4FIZA

Crystal structure of the binary complex between a fungal 17beta-hydroxysteroid dehydrogenase (apo form) and coumestrol
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
260
structure length
260
Chain Sequence
YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17beta-hydroxysteroid dehydrogenase
publication title Crystallographic studies on the flavonoid inhibition of a fungal 17beta-hydroxysteroid dehydrogenase
rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 109
structure length 260
sequence length 260
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fizA00
1XR3A 3ADPA 1WDKA 2DC1A 4PZEA 4WOKA 2VZ8A 3TZCA 3U3XA 1MFPA 2JJYA 3HZZA 1U1IA 4GKBA 5CP8A 3GG9A 3WTBA 3OA0A 1MV8A 3A06A 4EYEA 1JKIA 2GSDA 3IUPA 2HU2A 4E2XA 1D1SA 5KOIA 3JQ6A 3UFXA 3N58A 3W6UA 3M1LA 3PIDA 2HK7A 4QFCA 5JAMA 1UZMA 1DHTA 2EERA 3WX0A 4WEOA 4E12A 1R6DA 1XSEA 5I9NA 2ZYAA 1L7DA 2GDZA 3AY7A 4XR4A 2Y0CA 3ANNA 4WJZA 2VHWA 3BYZA 3GUYA 3VZQA 4BO6A 5DBFA 5I8ZA 3LSYA 5BSGA 1HE2A 2BLLA 4IQ8A 3G1UA 2P91A 2HK9A 2NM0A 4M86A 3I9JA 1DIBA 4QQRA 2AW5A 4CM5A 4IM7A 3IQDB 3H3FA 3KYCA 4AL4A 5B1YA 1NR1A 3U4CA 1MLDA 3VTZA 2BFAA 2JD2A 3I5MA 1YBMA 3JQ8B 2DT5A 1LQTA 1HYHA 4CUJA 3BTSA 3E9NA 3F46A 3NTOA 3PWSA 2UYYA 4YBZA 3WMWA 4B4UA 2PGLA 3ZN2A 4WK6A 4B4OA 4MO2A 2J8ZA 3JCZA 1JU9A 3F6YA 2W90A 3EZLA 5MDHA 1XYGA 1QYXA 2FR8A 5A1TA 4IS3A 4UUPA 4RVSA 2CDCA 2X5JO 1JTVA 5JY6A 1UJMA 4M89A 4M55A 4RQTA 1F12A 3JV7A 4A27A 4Q3CA 4II3A 3ONEA 5CAEA 2CVQA 3WXBA 2CZCA 3UW3A 1J6UA 2WTBA 3OH8A 1RM3A 4GMFA 1ZUD1 4BNYA 4A2CA 2A92A 3QWAA 4YA6A 4AJ1A 2DM6A 5I7SA 1NPTO 3MJVA 2PD6A 1JLLA 2D8AA 1N9GB 4ZD6A 2P2SA 3GRPA 1N8KA 4IQGA 3WSVA 2NTVA 4NG5A 4IMRA 3Q6IA 4BMSA 2EP7A 4DWVA 1RM0A 3PIIA 4O63O 4ALIA 1U9JA 4J1TA 5T5QA 4AFNA 1A71A 3L9WA 4IJUA 4CMKA 2DAPA 3PHJA 4JLWA 4PZDA 4XQCA 3AM3A 2TMDA 4YQZA 2GF2A 4M87A 1GL3A 4AG3A 2BH9A 1ENYA 3KYCB 1YKFA 3FCOA 4J2OA 3HFGA 3AW9A 4AICA 3PVZA 1B26A 4CLHA 3AI2A 1MG0A 1XIVA 2JCXA 3OQBA 4R9RA 2A4KA 4MIEA 4DIBA 3GFBA 4GH5A 1LC0A 3BHJA 1BG6A 1RM5A 2DBVO 4RF2A 4QTZA 1H6BA 4CLEA 3ZHYA 4PCVA 3OJOA 1PR9A 4B79A 2EV9A 3NT4A 1C1XA 2JFHA 4YQYA 1B8VA 2PKQP 2Q2VA 1A7AA 3G3EA 3WYBA 2PZMA 5H82A 2XPCA 4GSKA 4DPLA 4D3SA 2O4CA 4R5HA 2VHZA 1E5QA 2ZATA 3C24A 3F5SA 4JP3A 4AJIA 1LSJA 4BGVA 2PZKA 4GGOA 2O3JA 1LJ8A 2OFPA 1WLYA 3BHIA 3ST7A 1PS9A 1DC5A 3E18A 4XR9A 4PLWA 5KWEA 2LDBA 2Z1MA 5BNIA 2WWRA 1NQAO 4UREA 4GQAA 3QWFA 4E30A 4Q9NA 1BVRA 1D3AA 2GPTA 5BSHA 1M6HA 1ISFA 4J16A 1T2CA 2X23A 3TL3A 4BGUA 1NQTA 1TT7A 1XQ1A 3EVNA 3C1TA 5G0VA 1YVEI 7ADHA 1KEUA 4OOEA 4XX0A 1PGOA 2FSVA 4FSHA 4PLPA 3TZ6A 3DZJA 4GVLA 4HP8A 4CLDA 2X0RA 3HB4X 3FTPA 4FOOA 3WNVA 1M67A 1PGJA 1LUAA 4WLFA 2ZJ1A 3DMYA 5F5NA 1BWSA 1Q1NA 3NGLA 2YV1A 1EE2A 4J1SA 1SPXA 3DDNA 1WWKA 3JD1A 4ZU3A 1Y5RA 4PN3A 4FB5A 4BMVA 4NIMA 3RCBA 3FWNA 5F1OA 4PRKA 1C1XB 1IPEA 3C3XA 4H7PA 2OO5A 4NDNE 4NR0A 1YB1A 1EZ4A 1LLQA 3TZKA 3GHHA 4FFPA 4JQCA 2NU8A 1UDCA 4K6CA 2ZCUA 1DFGA 1I3KA 4J4TA 5HTOA 1LQUA 5U1PA 1R4NB 1E3EA 4R1UA 2OGUA 1NYTA 3KVOA 3TL2A 3ZU3A 2GRAA 3PZRA 1C3VA 1OMOA 2VYVD 2WDZA 4S1VA 4A7PA 4Y6SA 4WLUA 3K5PA 1IUKA 1ADGA 3GDFA 1AN9A 3TRIA 4EJMA 2RIRA 4CMAA 5DBGA 4D7AA 2XXJA 4EDFA 3AUUA 3JYNA 2V6BA 1EUCA 2ZCVA 1HE3A 3NEPX 5AQ1A 4I5DA 2AMFA 4IDBA 2CVZA 2O3UA 4FD3A 4W7IA 4AJHA 5C7LO 1E0DA 5DDIP 4DLLA 3PLNA 1ZKMA 4DA9A 1PS0A 3GDGA 5A3VA 3ITKA 1UXJA 3DQPA 4IZIA 5TGDA 5JW6A 3LQFA 7MDHA 5EIOA 5CDGA 1DRWA 4JP2A 4D44A 1BXGA 3FSRA 4AVYA 4FGWA 3GT0A 3L0DA 1P1RA 4MVJP 3NDRA 3UCEA 3WGTA 5C37A 3TOZA 2NVWA 4C7KA 3K96A 4CR6A 4BNHA 4DGSA 1TB4A 2ZB4A 2G76A 4NI5A 2ZKLA 4IS2A 1GYPA 1I30A 3IL2A 4BNUA 1ONPA 2Z5LA 3DZGA 3E9QA 4BNGA 4XQ9A 3CZRA 4CUZA 4W9NA 3D1LA 2EJWA 1R37A 2CDAA 3D3EA 4PLVA 5JYEA 3T7EA 1IYZA 5C7OO 1HDOA 2V6GA 3ZH2A 3SLGA 1OBFO 3QVOA 4CMHA 3FWZA 4I9HA 1Z45A 3QVTA 4TZKA 4NK4A 4UVHA 4JGBA 3WSWA 1A4UA 2YFQA 3AOGA 5JAIA 3ZGYA 1DC4A 1AXGA 4TRJA 1NHGA 1MC4A 4XGIA 1G0OA 2J3IA 5HS6A 1EK5A 1X0VA 2HRZA 5CHEA 4XZ3A 4G81A 2D3TA 3JQEA 5TX7A 3D4PA 3S1LA 5L7WA 1J0XO 2NADA 4WLOA 3E1KA 1KBZA 1EVIA 2FRDA 2C5AA 1CDOA 3ANMA 3GA0A 3RBXA 3W8FA 3VZSA 1V3TA 3MWEB 4XIYA 2H9IA 4NBTA 1MFZA 5I7VA 2DTDA 3B1KA 4GLOA 5H83A 5ILOA 3BZUA 3CTMA 1BXGB 4Y67A 3CKYA 5IN4A 3PYXA 1OI7A 5G0WA 1N5DA 3CIFA 1DLIA 3QJ5A 4DREA 4M1QA 3SC6A 4OL9A 5EL0A 4CLRA 2BD0A 3H9EO 4BKPA 3D3WA 4FIZA 4JCOA 1PJBA 3I1JA 4CM1A 2O7SA 5JC1A 1UH5A 3DONA 5AXBA 4NBUA 1GV1A 5IDWA 1E7SA 3U62A 2GERA 2BMAA 3GNTA 3S8MA 4BGEA 1E6EA 2E6UX 4PG6A 1HZZA 3DAGA 3RFXA 4QFDA 4RVHA 1YQXA 2QIOA 3D0OA 2B5WA 4JJGA 2C0CA 3OEWA 4BO4A 4MP8A 3UN1A 3PGXA 1HE5A 4IJWA 2B4QA 4BO0A 3ZWMA 3P5SA 3JQDA 4C4OA 1HDCA 1I2ZA 1GADO 1KEVA 1HSOA 1RPNA 3GVIA 1E7RA 4QO7A 3AU8A 4XD2A 1ZZEA 1B3RA 1DHRA 3F1KA 3UKOA 4Q3AA 3ZV4A 3P2YA 1G0NA 3OA2A 1MP0A 1GUZA 4INAA 1XU9A 1H9AA 1I36A 1JWAB 2Y0EA 3K2BA 4RPLA 1UUFA 1RWBA 3NT5A 1QORA 3K9QO 1XLTA 3HDYA 3HN2A 1M76A 3VC7A 5JBIA 1Q7BA 4XA8A 3W8DA 1YWGO 3ZHBA 4PG7A 3ULKA 4MJLA 1ZMTA 4LMRA 4S3MA 2GR9A 4BO9A 2O3SA 4PRLA 4KTVE 3PDUA 3ZWWA 2JAPA 4NBWA 5DULA 4YTEA 4YCAA 3GY0A 4XJTA 5KVSA 1PJ4A 1E3WA 3GLQA 4FJ0A 2VYND 4OJNA 1LU9A 