A;  4HAM A;  1JKO C;  2QA4 I;  1IN6 A;  2CSO A;  2KIQ A;  3HOY J;  4XSX F;  4BXX J;  1MBJ A;  1ZLK A;  3HM5 A;  2A6T A;  5F04 A;  4L0Y B;  5EZH A;  2G0E A;  3VSK A;  2CUZ A;  1H88 C;  2XAQ A;  4JBA A;  4J01 A;  4NNJ A;  5D5W B;  1IV6 A;  2XAF A;  3LFU A;  1R1T A;  2HGC A;  3EDP A;  3FDY A;  4IEJ A;  5ICC A;  3OYJ A;  1MBK A;  4JYK A;  3ZMU A;  3IAM 2;  4HQM A;  1PUF A;  2VT2 A;  2PJR B;  1S29 A;  2XGC A;  4ANJ A;  2R7R A;  2R7V A;  3FXJ A;  2RAE A;  3RJP A;  3V7C A;  5EEA A;  2JZY A;  1E2X A;  1SVO A;  1YYV A;  3QYE A;  1YTY A;  2B0L A;  1W7P B;  4ENN A;  1SAX A;  2DDA A;  4Q48 A;  2DLL A;  3SDG A;  2STT A;  2HYJ A;  1USS A;  4E7S A;  2UUZ A;  4GRI A;  4HX7 A;  1FOX A;  2DTZ A;  2OAZ A;  4N4O B;  4NQW B;  2JVH A;  3TQN A;  4B4C A;  2OBP A;  2F5E A;  1ZN2 A;  4RA2 A;  4M9S A;  5A2Q Z;  1QU3 A;  1HW1 A;  3CUQ B;  5D6F A;  2ZJR F;  1W7P A;  4RGX A;  4A3J J;  2XRO A;  5HVQ C;  1IRG A;  3FM5 A;  4EJW A;  2EZK A;  4OOI A;  2M0C A;  4BQQ A;  1FBQ A;  1W5C C;  2EIM H;  4AD9 A;  1W1W E;  1QBJ A;  3HOV J;  1ZGA A;  4HNU A;  4XN0 A;  1JJ6 C;  1Y0U A;  2E2J J;  2CW7 A;  3ESW B;  3SXY A;  1VTN C;  3ZQI A;  4F7Z A;  3HOW J;  2HOS A;  4KIF A;  4ENM A;  1S7O A;  4CCK A;  3MZ8 A;  2ISZ A;  3G1M A;  2W85 A;  3LA3 A;  2PX9 A;  4X1E A;  2MG4 A;  2NNN A;  2Y9Z A;  1KA8 A;  3PIO F;  4XSZ F;  3WTY C;  2K9M A;  2O6G E;  1DPR A;  3MN2 A;  3FKI J;  2ZXW H;  3G71 I;  3KYL A;  2BXY A;  3KCC A;  3DLL F;  1JI8 A;  3CC2 I;  4XIC A;  1I6H J;  4EQQ A;  3DV8 A;  2NYX A;  1LE8 A;  2AXT C;  2V79 A;  3T0Y A;  3OYI A;  1GXQ A;  5BQT A;  1X19 A;  1NG7 A;  2R7U A;  2FJ1 A;  2K4J A;  3C2G A;  4R1H A;  2VKV A;  4IQ4 A;  5DTD A;  4X0G A;  5GAD J;  4BBR J;  5HDG A;  1JTX A;  2F6C A;  1EF4 A;  5K5O A;  2CQN A;  1VQL I;  1WRJ A;  4MGR A;  5F6F A;  2R7T A;  1SC7 A;  1N25 A;  1DPU A;  5BOX A;  3BDD A;  2COB A;  4XLE A;  1V5F A;  4KIB A;  3ZMZ A;  3K2A A;  2HS5 A;  3A4C A;  3ZQG A;  3L00 A;  4I2O A;  3RKQ A;  4HBL A;  4U0V A;  4L9N A;  3CCY A;  4QIW N;  3VOE A;  1V5E A;  5J4V A;  2JUG A;  4I0B A;  2DBB A;  5LEJ A;  2HNH A;  3EPZ A;  5HNF A;  1ZGW A;  2H27 A;  1B72 A;  2RV8 A;  3S2D J;  4AU7 A;  5ED4 A;  2ESH A;  3FXK A;  2FX0 A;  4RDU A;  2VIX A;  1LDK B;  4EGY A;  3GFI A;  3LSH A;  3K70 D;  2E36 A;  2M2E A;  3HRU A;  4Y15 A;  1MD0 A;  3SZT A;  4OIO F;  3IRQ A;  2CFO A;  2A5Y B;  1BC8 C;  1R5G A;  3FMQ A;  1OR7 A;  3LA7 A;  3W6K B;  1IC8 A;  2MH9 A;  3BJA A;  4A3C J;  2WWY A;  4B48 A;  5E1Z B;  2LG4 A;  2L4A A;  1STZ A;  5FKO A;  1MBE A;  2Z1D A;  3FMR A;  5DYM A;  4BY1 J;  3DPT A;  4KIG A;  1F9N A;  3TDZ C;  1D0Y A;  1IDZ A;  4A2U A;  1K78 B;  1AKH B;  2M3A A;  1JT6 A;  1WJB A;  1X1D A;  3ZR8 X;  3F21 A;  4MFE A;  4DQ2 A;  1S6L A;  1WPK A;  2Y0S A;  1Z91 A;  2A5W A;  1YJ9 I;  3WTV C;  2JA2 A;  