4FIZA

Crystal structure of the binary complex between a fungal 17beta-hydroxysteroid dehydrogenase (apo form) and coumestrol
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
260
structure length
260
Chain Sequence
b'YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17beta-hydroxysteroid dehydrogenase
molecule tags Oxidoreductase/oxidoreductase inhibitor
source organism Cochliobolus lunatus
publication title Crystallographic studies on the flavonoid inhibition of a fungal 17beta-hydroxysteroid dehydrogenase
rcsb
total genus 109
structure length 260
sequence length 260
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fizA00
1LRJA 4R9RA 1M66A 4PLPA 1CETA 3RFVA 3FNEA 5TRTA 1DRUA 4M49A 4BVAA 1XDWA 4NIMA 2BFAA 5I9MA 3ZW8A 1GV0A 4DBVO 4XEHA 3VH2A 4PLZA 4AJEA 1LNQA 1NFRA 3WGIA 3ETDA 4I9NA 1HKUA 2DPGA 3HZZA 5ENVA 4R54A 2CNBA 1DIRA 1NAHA 3RFXA 4CM8A 2D4AA 2PH5A 2JHGA 2W98A 3VVCA 3L77A 2VZ0A 3B1KA 4ILKA 4MP3A 4CV2A 4NH4A 1XYGA 1T2CA 3ONEA 3DDNA 3CUKA 4RF3A 4TVOA 4LRSB 2WMDA 3PFWO 1JU9A 1ZZEA 5JPIA 4DRYA 4RCVA 4B4WA 4DLAA 3CTMA 3DL2A 5U4QA 5L7WA 3JD2A 3EVTA 1KC1A 3NAQA 1PTJA 1H5QA 2E6UX 5JCJA 4EUHA 2JHFA 1R4NA 2QHXA 2X6TA 1I30A 1YDWA 3EMKA 3CH6A 2HRBA 4F6LA 4FR5A 1PWZA 4FC7A 4LMRA 4L4SA 5MGBA 2R6JA 4RVHA 3BXXA 5A5FA 2UAGA 3AFNA 1BVUA 3GH3A 4B4VA 3RCBA 4BO0A 2E82A 3JQFC 4EW6A 5KVCA 5FI3A 4B8ZA 3IAHA 3ZV4A 2BMAA 2VRCD 1Y81A 5FI5A 4RPKA 1ZIDA 1LDYA 2GSDA 4BNGA 4YQYA 1LLCA 4XQEA 1AXGA 2JD1A 1EVJA 4CL3A 4RQTA 3M1LA 4C4OA 3JYQA 1I32A 3V2HA 2AQIA 2D5AA 1B15A 1GPJA 4B79A 3KTDA 3FNGA 4HY3A 4BNFA 3HNPA 1E7WA 1PQWA 2ZQYA 5I9LA 1Y8QB 5CDUA 3ZWCA 1QSGA 3ICPA 3UOGA 3IIEA 5A06A 2Q2VA 1KEUA 4Z3KA 4HFJA 4E30A 2CF6A 5COQA 5KJ6A 2FY8A 4Y8VA 3ZWVA 1G0NA 1OC2A 3WYCA 3GEMA 3LT0A 3GF4A 4B4OA 4BV8A 5ER6A 5AXCA 4HFRA 1ADFA 