4FGSA 3ZCXA 3D3WB 3NAQA 3QHAA 1EMDA 4ONEA 1DBVO 1U2GA 4IZHA 1SMKA 5I7EA 3HJAA 2Y1OA 1P9LA 3NDIA 1EQUA 1PQUA 4LVCA 4BKUA 3AJRA 2J3JA 1P1JA 1O6ZA 5AXDA 1HTBA 2X5OA 3GZNA 5EQDA 1VJTA 3C85A 2ZQYA 3DEYX 3QVXA 4AJPA 2E49A 3AI3A 4OKNA 1DOHA 2CVOA 4BO2A 3HUDA 2R2GA 1K6IA 3ENNA 3O9ZA 1A5ZA 4BNKA 4UUNA 4AJLA 4CJXA 1NM5A 4ZQHA 4DLAA 8LDHA 3RVDA 3DZBA 2HJSA 2AEFA 2Y1DA 3BMCA 1AHIA 1CRWG 2X22A 1LLDA 3QRWA 4MVJM 1IL0A 1HYGA 4I1IA 3WGIA 1O94A 2C7VA 5T64A 3H9UA 1P45A 2D5CA 4TKMA 2WYUA 1HYEA 3EYWA 4ILKA 1JKFA 3GUCA 5EPOA 1KIFA 4QXMA 1E7QA 3IKVA 3WNQA 3SJUA 3I9OA 3JYLA 5BSFA 5L4SA 1E77A 2G1UA 2VRBA 4QX6A 1TT5A 1E1LA 1I32A 5A05A 3TNLA 3ZWCA 1KC1A 3LU1A 1IY8A 3BTUA 1JVBA 3DZKA 1PGPA 2BFMA 2E48A 4LCJA 4TQGA 2YHIB 4IDAA 3U0BA 1MA0A 3RSHA 1B0AA 1M6WA 1E3WB 5FFFA 4YT8A 1B3BA 1I2CA 3AUAA 3PRJA 5L7TA 1HDRA 1NFRA 2IYOA 3KB6A 3G0OA 1B8PA 2NACA 4AJOA 4BGIA 1XGKA 3L9XA 3H5RA 3MJ4A 3WIDA 4DRYA 4OXYA 3KBOA 1ZK3A 2NSDA 3RQSA 1C0PA 1P33A 4ZN6A 4ND1A 4NH4A 4RPJA 2VRCA 3JQGA 4I5GA 4NJMB 1ZW1A 2BFPA 5JE8A 2O48X 2Q3EA 1I8TA 4GVXA 2DUUA 5JO0A 5TNXA 3RUFA 3ZWNA 1UXHA 2CFCA 1E5LA 3BMCB 3ONDA 1GPJA 4XYGA 1KC3A 5HWSA 1QRRA 2D4AA 2X9VA 1H2HA 4J7UA 1EFKA 3T4EA 4QSMA 3IDSA 2IZ1A 3OJLA 3RUHA 1B16A 1SEPA 1VE9A 3WR5A 2OBYA 4JK3A 4E31A 1UDAA 4PLZA 2YY7A 1NHWA 2IYPA 4NU5A 4ALNA 4A73A 3GHYA 4BNVA 1QKIA 2AG8A 2BRUA 1ISMA 3GGGA 4E5MA 1T2EA 3IMFA 1TT5B 4YB8A 1U3UA 4GGPA 2P9CA 4E2WA 3VVCA 2ZTUA 3RUEA 4WASA 4CM4A 3MOIA 3S55A 4R68A 3MCVA 3ONFA 4B8ZA 5A03A 2GZ3A 4FR5A 1GUFA 1LSSA 4P38A 4K28A 3QP9A 3AI1A 4WLVA 4Z0TA 2NU9A 3C1OA 3OJFA 3H7AA 2YV3A 1F8FA 4BV9A 1QSGA 1LDNA 1U4OA 1LC3A 2HMTA 2YQ5A 2V7PA 3L77A 4CM9A 4YPOA 1CF2O 4BB5A 4GL4A 5ITVA 3MJTA 4D3DA 3ZNNA 3JQGB 3AM4A 3QY9A 4KOAA 5L7YA 2C29D 1NQ5A 1P0CA 1SB9A 2FOIA 1LI4A 1ZSNA 1U28A 3LK7A 1YDEA 2D0IA 1NWCA 2DQ4A 5JO9A 5KIAA 4J91A 2PTGA 4AJKA 1NFFA 2UV8A 2IXBA 4MINA 1PS8A 5F21A 4BQRA 4J6FA 5FWNA 1LDEA 3A14A 2VUUA 3H8VA 4ESOA 4EJ0A 2XOXA 2W8ZA 3EAGA 5LDGA 5I7FA 2VWHA 3QW2A 1O89A 1OC2A 2QYTA 5DN9A 3FI9A 3EZYA 4R1SA 4PG4A 1ZJYA 3PHLA 2B83A 3ZNQA 1KYQA 4U5QA 3RC1A 3I52A 2PD4A 4I8XA 3DHNA 3UF0A 4N7RA 4MKXA 3H2ZA 1IHXA 4YEDA 3R1IA 4YJGA 5DCYA 2GD1O 3FTNA 1DDOA 1GD1O 1I10A 1WVGA 5JAQA 1E1MA 2QW8A 4IDCA 4XWYA 2BF7A 4RGBA 1XU7A 2DTXA 4ND4A 3L6OO 3AM5A 4BKQA 1T1SA 3QE3A 1BVUA 4NFSA 2Q1TA 2XXBA 5JMWA 4OSOA 4EITA 1IPFA 1A27A 3JQAA 5AXCA 4A10A 4E21A 5A06A 4R51A 1AGNA 3F9IA 3IJRA 2DKNA 3R3JA 4CM3A 1ENZA 5I9LA 1PZFA 4JXKA 4CUKA 1S7CA 2HMWA 1X0XA 4WKGA 4JBIA 2WD7B 1YGYA 3TN7A 3GK3A 3EMKA 2O50A 2X8LA 2G0TA 3P7MA 2O2SA 2GZ2A 1F17A 4ZQEA 2Z95A 3PFFA 1K6JA 4OIMA 4HNHA 4L8VA 4NPCA 4PLGA 4RF4A 4PVCA 4CL8A 4RL6A 5JDIA 4RV9A 1E3JA 3COSA 2RHRA 4RZIA 1YL5A 1QV6A 5EMHA 1Q2XA 3GN1A 3INTA 3MJEA 4FFRA 1QLHA 1V9LA 3RFVA 4G65A 2GN9A 4YAGA 1KVRA 3E5MA 3EDMA 4J43A 2AQ8A 3LC2O 4G2NA 4JBHA 1ZCJA 4J4BA 3N74A 1JW9B 5DF1A 5IFLA 1HZJA 1OFGA 4FC7A 2BI8A 1ZFNA 2GN4A 3U4DA 4L4SA 4M54A 4DC1A 4YAIA 4LRTB 3WDSA 3W4JA 3AOEA 4IDEA 4YJGB 1U3WA 3KEQA 3Q2KA 1EVJA 1H6CA 1BGVA 2RHCA 1CIVA 4BB6A 2Z1NA 1FDUA 3BIOA 4AJJA 3PDJA 1YOVA 4U8GA 3AY6A 3E82A 4MVJI 5DOVA 3FN4A 1W0CA 1JDJA 4MVJF 3WTCA 1KEWA 3JQAB 4Z9YA 4GWGA 4E4YA 4F6LA 4RJTA 3DC2A 1O9BA 4PG8A 3GEMA 5IG2A 5MGBA 4GX5A 3VH4A 3GZ4A 3E03A 3H6KA 3DO5A 4Z0HO 3JQ7A 1U3VA 2TMGA 3OP4A 3IJPA 1UP6A 1C1DA 3WBFA 1N7GA 2X0IA 3AU9A 4YAJA 1HETA 2PWZA 5B37A 4ALLA 2DBZA 2R00C 1UZNA 2W2KA 2JHFA 2R00A 4Y8VA 4DL9A 1SZJG 5JCJD 1TEHA 1BSVA 4GX1A 1ZBQA 3PK0A 3FNHA 5JDCC 3RUDA 4ZQGA 1N1EA 5TS3A 4H16A 5JDCA 1VSUA 1XWFA 4W6ZA 1UZLA 2FHSA 3R0IA 3TFQA 2ZJ0A 3RIHA 4DBVO 3WGOA 3FF4A 1DAPA 1QYVA 4MIYA 4F46A 4P4NA 3D64A 3ZHXA 1DLJA 4OKIA 4KUEA 4N18A 2OP0A 5CG1A 1Z7EA 3KXDA 3RD5A 3I3OA 4TVBA 3ZZNA 1G6KA 1YOVB 4A26A 1HE4A 2YJZA 1NWHA 2EF1A 3ZV6A 3QVWA 2NQTA 2I99A 2E82A 2JAHA 4D79A 1J5PA 3DOCA 1LDYA 2WE7A 4MP6A 2NQ8A 2CUKA 4Q3DA 2EJVA 1U8XX 1LEHA 4BNWA 5CFZA 1LSOA 3JQFA 1UDBA 4TRNA 3A28A 5ITWA 2X9NA 1HDXA 3JQ7B 3FPCA 4L9RA 4XGKA 4MKRA 2I9PA 3EC7A 3JQ9C 2Y1CA 1C1DB 4BO5A 1WNTA 4B3HA 2WJPA 1DXYA 1X15A 3JQ9A 1AUPA 2IODA 4IDFA 4PIVA 1DC6A 3LVFO 3BMNA 4KDEA 5IZ4A 3DTYA 1X7DA 1QR6A 3BMOA 4WE3A 1I3LA 2W2KB 2YV2A 1W8DA 3DR3A 2YYYA 4E13A 5L3ZA 1QYWA 1K6XA 1ZK2A 2BGMA 3PHHA 5CEEA 1JAYA 1GY8A 1B14A 3ROMA 4F3YA 1YH3A 1VLLA 2ZTLA 3GNQA 4YRDA 4XIJA 2JFFA 2BGLA 1XDWA 3ETGA 4ID9A 2GN8A 3GF4A 1H0KA 1NPDA 2FZWA 2NU7A 1X7GA 1Y8RA 3OQ6A 1YRLA 3NJ8A 3H2SA 4ZRMA 3H3JA 2EG9A 1NASA 9LDTA 3PJFA 4DYVA 2Q49A 2ZTVA 3RU7A 1ISJA 1WAMA 4I5FA 1SC6A 4BO8A 2O4UX 1DIAA 3CMMA 3ON5A 4MVJH 3R3SA 1T4BA 5KJ6A 2WM3A 1E1KA 1Y8QA 4KUGA 1D4FA 4BNNA 5HM8A 5L9AA 2ZK7A 3Q9UA 3D7LA 4RLHA 2CF6A 3LC1O 4J9VA 2FWMX 4QECA 1Z7BA 4J7XA 4BNFA 5EJ2A 3WWYA 4YJDA 1N2SA 1QYDA 1HLPA 2J3KA 4ITUA 4YJFA 3DOJA 4ZHSA 4D0RA 5KKAA 4E5PA 2FPGA 1X7HA 5DCWA 1D1TA 4MDHA 2AE2A 3HG7A 3U4IA 3BMNB 3PP8A 5L51A 3B6ZA 3NX4A 4EW6A 4RVGA 4HXYA 4YAKA 3BMOB 3LT0A 3LT1A 1SCUA 1GYRA 2B4RO 3QWHA 1HL3A 5L53A 4YWJA 4N54A 2QX7A 4ALMA 5A4DA 3U09A 1OC4A 3I9LA 4RPHA 4LGVA 4CODB 3O8QA 2HJRA 4BNLA 1C14A 3HQ4O 4B7UA 2NTJA 5KJCA 3V8BA 3F4LA 1MG5A 3FR8A 3GVHA 4NJOA 1YL7A 