2XDV A;  2CQX A;  3KYC B;  1FIA A;  4XKW A;  3JAM K;  1SFE A;  5HS9 A;  4CZZ A;  2GA2 A;  3DF8 A;  4MLO A;  4BGD A;  1XDU A;  3P7N A;  4HF0 A;  4XOP A;  5CQE A;  3A01 A;  3H0D A;  4XLF A;  3M3Y J;  3F8F A;  1ZKG A;  1B9N A;  4M6V A;  1DGW Y;  1Y8Q B;  1O3Q A;  3E5Q A;  3TO7 A;  2CRG A;  5JVG F;  3ONQ A;  4YFX F;  4JX4 A;  4A3E J;  3H5R A;  1QZZ A;  4HLX A;  3HOT A;  2P8T A;  4E7H A;  4V19 K;  4LOC A;  1YS6 A;  4BEH A;  4M9X A;  2QQ9 A;  2P7C B;  3CME I;  1TLH B;  1VQ8 I;  3SHF A;  3OYM A;  5CYV A;  4A3F J;  1KQ0 A;  5IT9 Z;  2X1C A;  3DFG A;  2QWW A;  3I4M J;  4DW6 A;  5F1J A;  4GCV A;  4GGG A;  1YJN I;  1K6O A;  3HEF A;  3R0J A;  2KJC A;  3BR3 A;  3HHG A;  1J09 A;  2XSJ C;  3TP0 A;  1G4D A;  3U9G A;  2IGN A;  4W1U A;  4QWQ A;  3IL2 A;  4DIQ A;  2IAI A;  4HSR A;  4IHT A;  1MJ9 A;  3P9I A;  2ZO4 A;  1LB2 A;  4QPO A;  2PEX A;  1U5T A;  1ORK A;  2W7N A;  1Z1D A;  3ECO A;  3Q9S A;  2R4G A;  3ABT A;  4Y33 A;  2KZV A;  3L2R A;  5TJJ A;  1RUN A;  1JGG A;  2BY3 A;  4CO8 A;  3CCS I;  3ZXS A;  4C30 A;  3WTX C;  1PVE A;  3B73 A;  2W48 A;  3OYL A;  2ZME B;  4U87 A;  1G3S A;  4CA0 A;  1SD5 A;  3I9V 2;  2DMT A;  2QM3 A;  3S3N A;  3HDD A;  1AWC A;  4KA4 A;  3JTG A;  3F8C A;  2WAD A;  3B02 A;  3M4O J;  2XKP A;  1I27 A;  1OPC A;  3OYN A;  2GIZ A;  2OZ6 A;  3GZN B;  3J81 Z;  4IXA A;  2Q1Z B;  2F4I A;  3CMY A;  2R5Y B;  3PUB A;  1OR7 C;  3FZV A;  5HS8 A;  3ZRG A;  4GYG A;  1HSJ A;  2YPR A;  4AM3 A;  2BZT A;  2DOF A;  1KU3 A;  2DT7 B;  3R61 A;  2KHM A;  4B44 A;  2M0M A;  1QO0 D;  1HKQ A;  2NAZ A;  2QSF X;  2FBI A;  3HOU J;  2HQN A;  2QYO A;  4PCQ A;  5E3O A;  2QUF A;  2K85 A;  1ZRF A;  1JUP A;  2CV0 A;  4F55 A;  1QGP A;  1N77 A;  1ZG5 A;  2KT0 A;  5IP7 J;  1B4A A;  2WAQ N;  3TP3 A;  3HL2 A;  2GQQ A;  2FOW A;  5K1Y A;  3E6M A;  3LST A;  5D5U B;  2VL8 A;  3R60 A;  3IH3 A;  1T33 A;  2LMD A;  1X1A A;  4ZDL A;  2DPU A;  5IYB J;  3MKZ A;  1ZEL A;  3L9F A;  2JVG A;  1O3R A;  1MH3 A;  3PFY A;  4O5V A;  1LDJ A;  5EJC A;  3JTH A;  2HPM A;  4XMY A;  2RDP A;  3AAF A;  1OYI A;  2LVS A;  3KEY A;  3AG3 H;  1O7L A;  2L9S A;  2VQC A;  4D9J A;  3LAP A;  2DA5 A;  1ZHF A;  2VKD A;  3BCA A;  1FP1 D;  3HGY A;  2P6T A;  1YI2 I;  3H3U A;  1L0O C;  1Z3X A;  2UXN A;  2LRD A;  2KP6 A;  2IXS A;  1CF7 A;  3PFI A;  3OL4 A;  2QBY B;  3GTL J;  4ETS A;  3QPL A;  3JRG A;  2X9D A;  5FRO A;  4U7D A;  3CCL I;  4UV9 A;  3FK7 A;  4I98 B;  9ANT A;  4L5J A;  5IOY A;  2OUM A;  5FFZ A;  1R71 A;  4BHC A;  2K7L A;  4TV7 A;  5H6Q A;  5IYD J;  4ZTJ A;  1Z21 A;  3QP6 A;  3BR1 A;  4ZTF A;  2VQL A;  2Y0M A;  2FMY A;  3I3L A;  3WE3 A;  2ID3 A;  4ZYH A;  1PP7 U;  3UNG C;  5L3D A;  1P9Q C;  2GAU A;  4YFN F;  2FUG 2;  2L7M P;  3TO9 A;  2HOT A;  3IUO A;  3GFL A;  3OR1 C;  1E3H A;  3SDB A;  4CH7 A;  2MD0 A;  5M3F J;  