1R0KA 1XU7A 4E31A 1LSUA 3GOHA 3DTYA 4BO3A 3TFOA 2Q45A 2OHXA 1CQJA 2BGLA 2C29D 3RC9A 1PGPA 2OP0A 3FI9A 3RQSA 2X22A 2NTVA 3WYEA 1DLJA 4PLCA 5ILGA 1CYDA 4R69A 1DFGA 2BRUA 5JCXA 2O3RA 2PGDA 2VN8A 3CKYA 3L07A 1F0YA 2YDXA 1M6HA 3GLQA 5JMWA 3ASVA 1H2HA 3HJAA 1YB1A 1X7DA 5IAAA 4TWRA 5FF9A 3DZFA 3HSKA 2PGLA 3DAFA 4XYEA 5BSGA 4D0SA 1HZJA 1A71A 1QYCA 4AJLA 2EV9A 1JLLA 1I2BA 4J1NA 4JGBA 4J7XA 3UCEA 2QZ9A 3AJRA 4FFLA 3UW3A 1EVIA 5KVQA 1XGKA 2A35A 2I3GA 4XA8A 3GAZA 3PYXA 1V0JA 4XQGA 5IDWA 2JKVA 3DBLA 3JQ8A 1UXKA 3H8VA 1ONOA 4ONEA 3RWBA 1KS9A 4ZJUA 5L51A 3PXXA 4HBGA 3TOXA 3I4FA 1M2WA 1PZEA 1R0LA 2B5WA 2B4TO 1QV7A 2UUPA 1YL6A 4MO2A 1DFHA 4HX5A 4GI2A 1PS0A 1N1EA 1YWGO 4ZVVA 2Z1NA 4L8VA 1E6WA 2B0JA 1JTVA 3S2IA 5GZ6A 3VPFA 3GVHA 3W4IA 4BO4A 1KEVA 1IE3A 1HDOA 1LQUA 3T7EA 3GZ4A 2C59A 4FW8A 1CF2O 3JYLA 2Q2WA 4CQMD 3E9QA 1GD1O 4RVFA 1GYPA 4PZDA 3BIOA 1N8KA 3EGOA 1ISGA 4QT0A 2HMTA 3KOUA 2C5AA 1N92A 2W2LD 4UEJA 4KUEA 4TRNA 3CE6A 1I36A 1RM5A 2IXBA 4CM4A 4O6VA 4MIOA 4PLVA 2P4HX 2GCGA 3BA1A 3R1IA 5ICSA 1WW8A 5A4DA 1V3TA 4IBOA 1UAYA 2JFHA 4R1SA 1GAEO 1U3VA 4FQ8A 4YTEA 4K6FA 3QWFA 2CDBA 2BKAA 5CP8A 5AYVA 3KYDB 3U4IA 3VVBA 3DOJA 2JL1A 4R68A 3K73O 2FPIA 1RKXA 3AI3A 1B7GO 1PZGA 3INRA 5HWSA 1ZCJA 4OXNA 2YQ4A 3RC1A 2QX7A 4AJHA 4RV9A 2WDZA 3D1LA 1R12A 1RM0A 3PWSA 2DQ4A 4ZQEA 1IY8A 5CHEA 1JWAB 4CM8B 4YYZA 3HFGA 3QLJA 5EJ2A 3LF1A 4MVJA 3ZU4A 1SAYA 1HZZA 2QRKA 5KIAA 3WICA 3WSWA 1DFIA 1IUKA 3PFFA 4BKRA 5JAIA 1PQUA 2YZ7A 4KTVE 3E8XA 4OIMA 1PQPA 1CERA 3BMOA 2A9FA 1HDGO 3SXPA 3OIGA 4AJIA 3WLEA 1E3IA 1N7HA 3V1UA 4M55A 1PU2A 4XKJA 4JP2A 3PJFA 3VPHA 1HWYA 2G0TA 5DBGA 4BKOA 1T4BA 2ZQZA 5A9RA 3X2FA 1E5LA 1LI4A 5EMHA 3TZCA 4CLRB 5F1PA 3IP1A 1EZ4A 1ULUA 2EKQA 3ZGYA 5KJFA 2X9NA 3Q9UA 1ZEMA 1OAAA 2I5PO 4IIUA 3RU9A 1BW9A 1U2DA 2WM3A 5CG2A 4W7IA 4BNIA 