3INGA 4XQGA 2PGJA 2OBNA 2CDBA 2OUIA 1CETA 1M2WA 3FHLA 3IS3A 1RKXA 1MC5A 2Y1EA 1GEEA 1YE3A 4XB2A 3MOGA 3BAZA 4RORA 3RI3A 4W9NC 5JYDA 3F5QA 1XELA 3H4VA 3PGJA 4UUOA 4ND3A 2RH8A 4W82A 1I3MA 1FDWA 3HHPA 2HQ1A 4RPKA 1Y81A 1DIGA 1Y8QB 3M2TA 3R6DA 4M8SA 4MVJA 1BRMA 4DLBA 3OF2A 4G5HA 4D46A 1Q0QA 2C54A 3GVCA 3L07A 5G0SA 1V0JA 1ZH8A 5IDQA 3JQCA 2VUTA 4BO1A 3EUWA 4J49A 3WLFA 1DO8A 4YJFB 3V5NA 4ZJUA 3NTQA 5B4TA 3E8XA 4ALJA 5L45A 3NT2A 1YB5A 2BI7A 2QRJA 4IDGA 1NQOA 3F1LA 5K6AC 2VQ3A 2J5RA 5KJFA 3GGPA 4YT4A 3WGQA 5K6AA 1YJQA 1ZXBA 2WYVA 4OAQA 2VYVA 1BHSA 3WLEA 2EGGA 1ZSYA 1LTHR 3FPLA 4CMIA 3PYLA 5COQA 5KCZA 4BL5A 1R4MA 2DLDA 4BS9A 3RC9A 1ML3A 3O8QB 4F6CA 4R01A 1KVTA 3JD0A 5A04A 3GRKA 4J0FA 3OJEA 1VPDA 2R6JA 4YXFA 4Z9XA 4DVJA 2EKPA 5DZSA 3LLVA 4XRRA 5T57A 1MUUA 1BXZA 2VCYA 4OXNA 1DFIA 1ZMOA 4CM7A 1YQDA 3DAFA 2W2LA 1WMBA 5GY7A 4AJNA 1GZ6A 3JSAA 1TI7A 2IE0A 1K2WA 3UCXA 4CV1A 4HKTA 4R3WA 3GR6A 1HLDA 1W4ZA 3PTZA 3NTRA 5B4VA 1ZEMA 2IZ0A 2PY6A 2J5QA 4L73A 1JA9A 3PJDA 3DBHA 4GSLA 4Z0PA 2EW8A 3L4BA 1PGQA 3E5RA 4E32A 2G5CA 5AXAA 1ADCA 3U9LA 5JSFA 3C8MA 1EDZA 2AQKA 3WIEA 1BMDA 4HY3A 4U7WA 3V2UA 1ENPA 1IB6A 1NAHA 1HF3A 3OIDA 3SBOA 1GEGA 3NYWA 3OQ1A 1U8FO 4OMUA 1X14A 1SBYA 4CV0A 3CSDA 3GAZA 1YDWA 1CWUA 4BUCA 2F1KA 5COBA 2OP1A 4ZICA 3GC6A 3H9GA 5DCUA 5CDSA 2OMEA 3DWFA 5T8KC 1XCBA 4YDRA 3VH3A 3WB9A 5T8KA 5DP1A 4CMIB 1VJ1A 1W6UA 1FDVA 1R4MB 1VRWA 4RQUA 4RVDA 3WG9A 4D43A 5ILGA 3TPCA 3GN2A 1VJ0A 1JVSA 1PZEA 2J3HA 1LX6A 1C0KA 3CPSA 1Z6ZA 3WGYA 2W98A 3ASVA 4KQWA 5DOZA 5ENDA 1QLJA 2PH5A 3HWRA 4DQVA 2YHUA 4ALKA 2NU6A 4D0SA 3DOOA 5T67A 1EBFA 4HUJA 3ICCA 4Z9FA 1E6UA 3MJCA 3ZV3A 2B35A 3KEOA 2IXAA 1Y5MA 2HCTA 4OM8A 4CLRB 5JNLA 4U0JA 3Q0EA 3HDQA 1Y9EA 2C7GA 1PZHA 4H3VA 3DXFA 3BTVA 3GVPA 4LVUA 4YJHA 5JPIA 2HAEA 4MIOA 3ICPA 2EIHA 4JX8A 4RF3A 5LCXA 1HEUA 1V6AA 3O26A 3ZWBA 2GGSA 1ZEJA 4ZQFA 3DBHB 1V3VA 3PLRA 1ISGA 1NBOA 2P4HX 3U4HA 1PJCA 3WFJA 1O8CA 4WNCA 4DPKA 1RYDA 2FPIA 4R5MA 3KSUA 3NJ4A 1MX3A 3UOGA 3ANLA 1A7KA 2AG5A 2YUTA 3OMLA 2Y93A 4FCCA 4IINA 4IUYA 4BKOA 4BOYA 3GPIA 4ND2A 2HK8A 3GFGA 4BNZA 2WEKA 4FDAA 3WQRA 3KYBA 5EINA 1VKOA 5TC4A 1YBAA 4FBGA 4OXKA 1WDMA 3I9KA 3IIEA 2UDPA 1H6DA 1ZK1A 1ZVMA 4UAGA 2O3TA 3UGKA 2ILTA 3ZU4A 3ZWYA 2SCUA 4FQ8A 1PSDA 1DJQA 3MTJA 3UXYA 1GUYA 2B5VA 4P22A 3VDQA 3ZU2A 3RASA 1A4IA 1P3DA 3AFNA 4JJIA 1UXGA 3NKLA 3X2EA 4BNMA 3H65A 3HADA 1XG5A 1LRKA 1EFLA 2I67A 3WOHA 3KYDA 4FOSA 4CQLA 1BW9A 4RDIA 1NVTA 3EY4A 4KQXA 2C2XA 3U49A 1FXSA 1PJLA 1C0LA 2DUWA 3FBTA 1DFHA 1NPYA 4I5EA 1H6AA 2X58A 3RFTA 4GX2A 5TSDA 2X5KO 3RAJA 3S2GA 3UHAA 4YJHB 5HA5A 4IJVA 1VL0A 3F47A 1YXMA 3TDKA 3CMCO 2I3AA 2O23A 3DAPA 4DIFA 2NUAA 2DVMA 3GDOA 3EW7A 1GZ3A 1CEQA 1X1EA 3GZNB 4UVDA 4UVEA 2Q4BA 4BNJA 2IEDA 4CMCA 2CNBA 2OL4A 2VWGA 4CR7A 4OSPA 3UVEA 4CV3A 3ZI0A 4CM9D 4KWIA 1ADBA 3BMQA 4UULA 4IIUA 4XQEA 2XAAA 3HDHA 3RJ9A 1QP8A 1E6WA 4K1LA 1TA4A 4R41A 2WYWA 4JN6B 4EUFA 3ZU5A 1MXHA 2I76A 3ETDA 5KJEA 3LF2A 1ADFA 2DU8A 3WQSB 1BTOA 5TJ9A 1DC3A 4TZTA 3Q11A 5GZ6A 2ZYDA 4Y6PA 3KETA 1FJHA 1F8GA 2EXXA 3JYQA 3UICA 5THQA 3JYOA 1PU2A 1UP7A 4O59O 5COAA 3H9JA 3DMTC 3JQBA 3KYDB 4CQLB 1BW9B 1IZ9A 1ISHA 3DMTA 3ORFA 2RH4A 4NK5A 4OQYA 3DL2A 4WNIA 5HBRA 3RKRA 3KTDA 1T26A 3PQEA 3NRCA 4P4LA 5ER6A 3V1TC 3HB5X 3LLSA 2FP4A 1GQ2A 2C07A 5KKCA 4O5OA 4K6FA 3TZQA 2OORA 4ND5A 5CEJA 1Y1PA 4EZBA 1PEDA 2JKVA 2X0NA 3JQAD 4CR8A 5JC8A 1NTOA 5JY1A 2A35A 4XJSA 3SVTA 1KEPA 3PHIA 5EESA 2EWMA 1DIRA 4J1NA 3GMDA 2DBQA 4L75A 1H9BA 2JCVA 1EVYA 3V1UA 1R12A 4MVJE 1NFQA 3BMQB 3F4BA 5GZ1A 3OECA 3L6EA 3VDRA 3VPFA 5L4LA 5ICMA 2AEMA 4WCFA 2UVDA 3OBBA 1MXFA 1ZXLA 1EEHA 4HV4A 2NNLD 2HUNA 2X9GA 3PQDA 3EK2A 1CYDA 2VHXA 3KLPX 3D4OA 1DSSG 5DNAA 1GDHA 3VH1A 2YDYA 2IDZA 4O0LA 1PQWA 2Q1UA 4X54A 4OOFA 4LSMA 4OO3A 1T2DA 4WECA 1I24A 2VT3A 5A02A 2VTDA 3K92A 2EGHA 1DAOA 3I6QA 1PR3A 1FDTA 2QZ9A 2NV6A 3FBGA 3I6IA 4FFLA 5C3MA 2I6TA 4Z3DA 1YL6A 3KM0A 1K5HA 4BO3A 4U6SA 3OEYA 2VNAA 2X4GA 2RAFA 1TXGA 3D5TA 1O95A 5BNTA 1UXIA 3NUGA 2DPGA 4JJFA 2GCGA 2GZ1A 1YO6A 2HO5A 3PPIA 3DFZA 4CMJA 4R54A 1L1FA 1YONA 2X1HA 4K9DA 2DFVA 5TT1A 1UXKA 4DTIA 1SNYA 3MZ0A 1LLCA 3MJSA 3PXXA 3VVBA 3QWIA 2H6EA 2RBEA 3MTGA 2Q45A 2VHVA 3B1JA 4TMFA 3RC7A 3VKVA 3W8EA 4AJ2A 2PZJA 4B7XA 5KVVA 5IZCC 2FPPA 3LF1A 5IZCA 1VM6A 3UCFA 3X2FA 3LDHA 2NVUA 4J3FA 4HADA 1E7YA 4N5MA 3QQPA 3ABIA 5DT9A 3WFIA 5A9TA 1K0UA 3EGOA 4L74A 1CQJA 1HRDA 2EEZA 3Q1LA 4DPMA 6LDHA 5ER9A 4ZRNA 2Q1SA 1R16A 3M6IA 3MWDB 3Q2IA 3C1AA 1H94A 4TRMA 4WCFB 3VPHA 3W4KA 5LC1A 1N92A 5JDIC 3QIVA 4KTTE 3ZW9A 1G1AA 2Q50A 3GVXA 5U4QA 2WE8A 2AQHA 5KTKA 2JCYA 1H5QA 1GV0A 1NVMB 4FFOA 1E92A 2V65A 3BXXA 2AQIA 3LZ6A 1K89A 2GASA 5A9SA 3VAZA 2BGKA 4LSWA 1N9GA 5CPBA 5L40A 1PQPA 4MOWA 3VPGA 1B7GO 5KJ1A 4Q3NA 4PVDA 1CERA 4FJ2A 4E0BA 3OJ0A 5AVOA 1MGOA 1VC2A 1PJ2A 3AOEC 2OXIA 3E48A 1HDZA 3OIGA 3INRA 1KOLA 3T4XA 3VZPA 4A0SA 5FYDA 4QO8A 3ZV5A 2DTEA 1NXQA 3WS7A 1W73A 2P9GA 3PI7A 4XYEA 4CQMA 3ZWAA 3WGGA 1QMGA 2HMVA 3AY3A 2DBRA 3VPXA 4W99A 5IDXA 3RUIA 4ZQBA 3KSZO 1KVUA 3GEDA 4CMBA 1E7WA 1CQIA 2NVUB 3PWKA 1Z75A 3TFOA 1PJQA 2PZLA 1GQQA 3S2IA 2P9EA 4XEHA 1I0ZA 1AE1A 