2DAO A;  2Y69 H;  3FM3 A;  5E79 C;  1UCR A;  4AIK A;  2VON A;  5L3C A;  3LSG A;  4I6Z A;  1IF1 A;  2IS4 A;  2LP0 A;  4UUV A;  4D7M A;  4IRH A;  5F0H A;  1XGO A;  2Z99 A;  3PSI A;  3W2W A;  2IGK A;  3V4G A;  4A3M J;  2NRA C;  5JLW A;  3QWL A;  2K9Q A;  4WX9 A;  2RKH A;  2EZI A;  2WAF A;  1WFX A;  4OAY A;  5GP9 A;  5IOZ A;  1VFC A;  3MZY A;  2DQL A;  1L3L A;  1ON1 A;  1K6Y A;  3SZG A;  4MEX F;  3P9K A;  2DJN A;  3GTM J;  2L2O A;  5D8K B;  1WWX A;  1FMW A;  2ZJP F;  2UWM A;  1ETX A;  1IDY A;  2EV0 A;  2LNB A;  3BZK A;  3RKX A;  5HOD A;  1WZ2 A;  4PSW A;  2M7A A;  2WB1 A;  1TZL A;  4UVC A;  3HTS B;  3DPL C;  2E1O A;  3TOA A;  4KDP A;  2QKL B;  4EMS A;  3E5X A;  1XMA A;  2KLO A;  2PLY A;  3DEU A;  2LY1 A;  3ZGK A;  5D4S A;  4ITV A;  1IRZ A;  2O7O A;  5GTH C;  1WH5 A;  2EV6 A;  3CF5 F;  2VAS A;  3K4N A;  5JLX A;  3BY6 A;  1HDD C;  3Q3S A;  4KIS A;  4CDG A;  3QAH A;  4XRM A;  3NAU A;  1WSU A;  5EGO B;  2X6W A;  2E2H J;  1UG0 A;  1ERD A;  2DYR H;  3FXR A;  4ON0 A;  3F22 A;  4XID A;  2VJ5 A;  2DMN A;  3CCM I;  3CJT B;  4RLF A;  4JQF A;  2DFI A;  1WJC A;  1D8J A;  2MGQ A;  3M1C A;  4BJ5 C;  4I76 A;  2STW A;  4XRF A;  1QPM A;  2FOK A;  1K4T A;  1O4X A;  4UXN A;  1JXS A;  1GXP A;  2MA3 A;  4BJ6 C;  5EEH A;  1OYY A;  2PN6 A;  2VPL A;  3VYT B;  3HGG A;  1FLI A;  3KFW X;  5L3E A;  4A3D J;  3JSP A;  2A05 A;  4KMU X;  2JT1 A;  5IPA A;  5IT9 K;  2EA2 A;  4PJL A;  1S72 I;  5BPD A;  3KLO A;  4E7J A;  2E1N A;  2OF7 A;  1MBG A;  3NWS A;  2X0L A;  3HRS A;  1CF7 B;  1MGT A;  2K27 A;  3OIO A;  3HUG B;  5ICE A;  3T8T A;  5D4R A;  2KIM A;  5DUK A;  2O5R A;  3PSF A;  2L9N A;  2V9P A;  2DFE A;  5K5R A;  2VLA A;  2IRF G;  2YUS A;  2IJL A;  1ZH5 A;  1P4A A;  2X6Y A;  2GZW A;  1LPQ A;  3KP7 A;  2O0Y A;  2DCE A;  2HOE A;  2ZJ2 A;  3CP2 A;  3U21 A;  2X6O A;  1LNW A;  1T0F A;  3K9T A;  3SEQ A;  2Z16 A;  4C2T A;  2DA4 A;  4NBQ A;  2HYG D;  2M9H A;  1QNT A;  2PMU A;  2V9K A;  2HZD A;  4PK4 A;  1MSE C;  3K4K A;  4FT8 A;  4GYI A;  3CZ6 A;  2Y2Z A;  2R7O A;  3BTI A;  3F23 A;  4ZJZ A;  2L3D A;  2PMZ N;  3M8J A;  4Q47 A;  3OWT A;  3OMY A;  2WAE A;  1HKS A;  4A6E A;  4XLP F;  2ZCW A;  3BR6 A;  3VDX A;  4CCN A;  1SFO J;  2VQH A;  2MC3 A;  1FT9 A;  2LD5 A;  4LG0 B;  3DXJ F;  5DV5 A;  2HR3 A;  1U78 A;  4XON A;  2O8K A;  2XGE A;  4DBQ A;  5DD8 A;  4HV6 A;  3HJE A;  3VEP A;  3J7Z I;  1HW2 A;  4EGZ A;  1S7E A;  4LD5 A;  4LK0 F;  4XN3 A;  1I50 J;  3C7J A;  2ZXI A;  5LGT A;  2BEO A;  2OV7 A;  2MSY A;  5LEK A;  1B6A A;  2W84 A;  3AFH A;  3OYF A;  3BOQ A;  2A69 F;  3AL0 C;  1OFC X;  3Q0V A;  5GTI C;  1SMT A;  2DK8 A;  4A3G J;  2Z9O A;  1E0E A;  1IN8 A;  1C0W A;  2DDB A;  4HNV A;  1VQN I;  1W36 C;  4OU0 A;  4CGZ A;  1J7K A;  1CQT A;  1I3A A;  1V3F A;  2VE8 A;  5DCM A;  3TW7 A;  4AYB A;  3GZ6 A;  4A3K