3L4BA 1C0IA 3AY7A 4YR9A 4CQLA 4IXTA 1VKOA 2B37A 3JYNA 4WE3A 4A7PA 2J5KA 1GR0A 3H9UA 2QYSA 1N9GA 3GHHA 1ZXBA 2GD1O 2ZTVA 3F4BA 1Z82A 4P38A 3MJSA 3UUWA 5CEJA 3E82A 4CMKA 3BMCA 4BO9A 3OJEA 2ZYGA 3R0IA 2H6EA 1J0XO 4FJ0A 3DBVO 4LN1A 4MVJH 3PJEA 4WUVA 1XWFA 3RVDA 1SOWA 2PKQP 3VHRA 3RUDA 1P1KA 4UEOA 5GMOA 4D3SA 4XGKA 3AFMA 5T64A 4RDIA 2EGHA 2PKQO 3WFIA 1OBFO 3NGXA 5HBRA 4FS3A 4DLLA 3D4PA 3AU9A 1DIGA 4B7XA 2E4AA 2P5YA 1JKJA 1JWBB 1D4FA 1LLUA 1XSEA 1KY4A 2Q1SA 4YJHA 4E21A 1O9BA 1PL8A 2CF5A 4IJKA 2GYYA 1PZFA 2ZK7A 4Q3NA 4WEOA 2R2GA 8LDHA 3SC6A 5KJCA 1YRLA 2P9EA 2NU7A 5IDXA 1QYWA 3BMQB 3IMFA 1OC4A 1U1IA 1XU9A 3D4NA 3WBFA 4FPXA 1WXDA 4ZQBA 1P0CA 2G82A 3FR7A 1J49A 2O50A 5TQVA 3FTPA 4YJHB 4AJPA 3AUSA 1NWHA 1G1AA 4CMIB 4J4BA 1A9YA 4DQXA 3RKRA 1EFLA 3E5MA 5CAEA 3ULKA 4BQRA 1C1DA 2CY0A 4D3FA 6ADHA 1PX0A 4E6PA 2JCYA 1A7KA 1HEUA 3PDJA 3ONDA 4U8GA 3F6YA 1Y9AA 5BSHA 2HLPA 2Q4BA 1H2BA 4FN4A 3QVSA 2BFPA 1LRLA 3QHAA 3QIVA 5ITVA 3JYOA 1O5IA 2EP7A 2NACA 4IDFA 3W8FA 5DBFA 4MVJF 3PHIA 3MCVA 4Y6PA 4CM5A 4MJLA 3FNHA 2NSDA 1VC2A 1ENOA 4BNLA 4MIYA 2Y1EA 1GL3A 3QWIA 3ZWAA 3K5PA 4RORA 1HYEA 3IJRA 2ZKLA 1V35A 3M2TA 2JFGA 2W4QA 4OSPA 1IPEA 4DC0A 2O3SA 4AJ1A 2OUIA 4YT5A 3L6OO 3O8QA 3G0OA 1M75A 5COAA 5I8ZA 4EDFA 4YAGA 5KCZA 4NZ9A 4PCVA 3WNQA 5TT0A 3PGJA 1E1KA 3A06A 4A2CA 2Q3EA 1EUDA 3BMQA 4FFRA 3VAZA 3ZW9A 1QYDA 2RIRA 1JW9B 3PRJA 3I83A 3C8MA 4NJMA 1Z75A 3IUPA 5JLAA 5AXAA 4KZPA 1GQ2A 3JQGB 4CV0A 7MDHA 1C14A 3W6UA 1DXYA 1LDMA 1R15A 4YXFA 4GWKA 3OSUA 3NTOA 2PZLA 3A1NA 2OFPA 3ZWYA 4CV3A 5CPFA 5G0WA 3ROKA 3GVPA 4E2YA 2B4RO 4IXWA 4PLYA 2E37A 1FDSA 1SEVA 2AEJA 3P2OA 4F46A 4NFYA 3ZHYA 2DTEA 5G4KA 4P8RA 1PEDA 3RKUA 3VDRA 3NUGA 4F3YA 3H6KA 4CLEA 4ZHSA 4DXHA 4RPJA 5F1KA 2ZATA 1LXCA 1NXQA 3ASUA 1MXHA 4JP3A 4U0KA 4A10A 3EY4A 2W90A 2HO5A 3OICA 3ZH2A 3VKVA 