1LDMA 2EKLA 4YRAA 1KS9A 3I23A 4IGFA 4LRSB 2VWPA 1DRVA 5JS6A 1IE3A 4A5OA 2QYSA 2Y1GA 3DFUA 2HKIA 1DIHA 5F1PA 5IDYA 3GAFA 3WWZA 3H5AA 3ZNOA 3KSDO 5JMPA 5TF4A 1Q0LA 1T25A 1ARZA 3LT2A 2PD3A 2ZIZA 4XGNA 4U0KA 4DYDA 3JD3A 3KLMX 5BT9A 1XQ6A 2FN7A 5A9SB 4N5NA 4ZA2A 2QZZA 5A5FA 1D8AA 4J9UE 1E3SA 1LDGA 2Q4EA 2VT2A 4BV8A 5IXYA 5G0UA 3OFSA 4E2YA 4BMNA 2OZPA 3K73O 6ADHA 1N1GA 2D59A 3T7CA 2PA3A 1PTJA 5F1KA 4GWKA 2VN8A 1AXEA 4DQXA 5IXSA 2FR0A 3RROA 3W4IA 1IOLA 5ADHA 1E3LA 2PH3A 3DBVO 2O3RA 2BHLA 4XYMA 4PLHA 3IP1A 4CQMB 1U4SA 3FRJA 4UVGA 4EUEA 2PFGA 1ISIA 4BNXA 2H63A 3RBVA 1F14A 3ITDA 2YW9A 2Y0DA 3KZVA 1KY5A 1PX0A 3L4SO 3WJ7A 4C7JA 3AK4A 1DJNA 1CJCA 3JQFC 4GLLA 2B0JA 2Q2QA 3KO8A 1B15A 3ROKA 4IQ0A 1MB4A 1UP4A 3P19A 1OZAA 1SO8A 3B20A 4LMPA 3RUCA 4EI2A 4Y98A 4E6PA 5CDUA 3H5NA 2CD9A 1F0YA 2VZ9A 4NMHA 2RCYA 4J1QA 1ZO8A 4RZHA 3V2HA 2H5LA 4KDFA 1HXHA 1VL8A 4R1TA 3CXRA 5GMOA 1R4NA 2QRKA 3ENKA 2VWQA 3DTTA 3VHRA 5IN5A 2GN6A 2WD8A 2AXQA 5U9CA 4D42A 4EUHA 5CPFA 4URFA 4Q3EA 3HN7A 3LT4A 4GBJA 3W6ZA 2EHDA 4K26A 3O4RA 3K8ZA 1SOVA 2QG4A 4NBVA 2ET6A 3S2EA 3ZHZA 1T2FA 5JCJA 1EBUA 3KOUA 3ZW8A 4HWKA 1NVGA 3PJGA 4WLNA 2X86A 3DHEA 2Y68A 3PFWO 3QV1A 4CMGA 3I4CA 4J0EA 4F45A 1EK6A 3SX2A 1H93A 1OAAA 2BKAA 5DBIA 4TROA 5AYVA 3VH2A 3DZIA 3HSKA 4B3IA 3MEQA 1PJSA 1UR5A 3PQFA 4ROSA 3G1TA 3GGOA 3A4VA 4BO7A 1NAIA 1WDLA 4UEKA 2QHXA 5JAZA 4L0QA 5GZ3A 2HLPA 4Z3KA 2HDHA 4PLCA 4MVJD 5G2OA 2B36A 1O0SA 2AHRA 4PLFA 4UEOA 4CM4B 1LBEA 3DBRA 2V6MA 1BDBA 4AJEA 3F3SA 1B8UA 1S6YA 1ZNQO 3ETEA 3O03A 5G0TA 1LRJA 3QWBA 5FEUA 1F06A 2Y05A 4PLTA 4WPGA 1KY4A 3RKUA 2G82A 4KMSA 4DQUA 4DC0A 1KVSA 3K6JA 4P4GA 4MPDA 5G4LA 4PLYA 2D2IA 1D7OA 1H2BA 2AE1A 1UAGA 3OSUA 1WMAA 1P74A 4BVAA 1O5IA 2QQ5A 4JROA 4FN4A 1VSVA 3C7DB 1ORRA 2Q1WA 4LCEA 3G79A 3ZWOA 1AHHA 2EP5A 2VOJA 5CDYA 2UAGA 2GYYA 4IJKA 2Y1FA 3VPSA 2ZB7A 4IXWA 4FFNA 5FI5A 1NR7A 1ZIDA 2FR1A 4FW8A 4MKZA 2VUSA 3G49A 1Y8RB 4O1MA 3TWOA 2O2YA 5B4UA 4IPTA 4KUHA 1Q7CA 3PJEA 5DP2A 5T6BA 2UUOA 2W2LD 2ZB8A 3G17A 4HFMA 2WSBA 4R4JA 4YYZA 1Y9AA 1WPQA 3PHGA 1ULSA 1ENOA 2X6TA 4W7HA 5JXWA 5TQVA 1N7HA 4HFRA 1P77A 5BQFA 1R0KA 1R0SA 4ZGWA 4R69A 2C59A 2Y67A 5FI3A 3IUSA 4IGEA 9LDBA 3DBRB 2ZQZA 5K9ZA 3HE3A 4HNGA 1WP4A 5ENVA 1PJ3A 3C7CB 2NLOA 4RO0A 5I8WA 1GZ4A 4JIGA 3K30A 2CF5A 5THKA 3K2EA 2C5EA 3A9WA 1PL6A 3UUWA 4FJ1A 1IZ0A 3QA9A 4J2HA 3I4FA 5EERA 5FF9A 4CMEC 2FZEA 4HX5A 4IY1A 2I5PO 4CMEA 4YT2A 3TOXA 5BR7A 4ZVVA 4FS3A 1QV7A 3NV9A 5A9RA 3CUKA 1R0LA 3FNGA 4TVOA 3WGZA 1A9YA 1R66A 1FDSA 3DHYA 1L7EA 1A72A 1NP3A 4QT0A 3HDJA 3KV3O 4OQZA 1I5RA 4R16A 1U5CA 3P2OA 4RDHA 5EQFA 2JD1A 1JWBB 1HDGO 2JD0A 5KNLA 2VZ0A 3ROPA 5HRUA 3I9MA 5BSEA 1YB4A 2VTEA 3PZBA 3EHEA 3S2FA 4OGWA 4EBFA 3OIFA 5KVQA 2ZB3A 3D4NA 4QEDA 3O38A 1EUDA 2C20A 1V3UA 4YAEA 1GU7A 2HMSA 4BIIA 1YJ8A 4HFJA 8ADHA 3LYLA 3L6DA 3RC2A 4CPDA 1E1NA 1E3IA 1M66A 2CY0A 3FNFA 1P1HA 1QYCA 4D41A 1GTMA 3TJRA 4YT5A 4A03A 3V1YA 3GPDG 3L4BC 4PFJA 3SEFA 1U7TA 1P1FA 2I3GA 1Z73A 4RVUA 1Z82A 1XHLA 2EW2A 4HBGA 4E3ZA 2C2YA 1FK8A 2OHXA 4PG5A 1Y6JA 4XYBA 4BHTA 1XKQA 3FD8A 3VKUA 4DUPA 4TRRA 5K0ZA 1UAYA 4NU6A 3VOSA 3DBLA 3HNPA 4LN1A 2UUPA 4LK3A 4Q3BA 4O6VA 4AJ4A 4L4XA 2P4QA 4Z6KA 3JD2A 2J5KA 3ROQA 4EEXA 4J7CA 5TLSA 3BTOA 5JLAA 2YZ7A 4B7CA 1JQBA 1WZEA 2Y66A 3GG2A 4DXHA 4HFNA 1U5AA 4BQPA 5I9MA 1LLUA 4NNJA 5AOVA 2POQX 4XDYA 3EVTA 2IRWA 4NFYA 4II2A 3WBBA 2O3QA 1PL7A 3JTMA 2B37A 4Y6RA 5B12A 1SOWA 4DIOA 4XRGA 5BNFA 4BNIA 5A5EA 4H15A 1X1TA 5TT0A 2NTNA 3ZWVA 1DEHA 2HRBA 3Q3CA 4NHEA 4NBRA 1HSZA 1K3TA 2I66A 3WMXA 1RYEA 4Q39A 2P5YA 1GFSA 2PKQO 3QSGA 4XYLA 2GLXA 1FF9A 1TLTA 1P31A 1U2DA 1YBVA 4M49A 1ID1A 4BKRA 2CMDA 2E37A 4TSKA 4E5KA 4BNTA 5KVCA 1WXDA 4PGFA 1VI2A 4CL3A 2IEBA 2VHYA 2PGDA 5C5IA 2FY8A 4E5NA 3SXPA 3U5TA 2Q2WA 1SB8A 3CH6A 1VKNA 1VL6A 2YHIA 3RBZA 1ULUA 1DPGA 3PWZA 4CLOA 2A9FA 4UVIA 4R9SA 2JHGA 2VRCD 3ASUA 4IIVA 1V8BA 2D1YA 1YS4A 4RLSA 3WQQA 4B4WA 3DBLB 1PWXA 2XF8A 3RWBA 2H1SA 3RJ5A 4NQZA 3M1AA 4WOJA 3RU9A 3WYEA 4OH1A 4E2ZA 4Y9DA 1ZK4A 3B70A 1P44A 4NJMA 1E7MA 1Q7GA 5TIIA 2PKRA 3ZWXA 4RF5A 3RUAA 1PL8A 3CE6A 1XA0A 4GKVA 1Q0HA 1FMCA 2HMUA 3KRTA 4GAEA 1IHYA 3TF5A 1HDYA 2E4AA 3OETA 2X0JA 4KP7A 2I65A 4MP3A 4UEJA 5F3RA 1BXKA 3Q9NA 4N5LA 3W1VA 4I08A 1EE9A 4P8RA 4E33A 1Y7TA 2PNFA 1IULA 1V35A 1J49A 1EQ2A 4I9NA 3BA1A 4J4HA 1WW8A 2F00A 3AWDA 1GCOA 2YDXA 4GX0A 4OYRA 2VOEA 2J6IA 4IDDA 3TZHA 5ICSA 1DB3A 3DZFA 1DRUA 3QLJA 1SAYA 2Q46A 1YQGA 2JL1A 5H81A 1OOEA 4RCVA 4WCDA 2D5AA 4IBOA 1T2AA 3IOYA 4J90A 4XB1A 3NDJA 2FMUA 2O7QA 3UH1A 1LSUA 3SC4A 5EN4A 2VYNA 4MVJG 3FNEA 3GQVA 5CG2A 4D3FA 1ZK0A 4PZCA 3H9QA 1HWYA 4CLOB 5JCXA 3FR7A 3VZRA 1QG6A 1J4AA 2QRLA 1EVZA 4I9UA 4D45A 4R3NA 3N7UA 4QUKA 5TJHA 3IAHA 3ZNPA 3CINA 4WLEA 2P68A 2VNSA 3SLKA 2B4TO 3GEGA 5ES3A 4KZPA 4WGGA 2ZYGA 3WJAA 4E5YA 5IF3A 5HS4A 2NWQA 2OOSA 1T24A 1HKUA 3JYPA 5G4KA 2G17A 2P5UA 3SJ7A 3IKTA 1PZGA 1U7HA 4IXTA 5F5LA 1ZJZA 1R15A 1X13A 3JQBC 1GR0A 5JFOA 3VTFA 5A3JA 4XKJA 3GNSA 3B1FA 3M2PA 4YR9A 1WZIA 3I9NA 3IP3A 4LW8A 4RVFA 1JAXA 3DZHA 3IC5A 1KVQA 4EJ6A 1U3TA 1PJTA 4YVFA 1ONOA 4GPD1 3UAGA 4CM6A 2IZZA 2WMDA 4KWHA 1ZSVA 3KUXA 1TVEA 