J;  5DUI A;  3Q0U A;  2NVQ J;  3IRR A;  2NVU B;  4FHT A;  1JGS A;  4RAY A;  1NHA A;  2F2E A;  4E6K G;  3K4J A;  4GXO A;  3ERM A;  2CW0 F;  1MMN A;  1U5T B;  1XTA A;  2ZSH B;  5LRR A;  1XMX A;  1VQO I;  3ZQ7 A;  4DYQ A;  4M9Z A;  1GUU A;  5KAI C;  4A93 J;  3KE2 A;  1BIB A;  2HPI A;  4LJZ F;  2JTV A;  3OSF A;  2B9S A;  1IUY A;  1KON A;  4DYR A;  1B8I A;  2BGC A;  3S3M A;  5TGT A;  2E1M C;  2P5K A;  2R93 J;  1JHF A;  2P5V A;  4OIN F;  4I99 C;  1TQP A;  3CUQ C;  4OWR B;  2ZC2 A;  4IX7 A;  1FPQ A;  3BPV A;  2GXA A;  3ZQL A;  3FXU A;  4UB6 C;  2N8G A;  1R5H A;  3PUF A;  3HKZ N;  1I1S A;  3FIS A;  3GUD A;  2DW4 A;  2EFO A;  2ICW G;  3RZO J;  1IN7 A;  1J9I A;  3CCR I;  1YW8 A;  1TWF J;  1WI9 A;  2BW3 B;  1IXS B;  2XHK A;  3SQN A;  5M5Y J;  2Y31 A;  1ZTR A;  2CH0 A;  3BQZ A;  2L9R A;  1WQ2 A;  1S9H A;  3IWF A;  2Q2E A;  3S32 A;  1D1C A;  1QHG A;  3D5R C;  1VQK I;  2UXX A;  1YQA A;  1BR1 A;  4MEY F;  3VB2 A;  3H92 A;  5EGO A;  2IS6 A;  3GTG J;  2BVM A;  1RES A;  2QKM B;  5GPA A;  3UR3 C;  4KUM A;  4Q4Z F;  1GLN A;  1KU2 A;  2EFN A;  5FO5 A;  3FK6 A;  2Z33 A;  3F9K A;  2PG4 A;  4F92 B;  1JKP C;  5DS9 A;  2EZH A;  2XPW A;  2PMH A;  1Z0X A;  5IYC J;  2F5D A;  3Q0W A;  3S93 A;  5KVR A;  1BBY A;  1X2M A;  2HQR A;  2L7Z A;  5J1Y A;  3LL7 A;  4EV0 A;  3BP8 A;  1K4S A;  2RN7 A;  1T95 A;  1D0X A;  4P9U A;  4BDY A;  4YII A;  2P6S A;  2KKO A;  4NC7 A;  2M8G X;  3QPH A;  2GOM A;  1WKM A;  1PDN C;  2Y48 A;  3J7A Y;  1KZH A;  2R0Q C;  1WJF A;  3F6O A;  3GF2 A;  3H5A A;  4IO9 F;  2DT6 A;  4XKV A;  1OCT C;  4HX4 A;  2YX4 A;  2O8X A;  4C9Y A;  3EUK L;  1JE8 A;  2KZG A;  3GTO J;  1KGS A;  4NUB A;  2DOA A;  2XPV A;  5FJ8 J;  5E20 A;  1MNM C;  3RQ4 A;  3A1Y A;  4PJJ A;  3W3C A;  4HF2 A;  4B43 A;  4HDV A;  4UNO A;  2X51 A;  4B3X A;  2DJI A;  2VBZ A;  3JRH A;  4Y52 J;  1V5G A;  5IP9 J;  1MBF A;  3VYU B;  4YEJ A;  3CCE I;  3N4M A;  1YX5 A;  4KMF A;  5DD4 A;  3H5N A;  5B1B H;  4D0P A;  2KJB A;  2FQ4 A;  3EYI A;  2IA1 A;  3O8H A;  3OV8 A;  4Y3O A;  1ITY A;  3CDI A;  5HS7 A;  2JA7 J;  3GW2 A;  2BHY A;  3L2C A;  2HQ5 A;  1XCB A;  4IPA A;  2MLG A;  4R8H A;  5ERI A;  1U2W A;  4JK1 X;  1R6R A;  3AG4 H;  3S3O A;  2PQ8 A;  3KPH A;  3P9C A;  1TW2 A;  4OIQ F;  1SAN A;  2L54 A;  4RGR A;  5LHG A;  3O2P E;  2IGO A;  5TIS C;  2BY1 A;  4AIJ A;  4CXF A;  4A0Z A;  2VOD A;  3BPX A;  2Y9Y A;  1I6X A;  3CCU I;  3WHB A;  1DDN A;  1FX7 A;  3GCM A;  2L7K A;  3L2U A;  4HRI A;  4IHS A;  4A3B J;  1FIP A;  3TO6 A;  4DOZ A;  1ZG1 A;  4IHV A;  1HKT A;  2ZFW A;  1XPX A;  2A68 F;  4E7L A;  4BL0 B;  2M30 A;  3I59 A;  4LGW A;  4DYC A;  4LIV A;  3HZJ A;  4IHX A;  2GXB A;  4O3M A;  4BXF A;  2DN0 A;  4FCY A;  1I3Q J;  3E5U A;  1WJD A;  4XOT A;  1BI2 A;  5KK1 A;  4I0A A;  5C4X J;  1E3O C;  1RIO H;  3HOX J;  2COM