4YT2A 1E3JA 3H5RA 4NU5A 1IZ0A 4Z0PA 4YT4A 5A3JA 3U4HA 3JQDA 1W0CA 4UREA 2YHIB 4ZD6A 2JFFA 1LC0A 3BTSA 3VPGA 1N7GA 1UXJA 2Y1FA 3A9WA 2J3KA 2EKPA 3AM3A 1QMGA 2O2SA 3MJTA 3EUWA 3MEQA 5I7EA 5A9SA 1ENZA 1HE2A 2GF2A 4Z9XA 1H6AA 1UZLA 5ITWA 3NDRA 5EIOA 4P4NA 4JK3A 4DA9A 1NR7A 3TF5A 3RUEA 4QO8A 1P1RA 4CQLB 3VH4A 5BR7A 3PGXA 4N18A 4YJGA 1YOVB 2NTJA 1EQUA 1V3VA 3OM9A 4CL8A 5K6AC 3DZBA 3DFUA 1LX6A 2DKNA 4I5DA 3WGZA 2NU9A 1ENYA 5EQDA 3QA9A 5H82A 1E6UA 4CJXA 2QW8A 4JN6B 1I0ZA 1WPQA 4A73A 5JCJD 1J6UA 1QLJA 3ITDA 5A03A 2DPHA 1E7QA 4Q3AA 4YJFB 2IE0A 1U9JA 3JQ7B 2GDZA 1ONPA 4BV9A 4GGPA 4D0RA 1M67A 2I67A 3PQFA 5DDIP 5L9AA 1YBMA 1D3AA 3FNFA 4Q9NA 3V1YA 1BXGB 3B70A 5A3VA 1MC5A 4Q39A 2CDAA 3GFGA 4L76A 4R3WA 2NQ8A 3Q0EA 2D3TA 1P0FA 2FSVA 2O2YA 3I9OA 3OHSX 3PYMA 3ZWBA 2DUUA 2HK7A 3MTJA 3S2EA 1T2DA 2ZTUA 3U62A 3H2ZA 3CINA 3PYLA 3CPSA 4LCJA 4L9RA 1U3TA 4WLFA 3BMNA 3I52A 5K6AA 4YRDA 4ZRNA 3EVNA 2H63A 4L4RA 9LDTA 2NNLD 4BNMA 3NJ8A 3BHJA 2NWQA 2D5CA 3V2UA 1R6DA 2Q4EA 2YFHA 2EEZA 4M89A 3KXDA 1RYEA 4RVUA 5I8WA 3ETGA 1ADCA 1T24A 4QO7A 4AICA 3WBBA 1O0SA 4MVJE 3GVIA 2DAPA 3DXFA 1ZJZA 4IUYA 1DHTA 3DZIA 4U6SA 4YJGB 2PD4A 4CODB 5I7FA 1E6EA 4YRAA 1HRDA 1GFSA 2OOSA 5JAZA 2I6TA 1Y7TA 3FPCA 3WX0A 3ZU5A 3IJPA 2VOJA 5G0SA 5DF1A 3COSA 1V9LA 3DEYX 2IDZA 4P4LA 3JQFA 4PZCA 4L4XA 4MOWA 3QWAA 2C2YA 1BGVA 3D3WB 3JQAA 4H15A 2B36A 1DRWA 1NQ5A 1AUPA 4IDGA 4RVGA 1DC3A 2FPPA 4PG8A 5JXWA 2JAPA 1X7GA 2PK3A 4NR0A 3SJ7A 3JQBA 3JQCA 4HP8A 4BGEA 1X7HA 3M1AA 3QVTA 4LVCA 4R9SA 1AHHA 1C1XB 3O9ZA 5JDCA 1IHXA 4LCEA 2IEDA 2VHWA 1C1XA 1Y6JA 4NQZA 5LDGA 1JN0A 2V6FA 1IZ9A 3FWNA 1P3DA 4QEDA 3UCFA 5EN4A 4P4GA 2Y67A 5C7LO 1CDOA 2GLXA 1LBEA 2NVBA 2VTEA 1EE2A 1ZBQA 2IRWA 2VT3A 3QY9A 1NFFA 2DC1A 1U2GA 1E7YA 1LU9A 1ZXLA 4OXKA 2NVWA 3K92A 3RBXA 4JX8A 3ON5A 4HWKA 3I9JA 3HHPA 