1A9ZA 4TKLA 1C0IA 3OM9A 4XCVA 4CM8A 4LISA 4TWRA 2DPHA 1PWZA 1NX6A 1GCUA 3E9MA 4R1NA 2AA3A 4YACA 2PR2A 4YRBA 2FSSA 1LDBA 2B69A 3WYCA 2EKQA 4DMMA 3OICA 4B3JA 1Z74A 3GMSA 3K31A 1GQYA 2GNAA 1M75A 1RJWA 2DFDA 3WICA 1LXCA 1P1IA 5IAAA 1ONNA 3AFMA 3A1NA 3E6AA 3QVSA 4WEQA 2JFGA 3ADOA 1BDMA 1GAEO 1HT0A 2HSDA 3KHUA 4NZ9A 4WCFC 2AEJA 4FFMA 2BELA 2BFOA 4DBZA 3OHSX 2GO1A 5TRTA 1GYQA 1PGNA 4UUMA 4RPGA 2A94A 4JBGA 3TSCA 4L76A 3STHA 3NGXA 3LC7O 5L4NA 2X7HA 4XDZA 1JN0A 3C7AA 2W4QA 1B2LA 3PYMA 4CV2A 2Y99A 4B4VA 2WD7A 4NFHA 3CEAA 5G4KB 1T1RA 3DB2A 2PLAA 3BHMA 4L4RA 2PV7A 2GUGA 3GH3A 1NNUA 1I2BA 1QXSA 3AUTA 1LNQA 3V2GA 1GPDG 5CDTA 1T4DA 2PK3A 4OHUA 5IJZA 1KETA 1I01A 2YQ4A 1EUZA 1P1KA 1PIWA 3AUSA 1RM4A 4EGFA 4EEZA 4JNKA 1KERA 1P0FA 4DMLA 1JKJA 3HFSA 1I3NA 2ZTMA 4IMPA 3D5QA 1I33A 2NVBA 2CSUA 4FPXA 4U6QA 2YFHA 1LRLA 5L95A 1SEVA 4WUVA 1LA2A 3ZWPA 4CM8B 4GMGA 3JD4A 3CZMA 3PEFA 3TQHA 3GOHA 4FC6A 4CQMD 5J23A 3WGHA 3JQ8A 2C82A 4CLXA 5CEFA 2Q99A 3I83A 4GI2A 4W4TA 2LDXA 5C7IO 1XEAA 3ZDFA 4B8WA 1EDOA 2V6FA 5LDHA
chains in the Genus database with same CATH superfamily
1DQZA 4ZCLA 3PEYA 2OB2A 3BK2A 4KPFC 3TZCA 1KDPA 1PDWA 2OFOA 3U3XA 2JJYA 3A4MA 3MRXA 3CO0S 1T36A 1XDZA 4Z1MD 1V7ZA 3NAZA 1H65A 3W0LB 3GBSA 1YU6A 4HTFB 2UZIR 3OA0A 4AU1A 2W11A 4EBBA 4G6ZA 5AW2A 1HI9A 3NWPA 5IM4F 1JKIA 3MT7A 2C0PA 3KKMA 2VNJA 2ZSFA 3KQMA 3Q9LA 1QFZA 1D1SA 2ZJ8A 2JG3A 2JIZD 3W6UA 2O5VA 1CNMA 3IQHX 4RE6A 4D9CA 2XSZA 4US1R 3M83A 1X9HA 2QVXX 4LJ9A 3INYA 5JAMA 4C01A 1HM5A 4N4AA 5AHXA 4IHJF 3DFMA 1SQSA 1T6NA 2FQ1A 4HSGA 2XJ9A 2EERA 1G66A 4WEOA 4ZI7F 3ZKAA 5KAMA 2XGOA 1J2UA 2ZYAA 4E12A 5BVHB 3IQIX 1LVHA 3CSUA 3AY7A 3ZHTA 4YUVA 4I8DA 1FNNA 4GLBA 4YXWA 4C2AA 4X6UA 1U8CB 2BGNA 3RYHA 4AO6A 1R50A 5IBPA 1GAWA 2PGAA 2QORA 4MDEA 1E5VA 3N3AC 3BXOA 3G1UA 2AZDA 3FNBA 1W29A 1JB1A 2MYPA 5EIEA 4IG9A 1VPEA 2ZUCA 3BB3A 2WWXA 4PO3X 5C3UA 4UNRA 1GG8A 3H2JA 4IM7A 2W43A 4WINA 3DZDA 4YMWA 1A97A 4DMGA 5B1YA 3G0DA 2FFRA 4RADA 1DU4A 3QH4A 4F60A 3GWZA 4QODA 4Z5XA 2VTKA 5J58A 5KX5B 2GNOA 4KFSA 4R8VA 1QS0B 1NUUA 3NTOA 1O0BA 2KQUA 3F3KA 1BEZA 1XJ5A 3FX2A 2XUQA 5TMEA 2WFMA 1CK4A 4W5HA 3ZN2A 4PZ0A 1Z33A 1J20A 2J8ZA 4W1SA 4A8JC 1JU9A 2HWUA 2QE6A 5MDHA 4W8OA 3DVAB 4QFMA 2FGJA 3GCGA 1RQPA 1P62B 4X44A 4RVSA 1WSAA 4FUTA 5JY6A 2C9OA 2O2ZA 1UJMA 1PK9A 1CZHA 2BHRA 4M55A 4F9GA 1ZICA 5B2EA 4MA5A 4A27A 4UQLA 1GJRA 1X74A 2I78A 3FW1A 3GJ3A 4Y2QA 1OE0A 4ESVA 4L7QA 4JB0A 3TOCA 1J7JA 2CZCA 1RM3A 1I4LD 4B46A 4YIHA 3M5PA 4I7EA 4JUIA 2XUAA 3U26A 2A92A 1MIHA 1T9AA 4O4IA 2DM6A 3R2JA 4AJ1A 2ACWA 3Q8KA 3MJVA 3EEFA 3TKYA 1ZI9A 2F1IA 4OQ4A 3I62A 1DX9A 3D7NA 2XWSA 2P2SA 1N8KA 1XAIA 1YZFA 2NTVA 3R41A 1R5BA 1YNOA 5IUJC 1WXQA 1KDTA 2EP7A 4DWVA 2VAPA 3DKVA 4IFEA 5JADA 5JAUA 1PSZA 3O82A 3W6NA 4ALIA 1E2KA 2WRZA 1VDZA 4P31A 4BASA 5T5QA 5CIWA 1A71A 3UEOA 3L9WA 1UBEA 3V48A 4C2TA 2ZVDA 3DEHA 4PZDA 3R6LA 1NJGA 1E0KA 2P9TA 3AM3A 2TMDA 1PKXA 2JAOA 1F1JA 4QD3A 2NSHA 4M87A 2HX1A 1XCMA 2B6NA 3Q7IA 2HA2A 3A3OA 2NSYA 2GK6A 3KYCB 2HYIC 4L6AA 4J2OA 1NE7A 3OKAA 3EQ6A 3IUQA 1B26A 3AONB 5EFOA 1L7PA 2IXGA 3AI2A 3PNPA 4C0SA 3ET4A 1VI6A 1TTQB 5EXTA 2QMEA 4EG8A 1EIWA 5BN4A 4YMGA 4BGDA 4MAMA 3L05A 5DM4A 1LC0A 4DSZA 1BG6A 2DBVO 3HCPA 4GICA 3W06A 1H6BA 2I3BA 4DLZA 1PKEA 1XEFA 4CTJA 1VMIA 2WIFA 4TN5A 4PGHA 1KSFX 2R6ZA 1X3SA 4F86A 3LQKA 6REQA 2EV9A 2PBFA 1F51E 4CDGA 2BM0A 2JFUA 3K5HA 4QNRA 1A69A 1C1XA 2M6LA 5BQXA 5ICCA 2GYWA 2KMLA 3LH5A 4X1IB 4BFZA 5DB4A 5L3QB 2NO0A 2F9MA 3U9SA 4YPVA 4UNNA 4IUCS 1LBTA 1OIWA 1J90A 1I3OA 1TW3A 2V1XA 2B9VA 2YCLA 1LY1A 3DSRA 4Z9AA 2PZMA 3WYBA 1DJPA 5SY9A 5CAEB 4GSKA 1JDPA 1ESNA 4PIPA 1ZXXA 2D1SA 2XHZA 1H2EA 3J7TA 3NASA 2FXIA 2VHZA 4HSEA 1E5QA 2ZATA 2VSXA 3F5SA 1J8VA 4C03A 1R4AA 1LSJA 1YR3A 1Y4SA 2PZKA 4FEYA 2WYHA 2O3JA 4KI0A 5AM2A 4YAOA 5ICFA 2YHBA 1JR3A 1TRHA 1PS9A 2MWMA 1DC5A 3IGFA 3OOYA 1GUDA 2ODWA 4PLWA 2WWRA 1HQDA 3AP3A 1G18A 2F4VB 1UKBA 2VPXA 4IGKA 3QWFA 4E30A 2LD4A 1LV7A 4HAOA 3T06B 1D3AA 2P4EA 1AB5A 2XNHA 3SE7A 1T8SA 3H9CA 1UBCA 4GOMD 3LDUA 4M36A 5EHQA 1DT5A 2VBIA 2W6ZA 3IBFA 1Y63A 4NKRA 2X23A 5D5HA 2Z4TA 2AJLI 1NQTA 1T2UA 2GDJA 3OKPA 3TL3A 2W37A 2C97A 4EG6A 3ZY6A 2BGJA 3ZDZB 2BFCB 3C1TA 4MKGA 3L1IA 2ICAA 4OOEA 4TMVA 4ETWA 3A1SA 3ZBTA 1PGOA 2FSVA 4FSHA 1USGA 4OIFA 2I3DA 1KOFA 2Q9CA 3DCJA 5DH9A 3ANSA 5KNBD 4W6QA 1XXHA 1D03A 2H9AA 2HQOA 2JIDA 1IPHA 3DTVA 4M1OA 2ZUBA 2ZEJA 4FOOA 3CLSC 2ZRFA 4EVSA 3SVZA 1BWSA 3NGLA 3T41A 1RI2A 2YV1A 4UMFA 1SPXA 3DDNA 4P3KA 3E7DA 1TIKA 3OOJA 2CLLB 1CB7A 4HEA1 3RVMA 3G2HA 4Y9SA 3WQBA 3GGCA 4RNDB 1GGHA 4NR0A 3C3XA 1MQSA 2OO5A 4NDNE 2XVXA 1LTQA 2OD7A 4OK5A 1ZHHA 1G6Q1 4MPJA 4P34A 1A9SA 4MA4A 4G09A 4RHTA 2NMVA 5IM4A 3TRKA 1O6BA 2A8YA 2BGUA 4GI5A 1PNVA 2ZCUA 1M5UA 4CKYA 4EF6A 1R4NB 1W88A 4AMUA 1HT2E 3FSGD 5CXUA 1DKOA 1RJEA 2VCHA 3NJRA 3QI7A 4UASA 2QNIA 1D4ZA 1I6KA 3KXPA 4TLMB 2VDNB 3PZRA 1C3VA 1LJLA 3H18A 1YRBA 4DM4A 1Y4AE 2CL7X 4IHJA 1ZMXA 3ELBA 1JYSA 2FWRA 2X2PA 2VH5R 2BDTA 3GDFA 1LLFA 3CWCA 1WZCA 1V3QE 4EJMA 4ZI7A 2RIRA 1BMQA 4C0XA 4DT1A 1UFOA 1KYZA 5CT6A 4ZT3A 2C5FA 3ICOA 1EUCA 3NATA 4UTXA 2QRMA 1HE3A 1KQOA 3H4MA 2HMYB 