A;  3EUH C;  3CTA A;  3MFK A;  3E7L A;  4IL6 C;  4UB8 C;  3JRD A;  2HDC A;  1MW7 A;  2DFF A;  3CP8 A;  4RB1 A;  4M73 A;  3KP6 A;  4RB3 C;  1ETV A;  2KRH A;  4A6D A;  2ZBK A;  2ZNY A;  1LFP A;  1A6Q A;  2RNG A;  2W25 A;  3P5J A;  3OS0 A;  2DMU A;  3IAS 2;  1VI0 A;  1M1E B;  1RKT A;  4G6Q A;  1QZE A;  4B1R A;  2OA4 A;  5ILS A;  1LUJ B;  3OYA A;  1VQ4 I;  3DU6 A;  2QQ8 A;  2HFH A;  2ELJ A;  3H3Z A;  2XF6 A;  5A2Q K;  4CYD A;  2D5V A;  1P7I A;  3W6V A;  1N78 A;  2M5W A;  2LC2 A;  5FB2 A;  2Y75 A;  2MC4 A;  3G3Z A;  1GVJ A;  2KDZ A;  3N97 A;  2ACJ A;  2AO9 A;  3BG9 A;  1GHC A;  2PJR A;  1MMA A;  3HYI A;  3DPU A;  3K4L A;  4AID A;  4A0Y A;  4MHG A;  3AKZ A;  4XRS A;  1XSV A;  3BR0 A;  4LB6 B;  1RC9 A;  1YE9 A;  2XAG A;  1VF9 A;  1UEL B;  5H2F C;  4S04 A;  3IWZ A;  4L9T A;  3CQZ J;  1YOV B;  3F0C A;  3U1K A;  1W36 D;  2CUE A;  4M6Y A;  3FF5 A;  4UUS B;  2V1U A;  1VND A;  1HF0 A;  5GAH J;  4H4K C;  4ZC3 A;  3HRM A;  3MKY B;  2BXZ A;  2LF7 A;  4BEH B;  1Z9C A;  2OZU A;  4AUX A;  5E3L A;  4EAT A;  1X3W B;  2DMP A;  4AYB N;  2VXD A;  5JR3 A;  2VOO A;  1BJA A;  3BT9 A;  3M9A A;  3G73 A;  4FX4 A;  4P55 A;  4U0W A;  4ZYD A;  2IS2 A;  5C4J J;  2R7Z J;  3HB9 A;  1I39 A;  3S2W A;  2HEO A;  2XAJ A;  1Z7U A;  1POG A;  5F27 A;  1X3Z B;  2CYY A;  3LOC A;  1IAW A;  4LLG F;  2DI3 A;  4M3G A;  1SD6 A;  2XGD A;  1R5I D;  2CG4 A;  2R5Z B;  3KP3 A;  3MEX A;  4RB0 A;  4MIM A;  2XPU A;  1B1B A;  3KET A;  4RGS A;  4HZF A;  4AIH A;  2CGP A;  4UUT A;  2HXI A;  5FLM J;  4XNF A;  4AWX B;  4CCM A;  3B6A A;  3DWL E;  3WU1 B;  2EV5 A;  2XSD C;  4PJ0 C;  3H9J A;  5FFX A;  3A01 B;  1P4X A;  1AHD P;  5FGM A;  1MBH A;  2ME0 A;  3S1M J;  3GTK J;  4XR6 A;  4HPQ A;  1WJ5 A;  2XGX A;  5EG0 B;  2H6B A;  1S8N A;  3J7A O;  2JA8 J;  2I5U A;  3KEQ A;  3RKY A;  2BVL A;  4K2E A;  5LGU A;  3COA C;  3FBI B;  3SJM A;  2BV6 A;  1X1B A;  4XKC A;  3U1D A;  2A07 F;  1Z3Y A;  3HPG A;  1D3Y A;  1XDS A;  5EF6 A;  2DA7 A;  4ZZL A;  3ISP A;  2HOA A;  1LJ9 A;  2V4J C;  4G7H F;  4G7O F;  1XX5 A;  3IP4 B;  4BU2 A;  5KAF C;  3QYB A;  2FQ3 A;  5DM6 F;  5DCF A;  4QTR A;  3DU5 A;  5GPC A;  1RKW A;  2L4M A;  2D45 A;  1EKE A;  2WA0 A;  5EYR A;  4LLN A;  3UKG A;  2XB5 A;  3EUH A;  5JHU A;  3O8G A;  2ZKZ A;  2BY2 A;  2Y0S N;  4A5M A;  2K9N A;  4NHJ A;  3D5S C;  4OIP F;  4L5E A;  4FAS D;  3GVA A;  1IZ1 A;  1WJA A;  2HKX A;  2YSR A;  5H20 A;  2R7F A;  3H3V K;  1I1G A;  2HZT A;  3OYH A;  1SFX A;  2LSO A;  3AG2 H;  3ZQF A;  2ZSI B;  2ECC A;  1ZK8 A;  2HTS A;  3PNT A;  5KNL A;  2OU2 A;  2LH9 A;  2XUB A;  4CYC B;  2FSW A;  2LK2 A;  4BHP A;  2E60 A;  2XAU A;  5EDN A;  2VOP A;  3RI4 A;  1BW5 A;  4MQV A;  3ELK A;  4H0E A;  1Y8R B;  4EVI A;  4KN4 X;  2BY0 A;  1ONV A;  4ENK A;  1G3W A;  1B72 B;  2AHQ A;  2M87 A;  5F0F A;  4BAC A;  