1QP8A 1FXSA 4IZHA 3ZWNA 3ICCA 5I7VA 2X5JO 2VWHA 4MVJI 5COBA 1Z7BA 5G4LA 5JO0A 5DN9A 4CR8A 4K6CA 2CZCA 2P2SA 4GPD1 4IIVA 5BQFA 1I2CA 1JKIA 4C7KA 3V2GA 3H2SA 3U49A 1U8XX 3JQGA 4CQMA 1D8AA 1Y5RA 3UN1A 5L4LA 4J2OA 4K26A 1DIAA 2OO5A 1XKQA 3PIDA 4TKMA 2ZB7A 4EBFA 1XLTA 3WIEA 4AJOA 3SBOA 1EFKA 4XZ3A 3PQEA 4WGGA 3GNTA 1XA0A 1DHRA 1DEHA 2W2LA 3JQ9C 4BGIA 5JDCC 4E13A 1R66A 1QORA 1B3BA 1E7SA 1HSZA 3ADOA 3WQSB 4D46A 4YWJA 2VUUA 3SEFA 3WTBA 3WFJA 4YT8A 1BXKA 1B2LA 1XR3A 4E33A 4YAEA 1ONNA 4NFHA 3VPSA 4ND4A 1YH3A 1YL5A 3MJCA 3UKOA 2V65A 4CUKA 5IZ4A 1SBYA 3SLKA 4NBVA 2FWMX 3W4JA 1I10A 4INAA 2GN6A 4XGIA 4WLEA 3C7CB 3QVWA 3K2EA 2NU8A 4N7RA 3AOEA 1NWCA 1TB4A 4BB6A 1FJHA 1VJ0A 4IMPA 2NTNA 2HKIA 1NAIA 3VZSA 3ZWXA 1K0UA 1F8GA 1LUAA 3IS3A 2I76A 5KWEA 1UH5A 4R1NA 3PI7A 3TZKA 1H9AA 4FIZA 3IL2A 4DC1A 1E3SA 3DMYA 4EZBA 5LCXA 3G79A 3ETEA 4JXKA 4MINA 2DFDA 1FDVA 3G49A 4JROA 1T2FA 3JD0A 4DYVA 5TIIA 4FFMA 3UCXA 4D3DA 4NBUA 5KJEA 1QXSA 2F1KA 4IS2A 1KVRA 1E77A 1O6ZA 4H16A 3JQ6A 1U5CA 1MUUA 4UULA 3KSUA 5LDHA 4NPCA 2BHLA 2WSBA 2BFMA 2HJRA 1ZVMA 3OEWA 4OL9A 1GUYA 3OF2A 3VC7A 4CMHA 5JYDA 2BGMA 5TLSA 2PWZA 3HN2A 1KYQA 5G0TA 1HLDA 5LC1A 5JS6A 1PJSA 4O59O 5L7YA 2C2XA 2JD2A 5TJHA 2DLDA 1QRRA 4YBZA 4B3IA 1LEHA 3CZMA 4LVUA 1XIVA 2GGSA 5DCWA 5IDQA 2Y1OA 3UF0A 1LQTA 1NPTO 1I8TA 3WGOA 4B8WA 3G1UA 4TRMA 2GZ2A 2RHRA 2AA3A 5TGDA 4D7AA 4E4YA 4AJNA 1IULA 3B20A 5FYDA 2V6MA 5B4TA 4AJ2A 4PVCA 3QQPA 4M86A 1BDMA 4BKPA 2NUAA 2FPGA 3W1VA 5L4NA 4Q3CA 1EE9A 2R00A 2B83A 5DNAA 3LC1O 4PG4A 4MKRA 2HQ1A 1X15A 5JNLA 1UDBA 1TT7A 5KVSA 3WOHA 5HA5A 3GRKA 5B12A 1C0LA 5CDGA 4GX1A 2OBYA 2X7HA 1YKFA 2Y1GA 3KYBA 1H94A 4CLRA 1DC6A 2PTGA 3S2GA 2PY6A 3H9GA 1ZK3A 2UUOA 1A7AA 5KKAA 1EVZA 1JKFA 2XXJA 5TX7A 3FD8A 3GDFA 1NPDA 4DPKA 3CIFA 3JQ7A 4S3MA 4XDZA 4YVFA 5HRUA 5TSDA 3EZYA 3KVOA 