5HX7A 1MT3A 1KO5A 1ECPA 2W7TA 4I5DA 2CVZA 1CRZA 4IDBA 4AJHA 1A9OA 2XYHA 3HC7A 4J07A 5DDIP 5EFZA 3DD1A 2YVKA 1TM4E 2NUTA 1HG1A 3T61A 1VYVA 1PS0A 3T4PA 5A3VA 1MTOA 3ITKA 2YVUA 3DQPA 3MWEA 5JW6A 3O31A 4UHDA 7MDHA 3K5WA 3KL2A 1M8PA 3BIFA 4EYQA 5CDGA 5HSGA 5KO2A 1KO1A 2Z1DA 2JBAA 3AW8A 3IXMA 4AZVA 4DNXA 4GR4A 3GT0A 2WIJA 3H1EA 1H2YA 2YVLA 3C4QA 2SKCA 1P1RA 1EJ0A 1TYAE 1XD2A 1AZTA 3JWEA 3UCEA 4C4XA 4JEIA 4C7KA 2OXEA 2ZRQA 3K96A 5ESWA 1T8TA 5DTIA 4CR6A 2H8GA 4TLDA 3S2UA 4LFBB 4TWIA 4OU4A 5DTMA 1SU7A 2ZKLA 2DHCA 5CVEA 5L6LB 4KV9A 1I30A 4BNUA 2ENWA 3OMXA 1DQRA 1NSYA 1ODSA 2Z5LA 1F3LA 4TWZA 3AG6A 4ZAVA 3WL7A 4DLRA 3FYSA 3M6LA 4BNGA 1W4CA 4CUZA 1C8KA 1KMMA 3S8EA 3H83A 3TEMA 1AA6A 1M0TA 1ZBDA 3R9XB 3QKSB 2FKNA 4RC9A 3ZH2A 5IWAB 1WS6A 2MDTA 3C48A 4JJ4A 4YAFA 5H9WA 1SOUA 4HXFB 4CMHA 1ECFA 4MROA 3MCAA 4HB4A 4AZ3A 3DDHA 2E55A 4HZUB 2ZRCA 4MLCA 4F4HA 1UPXA 1EZ1A 1UBMS 1T5OA 2O0LA 3PNQA 3OZVA 5JAIA 3GRAA 1L8OA 4G0YA 2CLCX 1NHGA 4OHBA 2OHIA 1NNLA 1JNYA 4XGIA 2J3IA 4Z7OB 3EWIA 4LX0A 5HS6A 3U7GA 4HDKA 4EHAA 5KYKA 4NV3A 4XZ3A 3HN6A 1L5VA 3DWIA 4MMXB 4UFNA 5EUMA 3TD9A 2HHAA 3D4PA 1YHYA 2XNDD 2CVPA 1YAJA 1JA0A 2NADA 1ZL2A 2K4MA 3E1KA 3L8MA 3PX2A 1NU6A 2A86A 1YRQA 2FRDA 2B1QA 1OXBB 2C5AA 2H1IA 1CDOA 4DQLA 1C9JA 3Q7PA 1KEKA 2W2NA 5HCNA 3U4QB 5DEOA 3VZSA 4ZU1X 5AI6A 1V3TA 4FFDA 4OK3A 1SD5A 2LCFA 5MF6A 5BN1A 3B1KA 2OCKA 3CTMA 4Y67A 1DQPA 5A3RA 1WPXA 2G83A 5BV7A 4G86A 1N2CA 1G9TA 1W1IA 4MAFA 1OI7A 3NNDA 4MR9A 5G0WA 5K3FA 2Z8XA 4UDNA 4DREA 2E4XA 2DZDA 4ID3A 4YROA 5DNUA 4X91A 4M1QA 3BCHA 3JVIA 5EL0A 2BJHA 1R2QA 4HGQA 2BD0A 3I8SA 4AMGA 2CLOB 4EMUA 1RP7A 1U2SA 3D3WA 3SR4A 4F12A 2OVFA 4Q6BA 4KBGA 5JC1A 2ZUUA 3DONA 1S2GA 4NBUA 1V11A 4OHFA 2VF2A 4W5NA 4NV0A 1P9WA 3DYBA 5A7FA 1HZZA 3DAGA 3RFXA 4L9WA 3LPMA 1V25A 4M83A 3ZBPA 1YQXA 2IXFA 2QIOA 3D0OA 3G0IA 3ILSA 3KR1A 1ZOLA 1XDUA 4IH9A 3OEWA 1V9CA 3PGXA 3EISA 1DAFA 4DIUA 1OU4A 1JJBA 5JVDB 4IJMA 4FINA 2Q5CA 2VJBA 3VPCA 1QKKA 4BO0A 3LT5A 4KIGA 4CHTA 2X9LA 3F90A 4BQNA 1ZHOA 4RSGA 5E9JA 2CV2A 4C4OA 1Z08A 4QU5A 1GADO 1RNLA 1PFGA 2BL4A 2O2GA 3OX4A 5CXSA 4Z2YA 5TY0A 3WNCA 5DM60 2JIRA 2NG1A 3NEAA 4ZVTA 1U2TA 5KMGB 1MJ5A 1DHRA 2YRWA 3RF6A 4Q3AA 2B9EA 1ZITA 2W4IA 3P2YA 2OGZA 1TGYA 2FW6A 4TQ9A 1EWRA 5J4HA 1I36A 3K2BA 4RPLA 1OAKA 2PUHA 1UFQA 2CCKA 5JBQA 1RWBA 1J06A 1R64A 2FPLA 3K7EA 3HU2A 3QE0A 2XQFA 3LPAA 4LHVA 3V6MA 4KQKA 3I2KA 1T4CB 4G8CA 3HB0A 4AO8A 5JHGB 2J85A 4XWKA 2HQBA 4MI9A 2JVJA 4MJLA 4BN5A 3HPRA 3PQCA 4OEHA 4YLGA 3LWDA 3VR6A 3WNZA 5DCLA 4BMXA 4BQFA 1CJKC 1GKIA 1IC6A 1T3TA 2IY8A 2JGLA 2O3SA 3CG4A 1NUQA 2X6QA 2O52A 3PDUA 5ELLA 4PNEA 7GPBA 2OEPA 3VHXB 3OZAA 3I2IA 3IIKA 2YXEA 2XGGA 3ANTA 4X85A 2NZJA 4WGFA 3LCVB 4XJTA 5KVSA 2CMGA 2RB5A 4FJ0A 4DCGA 2CL6X 1F2DA 2W0MA 1JEEA 3A1VA 4RIEA 1Q14A 2SBTA 4B9EA 1U2GC 2VK4A 2XIJA 3TIXB 1J97A 1WRBA 3E22A 4JUCA 4R7TA 4TTQA 2M9MA 2Y1OA 3HJAA 3OJWA 4RKYA 3V9PA 4QHYA 4GI3A 4ZOLF 2YBEA 2J3JA 2FUKA 2OFFA 1BQ4A 2ZYHA 1VJTA 2HNAA 2DSTA 3R24A 4B6QA 3QVXA 4AJPA 1XYVA 2PN1A 5K45A 4BO2A 1BOOA 4TKZA 4M7WA 3TLYA 5IF9A 1KOJA 3ENNA 2B1IA 3SOZA 3B6IA 3GRFA 1MJFA 2GESA 3QLTA 4HDNA 3ML1A 4UUNA 3T9CA 3X0DA 4DLAA 4KX3A 1XQXA 1UBTS 2AEFA 2VHEA 2X22A 1CRWG 3KQTA 1LLDA 1W47A 1HYGA 1SQ5A 4I1IA 2DG2A 1QIDA 1LJUA 3WGIA 5T64A 3CJQA 1VMAA 4YV7A 4H0CA 2KI5A 2ZIXA 2C9DA 4PXSA 3VPBA 3Q87B 3NNSA 4C06A 4C6TA 2VK2A 2P5TB 1YR9A 3BD6A 5AVQA 2RGEA 3KZNA 1N5OX 2Q5OA 2ZT5A 4B80A 1JKFA 2QN2A 2H5EA 5JV5A 2IXTA 5LQNA 3S1AA 1A8UA 1KIFA 3I09A 2BTEA 1E7QA 3IKVA 3VO2A 3SJUA 1NBAA 2YOFA 2NYAA 4ADSG 1QBGA 3DMPA 3TQIA 4XARA 3WAGA 1BJTA 4LQDA 1ZH6A 1E77A 1TMKA 2GPAA 2J6CA 2UZ0A 3G9QA 4UMDA 4ZMBA 1YCHA 3X1DA 3WGUA 3SDSA 1FYXA 1X19A 1GRQA 2YYSA 4TGLA 5CB8A 1RYHA 4LS3A 2IOQA 3ZWCA 1RBMA 3QOWA 4RA9A 3ZHQA 1JVBA 4MS3B 2JZOA 4PYNA 4EF4A 4EX6A 4QASA 8ABPA 4PYQA 4LCJA 3VPDA 1EH5A 2AVDA 4ND7A 4TQGA 1OZ0A 1CE8B 2H59A 3NVAA 3CHYA 1M6WA 1H8HA 5G3ZA 5GPBA 5BORA 1KDRA 3VUFA 5LPNA 1M8GA 1HDRA 4UU0A 1NFRA 2IYOA 2O6LA 3DT6A 3N8KA 3T94A 4BLRA 1WCIA 2CBGA 2WU1A 3H5IA 4E4TA 5IJWA 3LZDA 3RANA 4AJOA 4BGIA 5BW6B 4QXAA 2H7YA 2Y3IA 2RCNA 3MJ4A 4KSYA 4OKSA 2REXB 3M33A 3KBOA 3MM4A 1ZK3A 4PM4A 4N8EA 1JGTA 1P33A 3I6MA 3U7HB 3ED1A 4QUDA 1R4ZA 2Q41A 3LHSA 4OJYA 2DBYA 3WRXA 3DLTA 3HVJA 4JSYA 5U4XA 4JI8B 3JQGA 1TKRA 3KAQA 1HLFA 1Z5UA 4I5GA 4WXEA 5ECYA 5TE9A 5B7GA 2HGSA 4FHEA 5TNXA 2WNHA 1EWYA 3RUFA 1YS7A 2EAUA 3D7RA 3AB7A 3B9BA 1H2XA 3ZWNA 1E5LA 4TS3A 3B12A 1IAVA 2I6GA 2V7XA 5IULC 1KJQA 1S01A 1X8XA 1AKMA 1H2HA 1QLWA 1VZ3A 3K0FA 3LKVA 1TM5E 1JBQA 3BGSA 3IDSA 4B09A 3OJLA 1T4MA 2QAGB 3H5OA 3IVCA 3M9LA 3RUHA 3ZLUA 2W83A 4TT3D 4W5OA 2W6JD 3S99A 4Z7JA 3OZWA 4K03A 5CVDA 1QE0A 2OHGA 2C95A 1UDAA 3DE5X 3HL4A 4NP6A 2WKSA 3W5AA 3TCKA 4NU5A 3IUNA 4ALNA 3GHYA 1FJXA 1QKIA 2CV0A 1ISMA 3GGGA 1RLTA 1UOQA 1T2EA 4M7PA 4R9NA 3TAUA 2VXBA 4BUZA 3ITEA 2HXGA 1N6RA 3KV1A 3RVBA 4RIIA 5T4EA 1X6VA 4NZNA 1JALA 4YHBA 1LBQA 2ZTUA 2DJIA 1TQ2A 2JRCA 3I1YA 4MV5A 4O4LF 4WASA 3MOIA 2C4KA 3S55A 3ONFA 3U7JA 4DLVA 1SBZA 3F7TA 3IAAA 4RMJA 4FR5A 5KSYA 3EAFA 4P38A 3EVBA 4K28A 2M6KA 4IOLA 4QNNA 5BV8A 4DDVA 5HJEA 3R0ZA 