1E3P A;  2DPD A;  2LR8 A;  3HSR A;  4YRV A;  3TDU C;  1OJL A;  5ILU A;  1IJW C;  4M3B A;  1UZC A;  1F1Z A;  4UVA A;  4IKF A;  3RTR A;  1R23 A;  3HPH A;  1MMG A;  5LHH A;  3BQY A;  1KYW A;  2AQF A;  5E8I A;  1UHW A;  3CLO A;  4HYE A;  3ZQC A;  1DU6 A;  5FLV A;  1SD7 A;  4IOC F;  2K86 A;  4JOM A;  2R7Q A;  4WF2 A;  2MFZ A;  1PUE E;  1LVA A;  2CW8 A;  3S1Q J;  2YX7 A;  4A3I J;  1UB9 A;  3MKW B;  1E17 A;  2HKO A;  2QQA A;  2E5Z A;  2W24 A;  4V2F A;  2RVC A;  3E6B A;  2VBW A;  4HEA 2;  2XC7 A;  3MWM A;  3OSG A;  5ICF A;  4MO7 A;  1D1A A;  1O57 A;  2LYC A;  3NAR A;  1V54 H;  1OCZ H;  2K5C A;  3I4P A;  3K1M A;  3MZH A;  3CUQ A;  4Z2Y A;  1P2F A;  3LSJ A;  3M8E A;  3S1N J;  1J75 A;  1A36 A;  4NQW A;  1XGN A;  5D8L B;  1IGN A;  1TWC J;  5H6R A;  4FIS A;  2XF5 A;  2LKP A;  5CVJ A;  3L2V A;  1SMY F;  4F91 B;  3S14 J;  5CQG A;  2YU9 J;  1AOY A;  1ZQ3 P;  1D5V A;  1Q1V A;  3J81 K;  1U9O A;  2V1X A;  3CUO A;  2F4O B;  4Z6Y A;  5HDK A;  3CC7 I;  3SFZ A;  2RNJ A;  4CCO A;  4FX0 A;  4B8X A;  3BR2 A;  1PUF B;  3DKW A;  1G59 A;  2QSH X;  3FXQ A;  2D2W A;  1XC5 A;  2P81 A;  5L3F A;  1X4O A;  1HLV A;  2B63 J;  1WHU A;  5D6E A;  2V1D A;  4E70 A;  1FC3 A;  4RM3 A;  1VQP I;  1HQC A;  2VBY A;  1X3U A;  4LK1 F;  4A69 C;  2HVS A;  2JJ7 A;  1VQ6 I;  2ZXJ A;  2JUC A;  1HA8 A;  3QOE A;  2TDX A;  3CJN A;  1MNE A;  3ABM H;  4JX6 A;  4CHU A;  3E1S A;  1J59 A;  2QQB A;  4XLC A;  2CFX A;  3LAJ A;  2R7W A;  5M5W J;  2KFD A;  3A03 A;  4BAY A;  2DK5 A;  3RPU A;  2YR2 A;  4HV5 A;  4PZJ A;  3G4S I;  2X1D A;  4IQJ A;  2IW5 A;  3BTC A;  3HG9 A;  1TT5 B;  2DTR A;  1REP C;  1RZ4 A;  2GA1 A;  2WY8 Q;  4KFC A;  1FBU A;  1F5T A;  2MLK A;  4Q5S F;  1RET A;  2IP2 A;  3BTJ A;  4IZZ A;  5CJ9 A;  1MJA A;  2VQG A;  2X6X A;  1UHM A;  5E1X A;  3LA2 A;  3ULQ B;  4YG2 F;  3LWF A;  4L5I A;  4C2M J;  2P0W A;  2XV4 S;  2K02 A;  3I5U A;  4RB2 C;  4RAG A;  4IHY A;  2EIN H;  4MFD A;  2L7F P;  3GZ5 A;  2FNP A;  4HOB A;  3F8B A;  2NNY A;  4BH9 A;  2Q8K A;  4MTE A;  3ZOB A;  1VQ7 I;  3WOD F;  3RSN A;  2LOO A;  5CPR B;  2IS1 A;  2W00 A;  2MH2 A;  4ENJ A;  5FLX K;  1ZYR F;  3QOD A;  1T56 A;  2RGV A;  3CO7 C;  4CYC A;  3F3X A; 
#chains in the Genus database with same CATH homology
 3FIS A;  2COB A;  3RZO J;  2YS9 A;  3K2A A;  2ZB9 A;  3ZQG A;  2WB1 N;  1HOM A;  3RKQ A;  1TWF J;  3CCY A;  4QIW N;  5M5Y J;  2Y31 A;  1ZTR A;  2CQQ A;  3BQZ A;  1ZGW A;  2L9R A;  2LLK A;  3PM1 A;  1B72 A;  3S2D J;  1K61 A;  5K7F A;  5EGO A;  1UMQ A;  2FX0 A;  4RDU A;  3GTG J;  1RES A;  4IHW A;  4D7N A;  5GPA A;  3FK6 A;  1BW6 A;  2ECB A;  1GDT A;  1RR7 A;  5DS9 A;  1JKP C;  2M2E A;  2OPT A;  2EZH A;  2XPW A;  3H0G J;  1Z0X A;  1NK3 P;  1HCR A;  3HBL A;  3TED A;  5M5X J;  3Q0W A;  5IYC J;  1QRY A;  1X2M A;  2L7Z A;  2EQR A;  5J1Y A;  