4WA7A 2QD2A 2CHFA 1G64A 4HAZA 4ABTA 1ZJ5A 4F96A 4F71A 2B3DA 2BISA 4P9NA 4U2BA 1C30B 1Y48E 1I51A 3P5BA 4Y9TA 3ZLBA 3ZDXB 2ZDQA 1MVNA 1DIOB 1S96A 2MSNA 4ZV4A 5HW0A 3U6KA 2VJCA 4X71A 4Z0NA 3DNPA 4PEVA 2R25B 4YPOA 3ZBUA 5IRCD 3NQ41 1U8AA 4BB5A 4GL4A 2RGBA 1IY9A 3MJTA 3R77A 3QKRA 5B58T 3TZBA 1IATA 4OK6A 3T7AA 1A8HA 5AVSA 4ZO7A 2ATVA 1LI4A 1EG2A 3HA2A 3HGMA 5I7RA 4U7FA 3UJBA 4HN9A 5F64A 1ZRNA 2Q2NA 1NWCA 5A71A 3FNRA 3T9BA 2UV8A 2V7WA 1RRFA 3T7RA 3P20A 3E1GA 4UOQA 3RIXA 3OQOA 2GBCA 3FCCA 3U3RA 4EG4A 2DWPA 2VUUA 3AETA 3H8VA 3M9WA 4UW9A 4ESOA 2XOXA 5BW4A 2OV8A 5MFZA 1W44A 5LDGA 2OVBA 2VWHA 3QW2A 4ND8A 3Q3JB 621PA 1O89A 1OREA 3LWBA 2G5PA 5DN9A 1C4XA 4N1AA 5C52B 2OCAA 4KO1S 2NXCA 3VUEA 4D8YA 2MT9A 2CNDA 4Q9HA 2AZMA 1XI2A 2OV3A 2R8BA 1TCUA 3OSZA 4RV5A 4BNDB 1LNZA 2WA2A 5TQ2B 3QYFA 4KO2S 5IARA 3ZUPA 2C83A 6YASA 3ZZMA 4D0GA 4MKXA 5FBHA 5H4HA 4RHUA 4FI3C 1HRKA 4YEDA 3ESQA 4BBPA 1KPHA 5CA0B 1DDOA 2ZUWA 4UNQA 5JAQA 4CM4B 3BFKA 1ZVQA 4XWYA 4CEHA 4RGBA 1XU7A 3SSMA 3QE2A 3D9QX 1W4RA 2WIGA 4QWWA 2HRCA 2VAMA 4BKQA 4MV7A 3QE3A 3QVUA 5GINE 1VCNA 1WF3A 1NMEA 5F7ZA 1L1QA 1C8BA 4DCMA 4EITA 2UVPB 3EBOA 3G2MA 2IYFA 2C2OA 2NGRA 2BJVA 1QHFA 4KGZA 2NU9B 4C04A 2J09A 3F74A 5AXCA 1CDEA 4R51A 1IM5A 1Q0UA 1S9DA 2C4VA 2DKNA 2G40A 1ENZA 1GNRA 2MIIA 2O0HA 2Q8PA 2VJLA 3HZHA 3WJ2A 4CUKA 3Q3HA 4ZOLA 4EATA 1S7CA 2J0VA 1VHQA 3MGGA 1X0XA 3TJZA 2CXSA 1GA4A 5GONB 5KAPA 3OX2A 3TN7A 2ZUSA 4MUNA 2X8LA 2G0TA 3T1HB 2XMZA 1RLIA 1IY2A 1F17A 4ZQEA 1IUNA 1IN5A 4HNHA 5FOTA 4L8VA 4NPCA 4PLGA 2D2FA 3T3DA 1XKTA 1ZGZA 4DDUA 3GJXC 1Z39A 3MCUA 4YIKA 3ZK7A 4YI5A 2IYXA 4WN3A 1SUPA 4RV9A 1FQWA 1E3JA 3COSA 4N3BA 1A04A 4GIBA 4D9MA 4KFUA 4BMPB 1NN5A 3CGWA 3I72A 1QQAA 4Q9AA 3MJEA 2V7EA 4KR3A 1VYUA 2QNRA 4RIGA 3OHMA 4B6SA 4XWGA 4FSDA 2PZFA 3G9UA 3MTEA 3HU5A 3ND7A 4MQFB 3STUA 1WUJS 1RXSA 1LCIA 4J43A 5FO0A 1PFUA 4J4BA 1TZJA 1OFGA 3KJHA 4JI4B 2BI8A 2WC1A 1ZFNA 3NH6A 1E3QA 3H8WA 3KQOA 3U4DA 4L4SA 4EAQA 4WXRA 3C15C 3RYFB 2AN4A 1WU7A 3A6EA 4YAIA 1RJGA 3MYRA 2BM1A 1EDDA 1E4EB 3F6PA 3KEQA 3Q2KA 4P84A 1ZWKA 4RIFA 4AZ0A 4BB6A 1VGQA 1G1MA 2Q21A 2X8BA 1FDUA 1YQ9A 2PT9A 3EGDB 2XQKA 3PBKA 2FR8C 1MO6A 1YOVA 3MWLA 4IJ6A 4LHWA 4LY3A 5CGQB 3AY6A 3L0YA 4KXQA 4MVJI 4WKPA 2H4JA 3FN4A 1W0CA 4KRYA 4MVJF 3JQQA 5G53C 3V80A 1KU6A 1P5JA 3X1KA 3THYA 4RJTA 1VHJA 2NZWA 4QDKA 4EB8A 4JA2A 2DH6A 1XMOB 3MFQA 2IK8A 3CNEA 4LC1A 2QTZA 1A2BA 1SIOA 5CW2A 3LKDA 5I9BA 2EL7A 3VH4A 1T5TA 1NC1A 3PHBE 2QTMA 4IF6A 5AI4A 3BICA 3GZ4A 1H2WA 1FTYA 4B3TB 3N59A 2DPLA 3H6KA 3DO5A 2QM0A 4KJXA 4DZRA 1IXKA 4MEAA 1O9HA 3OP4A 1I4EB 5MFPA 4HPXB 5SZHB 3WBFA 2VEOA 1JSCA 2QZSA 3C8HA 4G8BA 2JFYA 1D6SA 3QENA 1FP4B 4J3JA 1WP9A 4R05A 4ALLA 1Y9ZA 1JDBB 4BVFA 3O2SB 4F7WA 3X3HA 3K9FC 1OHHA 2PZEA 2XUPA 3LYUA 4GXRA 7ABPA 2I7XA 3WK6A 4YCMA 5B6JA 2W2KA 4JYPA 3OAAD 2JBWA 3IE2A 4AY6A 4Y8VA 3AGPA 3FTDA 4HNAA 3N70A 1XJ0A 4R7GA 1JH9A 2YN2A 5JQWA 4LDRA 3WYFA 1TEHA 4F4JA 2FE1A 4C7BA 1BSVA 1O1YA 1G3QA 1HORA 3W5VA 3AUXA 5CVCA 3FDZA 5JDCC 1RKVA 1VE3A 3KU1A 1N1EA 3O47A 4PGMA 2Z9BA 4ZQGA 4ISBA 1XWFA 4ZVOA 5TS3A 4BQSA 1SKMA 1JFLA 1UZLA 3I32A 3OT1A 2ZJ0A 3IA7A 2ZJ5A 4WXMA 1J2EA 3DEIA 4DBVO 3D3NA 4OQMA 1K3UB 4O2AF 4N0QA 3M6XA 3ZHXA 4OKIA 1NMYA 2B25A 2Y6VA 4NH0A 4CQJA 5CG1A 2PX8A 5F7XA 4MUMA 3O7MA 4O4LA 1Y4ZA 1Z13A 1OKKA 1JHOA 1XMIA 1YDMA 3I3OA 3SF0A 1SXJC 4WJLA 1G6KA 5LB4A 1KK2A 1ULHA 1HE4A 3GARA 3SBDA 4A26A 4EPTA 2FFJA 4P2GA 5J5AA 1SJ9A 3N0VA 2I99A 3ROEA 1TUIA 4IX1A 2OXRA 5JSUA 5KS2A 1J5PA 2QW0X 4P3PA 3FWPA 4TLCA 4ZVPA 1P2GA 3S40A 4Q18A 5DLDA 2GEDA 2CUKA 3QLVC 3O8DA 1EDBA 1JR2A 4KEAA 5KYWB 2WWYA 1EM8B 1MB3A 3FDJA 3BN3A 2HMAA 4DEVA 5CFZA 1LSOA 2NT4A 2VQSA 3GLTA 3JQFA 4TRNA 4XVRA 2NTYC 2PYDA 1HDXA 4L9RA 1UBGA 1XBTA 3AERA 4EJFA 2J0QA 3IELA 3WL5A 1OH7A 3LBYA 3JQ9C 1TJ3A 3CIOA 4RD0A 4ZALA 4K2HA 1WNTA 4BO5A 2WJPA 4MIKA 5K0EA 4IXNA 1XRNA 2IODA 4GUAA 2X77A 1Q15A 2O2DA 5EJAA 1EFTA 1NBIA 3V8EA 3AL3A 2ZI7A 3FUUA 5IZ4A 3SC3A 4J16C 3FMPB 4JI3B 5K0TA 1QR6A 3A6FA 2RG1A 3PR3A 3KEMA 1W8DA 2VPTA 2O8DA 5ALYA 1OLUB 2JIMA 2PM8A 4NX2A 5EIWA 4O2RA 1UFRA 2CXPA 2DQSA 4PE5B 3PHHA 4G26A 5I9SA 5CEEA 5KYUB 1TAUA 1CULC 1JAYA 2CYAA 2GJAA 1XTQA 5BPHA 1AXRA 4IVQA 2YWEA 1VLLA 1AHNA 1TCVA 3O0TA 4L85A 4LXUA 4UXHA 4Q9IA 4GZ3A 3B3AA 4FQ5A 2DJ5A 1H85A 1T3GA 3ETGA 3PUWA 5EZ6B 4ID9A 4R6WA 1X7WA 1H0KA 1AGYA 1TUGA 1V39A 1W52X 2FZWA 1Y8RA 1YRLA 3WADA 3NJ8A 2ZYRA 3H2SA 1M6NA 3H3JA 3LWNA 4JT9A 4WUTA 2EG9A 3K0AB 5E9QA 9LDTA 2WTEA 4V3CA 5ALQA 2RBKA 1GNQA 2BGRA 1YI1A 2VIIA 4B44A 3KJEA 4O33A 3BRWD 4CWAA 4HYQA 3CMMA 3ON5A 3R3SA 4NARA 1SBNE 5HFNA 1S89A 5KYXB 1Y8QA 4KUGA 2ZE6A 1ATZA 1SH7A 3N86A 1RXYA 4LOKA 4BNNA 2XT6A 2ZQ5A 5FYQA 1DEKA 1QGYA 4NENB 2GETA 3I4LA 3LC1O 4J9VA 1DBWA 1TK3A 2OSVA 3IAS6 4I5IA 1P72A 1WB6A 1NN3A 1E9BA 4L9SA 3GQBB 1P0PA 5EWMA 3WWYA 1AKQA 3RFUA 1ZY2A 3DHWC 1XFDA 5MHTA 3UB2A 1AQIA 1QYDA 1Y82A 3SXUB 1Z68A 2EFCB 3HUEA 4B6EA 4ZHSA 1G20A 3DQZA 2WJWA 4L8LA 2FVXA 4PPQA 1AKVA 1OA1A 1SULA 2D13A 3Q8WA 4QZVA 5DCWA 1D1TA 1K0FA 3UAVA 1JL3A 3K8YA 3L40A 5EQTA 1Z7GA 3PEUA 2PS9A 3U37A 3BMNB 4D92A 4BP8A 4QU0A 1FUKA 2QYOA 4LRUA 5JJLA 1KRWA 3BMOB 3IP8A 2IYSA 3LT0A 4J76A 4XCQA 2QE7D 3FUWA 3QWHA 2V1UA 3I6ZA 3QELA 4YWJA 4K5QA 3DVRX 3G0BA 3KT0A 4ALMA 3ETJA 3N87A 5A4DA 8OHMA 1C80A 5EIHA 3OD5A 4RKRA 3FH0A 3KTFA 3LIIA 5ADWA 1JZSA 3QU5A 5ARBA 4U3JA 2DB3A 3T7TA 5KJCA 5EP1A 3V8BA 3F4LA 4PYKA 2FEXA 1JDNA 2NXEA 2FPOA 5AT1A 1YL7A 4HRXA 3U3MA 5IP5A 1M2NA 3AR5A 4UOEA 4NDZA 3QOFA 2W2MA 1CETA 2ZP1A 4UCQA 1TE2A 3C70A 3EOAI 3WWPA 5FTWA 5JZVA 1VKHA 3RKSA 1GEEA 2I4NA 4XB2A 3I05A 4RORA 3RI3A 5JYDA 4ZODA 3F5QA 3H4VA 4DCJA 4ND3A 4HQRA 1I3MA 1QE5A 4E7OA 4I4IA 4RPKA 2HQ1A 3A6GA 3QLEA 2ZGVA 5A2GA 4MVJA 3T5CA 1PQYA 4PTZA 2VJMA 5K8CA 1ZJ4A 3UAYA 3HSSA 2IHYA 4WQMA 2XMQA 4RK1A 1N6KA 4G5HA 4LK2A 5EWLB 3NBXX 4LZZA 5DM0A 4OB8A 2YIMA 4LBZA 2CZQA 3EUWA 1ZM9A 4GMXA 4KQJA 2H08A 1YKGA 4J49A 2OO3A 4YJFB 2W6ID 3WLFA 1XNGA 3RO7A 4NESA 1LBSA 4ER5A 3NTQA 3DNFA 1A9XA 5FNVF 4KXLA 4ZI7B 1QH8A 1E4VA 1G2QA 1C3OB 1ORHA 4ALJA 2FX5A 3PR1A 1K8ZB 1YB5A 1QIGA 4V0RA 2QRJA 4Z86A 3FSGA 4MRVA 4OHVA 3G23A 1OIVA 4DGQA 1WIWA 3NHZA 4EHNA 4YT4A 1O54A 4IDHA 5DX8A 5K8JB 1BJRE 3FVQA 1X42A 3S0JA 2R8PA 5CFMA 4OAQA 1CNEA 1KYTA 1SCUB 4QTXA 2HOQA 3OZSA 2JNWA 3TKAA 1WUKS 1ZSYA 1B00A 2WJVA 4HYEA 4ESHA 1N2GA 5COQA 2WVGA 4FR0A 1R4MA 3SP1A 3A8TA 3LBHA 5A6SB 4QVKA 1PWEA 4TSRA 3VR3D 2AFIB 1H0RA 4Q1CA 5BWCA 3OTOB 3A2MA 5KNDH 2E3JA 3LQQA 3K9GA 4Z9XA 4RK5A 3RSLA 4QYTA 1TW2A 2J3DA 3LLVA 2AEEA 4V2IA 4PR0A 5ALOA 5BSRA 5T57A 3TLMA 2L0XA 4O2AA 4XVCA 1XD2B 2ERYA 1UK6A 2QY6A 3OC6A 5AW5A 4S05A 4ZIRA 1R3DA 3BEDA 4B76A 3D4BA 1HFEL 4FYWA 4PNZA 7REQB 3N0TA 4R3WA 3W5SA 2VF7A 3NBAA 5E6SB 1MX9A 2VR1A 4P82A 1VKZA 4OA8A 4WJKB 1HLDA 2YIDA 4Y1EA 3R40A 2HWYA 4X41A 2D2XA 3HXLA 2PAAA 1EB8A 1RZVA 2F8SA 2ZRDA 3C4VA 2O0JA 4INOA 2C3PA 4HB0A 4Z0PA 1JFTA 3BRCA 3KPVA 1U7WA 3L49A 1S2DA 4X6LA 4YRRA 1P5RA 3V7NA 3FOFC 1ORVA 2DF8A 3BF8A 1SIUA 1NBME 2BMVA 1BMDA 2QRNA 2QX6A 2XJ4A 4LJLA 4PR3A 4TSFD 4U7WA 5GQSA 3AVXA 2O5EA 1FMTA 4QBFA 3VVLA 3SBOA 3OIDA 5KHLB 2PUAA 4XOIA 1GEGA 2HZ7A 3U4AA 2XWQA 1X14A 1QO0D 3EG9B 3L1UA 4A8TA 3ZDAA 1FQJA 1QIMA 1YDWA 2BKUA 3NHYA 5I6DA 1EQAA 1DGQA 4N47A 2F1KA 5COBA 3WL8A 2E87A 3H9GA 4RABA 1JIVA 4X60A 3WKEA 3GFTA 2GJ4A 4HZGA 4QICA 3VOTA 2ERCA 3QG1A 2ZZNA 3UXMA 4IOKA 1OFIA 2CXQA 1M1YA 3AFIA 4P3OA 4TLBA 4CMIB 1ESDA 4Y2YA 4QVIA 4DV6B 1W6UA 1VRWA 5BXQC 2PEYA 5KYVA 1L5QA 3EH2A 5SY4A 3CT6A 2X8JB 3VGPA 5D3ZA 4E15A 4GNRA 1C0KA 1R0RE 3AESA 3SKYA 1FRVA 4M1EA 2VAWA 3C3EA 1SZDA 1L8LA 1TIBA 2ZAGA 3HWRA 5DOZA 2RHBA 5F77A 5KKNB 2HFKA 2VJOA 4MS4A 5T67A 1U2ZA 2CNLA 2AOUB 1M2JA 4UPEA 1XTVA 4EWLA 1CUDA 2YW2A 2YWCA 3ZV3A 2CL5A 3GT7A 4OQLA 4U2CA 1QIKA 4RZSA 5DGHA 2X1LA 4TV9B 4IO0A 4H35A 1Y5MA 3TRDA 5JZ9A 4C78A 4U0JA 3BWBA 4UHKA 1KO8A 4V1CA 1PR1A 1BZYA 1PJZA 3D3QA 3ECAA 3H97A 5G1OA 3BTVA 2LIPA 4G9EA 4IO1A 1FLNA 1NKTA 2VDLB 4YJHA 1MDFA 3FIJA 3CCCA 3DE3X 3ICPA 5JPIA 4CBVA 4E03A 5L3SA 1HEUA 4L5JA 5D5PA 5FJJA 3K09A 4Q4AA 4U2DA 1M2KA 2G9NA 2GGSA 4N12A 4ZQFA 2MJLA 3A1UA 3QE9Y 3U4HA 3N8DA 2M1XA 4KSBA 1L1EA 1GFIA 2OAQ1 2ZSDA 3VYTB 1FXWF 2ODTX 3CG0A 2QN9A 3I2FA 4EJ2A 5CGZA 2FPIA 3D0RA 1NM5C 2ZSBA 4PSKA 3UOGA 2O57A 3WLNA 2OZEA 1WEHA 1M1NA 1R0BA 2PSHA 2G9UA 4BOYA 4DCSA 4IINA 4ER6A 5A5GA 4HJRA 1FS5A 1WF6A 4MUFA 2D4HA 2F3UA 2HK8A 3DB1A 3GFGA 2VDWA 4AYXA 1HQYE 5EINA 2VDVE 1VKOA 1CTQA 4V0NA 3SFTA 5CDHA 1ZUHA 2FMIA 4FBGA 1WDMA 4OXKA 4EMSA 4ZO9A 5BUQA 2UDPA 2R66A 5MN6A 1XZJA 1ZK1A 2HBYA 3PV0A 3UGKA 1ZOPA 1G16A 2QMUA 2XUOA 3MWKA 5IK2D 2SCUA 3K9NA 3OVMA 3OZCA 4FQ8A 2BCJQ 3UXYA 1GUYA 2B5VA 4P22A 2F3PA 4TWAA 3ZU2A 4RKWA 1A4IA 1F0PA 1Z5WA 5BN5A 1Z2OX 3SBEA 3AFNA 1UC5B 3KSRA 4LOLA 4MITA 1Z5VA 3NKLA 4Z4GA 4BNMA 5EG5A 4RZUA 3A6ZA 1RAEA 2JGDA 3TZEA 1F4VA 3ZE9A 1XG5A 2NU6B 4TZ0A 4TQUS 3KK0A 3NTXA 3EY4A 3DS8A 4RDIA 1NNEA 3S8YA 3PUJA 3KUDA 3MF4A 5HQJA 3U49A 2PU5A 3OY2A 4CYMA 2QTRA 3BCRA 3ODGA 1PJLA 5ANRB 4E5UA 4NCBA 1XZFA 4RZXA 3HY4A 4I5EA 2X58A 2BFFB 2PKWA 3CEPB 3HKEA 4GWLA 3RFTA 2PUJA 4L5BA 1JLHA 3UHOA 2HSJA 4GX2A 3F7NA 4ZO6A 4LTDA 3SX4A 5HA5A 2GTPA 3E22B 2IF2A 2QGNA 4F56A 3VR0A 2LE0A 3HLTA 4N0EA 5SV2A 1H42A 1G4UR 1L7MA 1SHZA 3RSOA 1NJSA 2QMYA 2W8BB 3RVJA 1GZ3A 4N0DA 4N39A 3WLLA 1OXKB 3W05A 1QNLA 3C45A 4BNJA 1NI4A 2B82A 2OL4A 4CR7A 4JC5A 3T95A 2I1LA 3WNDA 4H0NA 1VA5A 1QF7A 3ZI0A 4UTNA 1RP1A 2V9CA 1W34A 1SVKA 1ADBA 4Q4JA 4QQFA 4UULA 4IIUA 2COKA 3R5JA 3H75A 4O2BB 1E6CA 4KE8A 1E6WA 1L7AA 1NJ8A 1QAQA 3LHKA 4K1LA 5KSPA 1F2UA 1AZLA 1L1RA 4ZEXA 4OGLA 4C7VA 2X14A 3E7PA 2ZIXB 1ZUWA 3P52A 4JN6B 3DMRA 2WWVD 3T9FA 2P6MA 4ZYTA 2Y92A 4S2EA 5GWXA 3ZU5A 1T35A 2I76A 1VLMA 2FETA 5KJEA 2ECFA 2GD0A 2KJQA 2YV5A 3BULA 1E9VA 2IITA 3O2JA 5D3MB 4ZDWA 4EGSA 4QDTA 1G7RA 5FBRB 5FR2A 2A67A 2HU7A 2PRKA 2WU8A 2XWJI 5GZ6A 3THOA 1P4HA 1T8WA 1GGKA 3PHCA 2AKYA 4DLUA 3IV6A 1NUAA 2EU8A 3LYAA 3O7WA 5COAA 5LYJF 3EWSA 3FNIA 3H2BA 1ISHA 4FMCB 2HHJA 4OQYA 4Y2UA 2HQRA 2Q3HA 3MIZA 1BH2A 4BCDA 4CKBB 3WLKX 1O2DA 3PQEA 2AFIE 4JOBA 3T3EA 1OU0A 3EDYA 1N2EA 2CUZA 3L8DA 5ER6A 1ORTA 4HRAA 4WTOA 1CFZA 3G2KA 2FQXA 4BLQA 1CQPA 4B3BA 4BRZA 1LPPA 2GKOA 2XDAA 1D2EA 2BFWA 4O5OA 2J4FA 3PUKA 3KPWA 3AEUB 3U19A 4DCUA 2XTNA 1UZUA 3IPRA 1ZD2P 2I6FA 3JQAD 2NUAB 4CR8A 4D80A 1PV1A