1K83 J;  1IC8 A;  1BA5 A;  5F08 A;  4A3C J;  2JWT A;  1ETK A;  2M8G X;  5FKO A;  1MBE A;  4BY1 J;  3D1N I;  2R0Q C;  1IDZ A;  1QVU A;  1AKH B;  1OCT C;  1JT6 A;  4FE7 A;  1APL C;  3JRE A;  1MSF C;  4MFE A;  1ETO A;  1XS9 A;  1WPK A;  2HDD A;  2CQX A;  1FIA A;  4Y7N J;  1HDP A;  5EG0 A;  3GTO J;  2R5Z A;  5M3M J;  2XPV A;  5FJ8 J;  4MLO A;  1WI3 A;  2EBI A;  1MNM C;  2ME6 A;  2JA5 J;  3A01 A;  3JRH A;  3M3Y J;  1ZKG A;  2LTP A;  4Y52 J;  4M6V A;  5IP9 J;  1MBF A;  2CRG A;  4A3E J;  4JX4 A;  4QSH A;  2HXO A;  2CJJ A;  2FQ4 A;  3O8H A;  2XB0 X;  1ITY A;  4LOC A;  2JA7 J;  1YRN B;  1Y1W J;  4J19 A;  2TCT A;  2HQ5 A;  2VUM J;  3BG5 A;  4A3F J;  2NVT J;  5FKL A;  3A02 A;  3I4M J;  4BBS J;  1SAN A;  4DW6 A;  5F1J A;  2XRL A;  4XRS G;  2FD5 A;  3HEF A;  1Y1V J;  3BR3 A;  3TP0 A;  1LE8 B;  4W1U A;  5C44 J;  5J1U A;  4CYC A;  1NK2 P;  4XK4 A;  2IAI A;  2Y9Y A;  1WCM J;  3WHB A;  4UUS A;  1GV5 A;  4DZJ A;  3TW6 A;  1UHS A;  1JJ8 C;  4A3B J;  5E3M A;  1ORK A;  1FIP A;  4IHV A;  1H8A C;  1UG2 A;  1F43 A;  3GBG A;  1NTC A;  1JGG A;  3S15 J;  4DYC A;  4IHX A;  2DN0 A;  4FCY A;  1ETW A;  1I3Q J;  2W48 A;  5E3N A;  4C3I J;  4GFB A;  1WGX A;  2DMT A;  5C4X J;  2CU7 A;  1E3O C;  3HDD A;  3HOX J;  3M4O J;  3E7L A;  3JRD A;  3CMY A;  2R5Y B;  2L0K A;  1ETV A;  1IUF A;  1GT0 C;  1Z77 A;  2DA2 A;  2DMU A;  1VI0 A;  3RZD J;  1RKT A;  2Y30 A;  4B1R A;  4BY7 J;  3JR9 A;  1JT0 A;  3HOU J;  5IP6 A;  5E3O A;  2GBY A;  1JUP A;  2D5V A;  2KT0 A;  5IP7 J;  3LSR A;  1P7I A;  2IEK A;  5K7Z A;  2WAQ N;  3TP3 A;  5EZG A;  3W6V A;  2EZL A;  3LNQ A;  5K7H A;  2DA6 A;  2KDZ A;  1U9N A;  2QF7 A;  2AO9 A;  3BG9 A;  3IH3 A;  3GTJ J;  1T33 A;  3HOZ J;  5IYB J;  1A5J A;  2VKE A;  4XRS A;  1MH3 A;  3BR0 A;  1VF9 A;  2DA1 A;  4D5F A;  3S17 J;  1H89 C;  3DEW A;  2LVS A;  1FTT A;  1JTY A;  1JKQ C;  1OCP A;  3CQZ J;  3F0C A;  2DA5 A;  2CUE A;  2E19 A;  1JUS A;  1ZR4 A;  2JA6 J;  3C2B A;  4UUS B;  1VND A;  1HF0 A;  3HGY A;  4AC0 A;  1TC3 C;  2H8R A;  1A6I A;  1X2N A;  5BNG A;  4AUX A;  4C3H J;  5E3L A;  1WH7 A;  2DMP A;  4AYB N;  2NVX J;  4EEF G;  3GTL J;  3QPL A;  1TWH J;  5C3E J;  3BT9 A;  2TRT A;  1P7J A;  3JRG A;  1BL0 A;  2X9D A;  2QCO A;  5C4J J;  2R7Z J;  3FK7 A;  3HB9 A;  9ANT A;  3BR5 A;  3RQI A;  3MVP A;  5IOY A;  4JX5 A;  2IBD A;  3JRF A;  2GM4 A;  1POG A;  5F27 A;  1W0T A;  3LOC A;  3WHC A;  5IYD J;  4M3G A;  1ETQ A;  4G12 A;  3BR1 A;  2XGD A;  1YRN A;  2ID3 A;  2R5Z B;  1QVT A;  1QPI A;  4MIM A;  2XPU A;  3BTL A;  3G1O A;  4UUT A;  1RPW A;  2HXI A;  2L7M P;  5FLM J;  3B6A A;  2HOT A;  2CUF A;  1U8B A;  2XSD C;  2NS8 A;  5M3F J;  2I10 A;  1JUM A;  3A01 B;  3LSG A;  4I6Z A;  1AHD P;  2LP0 A;  1MBH A;  2ME0 A;  3S1M J;  4D7M A;  3GTK J;  5F0H A;  3S16 J;  5EG0 B;  4A3M J;  2JA8 J;  5JLW A;  2LY9 A;  3LSP A;  1G2H A;  2K9Q A;  3SJM A;  2EZI A;  1LFB A;  3JRI A;  5IOZ A;  5GP9 A;  1VFC A;  1AKH A;  4FE4 A;  4A3L J;  3DCF A;  4S0H B;  2VI6 A;  5EF6 A;  2DJN A;  3GTM J;  1AU7 A;  2DA7 A;  2HOA A;  1FEX A;  2K9S A;  4M3E A;  1ETX A;  1IDY A;  2H1K A;  2DA3 A;  3QPS A;  5HOD A;  4QTR A;  3K7A J;  5GPC A;  1RKW A;  3GTP J;  5EYR A;  2E1O A;  1ZR2 A;  3JRB A;  3UKG A;  2XB5 A;  3L1P A;  3O8G A;  1GV2 A;  2Y0S N;  2K9N A;  4JP0 A;  4W97 A;  4L5E A;  1IRZ A;  2O7O A;  4B3A A;  2E2I J;  1WH5 A;  1FJL A;  3H3V K;  5JLX A;  3ZQF A;  1HDD C;  2ECC A;  3Q3S A;  1ZK8 A;  2WV1 A;  4M3F A;  4M3D A;  4XRM A;  3NAU A;  4CYC B;  5EGO B;  1W0U A;  2ID6 A;  3IH4 A;  2LK2 A;  2NS7 A;  3MKL A;  4RBO A;  1LFU P;  5EDN A;  2E2H J;  3GTQ J;  2HI3 A;  5FKM A;  1BW5 A;  2VPR A;  4XID A;  3JRC A;  2DMN A;  3VPR A;  1B72 B;  2JN6 A;  2AHQ A;  5F0F A;  2MGQ A;  2LR8 A;  2ELK A;  4I76 A;  1OJL A;  2JMW A;  3PO2 J;  3S1R J;  1O4X A;  1IJW C;  1DU0 A;  1GVD A;  4M3B A;  2M34 A;  2NOG A;  2MW8 A;  4DZP A;  1TWG J;  2LFB A;  3HGG A;  5J3L A;  4A3D J;  5FKN A;  5IPA A;  3BQY A;  2GLO A;  5F0C A;  3ZQC A;  1DU6 A;  1XG1 A;  2OF7 A;  5FLV A;  2LKX A;  1MBG A;  1B8I B;  4BKX A;  3CDL A;  3SFI A;  2EH3 A;  3OIO A;  1JKR C;  3S1Q J;  4D5C A;  4A3I J;  2O9L A;  1JKO C;  3S2H J;  4C3J J;  3HOY J;  1BJZ A;  4V2F A;  2YUS A;  4BXX J;  1MBJ A;  1X58 A;  1D5Y A;  3HM5 A;  5F04 A;  3OSG A;  5EZH A;  4MO7 A;  2G0E A;  2X48 A;  3NAR A;  1H88 C;  1FTZ A;  1IV6 A;  2X6O A;  4IEJ A;  3LSJ A;  2DA4 A;  3IH2 A;  3S1N J;  1MBK A;  2K40 A;  4JYK A;  4NDL A;  2M9H A;  1PUF A;  1IGN A;  1TWC J;  2XGC A;  1MSE C;  4FIS A;  3FIW A;  2Y2Z A;  3BTI A;  2PMZ N;  2RAE A;  3S14 J;  2YU9 J;  5EEA A;  1ZQ3 P;  1Q1V A;  3BR6 A;  1SFO J;  1U9O A;  3I4N J;  2LD5 A;  3SDG A;  1ETY A;  2HYJ A;  5FKK A;  4X6A J;  1U78 A;  2DTZ A;  2O8K A;  3BR2 A;  2XGE A;  1PUF B;  4B4C A;  2NVY J;  1XC5 A;  4FTH A;  1S7E A;  2P81 A;  5J1R A;  1I50 J;  1HLV A;  2B63 J;  4A3J J;  2R5Y A;  2MSY A;  3JRA A;  4A69 C;  2JJ7 A;  2EZK A;  3PO3 J;  1OFC X;  2M0C A;  3Q0V A;  4JX6 A;  4A3G J;  3BG3 A;  3HOV J;  1JJ6 C;  5M5W J;  3A03 A;  4HNV A;  2E2J J;  3ZQI A;  3HOW J;  1CQT A;  3BTC A;  2HOS A;  3TW7 A;  2DMQ A;  4A3K J;  3Q0U A;  2NVQ J;  4ABZ A;  3G1M A;  2JK3 A;  4X1E A;  2MG4 A;  2Y9Z A;  2R92 J;  1RET A;  3MN2 A;  3BTJ A;  3FKI J;  4DYQ A;  1MH4 A;  1F36 A;  1IG7 A;  1GUU A;  3QQA A;  4C2M J;  4XIC A;  4A93 J;  3IV5 A;  1ENH A;  1I6H J;  1TWA J;  1LE8 A;  4V2G A;  3OSF A;  4DYR A;  1B8I A;  4IHY A;  4MFD A;  2L7F P;  3OOU A;  3B6C A;  2FJ1 A;  5DTD A;  2VKV A;  2R93 J;  4BBR J;  1JTX A;  3ZOB A;  1R9T J;  1EF4 A;  3G1L A;  3ZQH A;  3ZQL A;  1T56 A;  2N8G A;  3HKZ N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...