4IDEA 4IJVA 4NI5A 1F17A 3S2FA 4R3NA 5HTOA 3E18A 3LT2A 3BAZA 5KNLA 4ND5A 1H6BA 3N58A 3C7DB 5EL0A 4E2XA 2Y05A 2POQX 2FZWA 3OA2A 1PJ2A 4M8SA 1ZSNA 1WNTA 1FF9A 3JQBC 1EVYA 4GVXA 1BTOA 4QECA 1BMDA 1MA0A 1H9BA 2VHVA 1Q7CA 1BVRA 2VNSA 3C1TA 4CQMB 1VL8A 3AI1A 3PLRA 1PGOA 3O38A 2ZYDA 1UDCA 5T8KA 4RJTA 4W6ZA 4N5MA 5C7IO 1GADO 2HK9A 2NV6A 2WYUA 4DQUA 4URFA 3CMCO 4WOJA 3WTCA 1ISIA 3U4DA 4EJ0A 3NX4A 1EEHA 3DQPA 2EIHA 5HS6A 1IPFA 1ZW1A 2LDBA 1DRVA 3ADPA 2X5OA 4PLTA 4BO5A 2CDCA 1A72A 3RI3A 1HE5A 3F1LA 4R1UA 1ID1A 2IYPA 4LSMA 1QLHA 1R4NB 5L95A 5G4KB 3I9MA 4LISA 1B14A 2Y1CA 4KDEA 4Z3DA 1T25A 4Y67A 1DOHA 2P4QA 4OO3A 1ENPA 3FHLA 4Q3DA 1PR3A 5DT9A 2NQTA 2YDYA 5K9ZA 1I3NA 4WOKA 4QQRA 4XGNA 3GNSA 1U4OA 2WD7B 3PEFA 3LLSA 1X14A 2I65A 2D1YA 3GC6A 4MIEA 3V8BA 3VTFA 4A26A 1DIHA 1YE3A 1P1IA 4EUEA 3DMTA 3W4KA 1WWKA 3FN4A 4K1LA 4OMUA 1VRWA 1CEQA 1ISHA 4GKBA 4H3VA 3KLPX 3GUCA 4J91A 2Y1DA 3I4CA 1BWSA 4XIYA 4XYGA 3IUSA 1MV8A 4KDFA 3MTGA 1XCBA 2EJWA 3GFBA 5T8KC 1C0KA 4DQVA 4TRRA 4CLOA 4KTTE 2B4QA 4D42A 3BTVA 4XYBA 3JTMA 1PGNA 1LDEA 2Q1TA 5DCYA 4C7JA 4NBWA 4CM1A 5TF4A 3W6ZA 3U5TA 3WGHA 1Q0QA 1SMKA 3MWEB 4J4HA 4OH1A 3P19A 1WZIA 3T7CA 1YL7A 1I2ZA 4J1SA 3E48A 5B1YA 2O3TA 2XOXA 3ONFA 4I5FA 1FDWA 5BSFA 3EHEA 1SEPA 1SPXA 1NR1A 3KV3O 2ZIZA 2IODA 1NVMB 3N74A 4YCAA 3DBLB 3JQ8B 1F12A 3TN7A 4GKVA 1P1FA 1ULSA 1HYHA 1T2EA 2IXAA 4TSKA 3GGPA 1DPGA 3WMWA 3I6QA 3LYLA 4FB5A 3DBRA 1YB4A 3FR8A 1C0PA 3H4VA 3HB5X 3AUTA 2HDHA 1MB4A 3GT0A 1MLDA 4R51A 3RIHA 4TROA 4O5OA 3UHAA 1DAOA 3A28A 3GY0A 3OBBA 2AXQA 2HJSA 3PZRA 3C7AA 4KWIA 2GZ3A 1GZ3A 1AE1A 3NDIA 2FZEA 3TL2A 1MXFA 1W8DA 3STHA 4E2WA 3FPLA 5I7SA 1N2SA 4IDDA 4CMJA 4UUOA 5JW6A 2J5RA 3KRTA 1ISFA 3ANNA 4A5OA 1LJ8A 4Q3EA 4CV1A 4KUHA 3ROQA 3PHJA 1F14A 2GASA 3PLNA 3EZLA 3QVOA 1T4DA 4U0JA 2OZPA 4J1QA 4NK5A 1L1FA 4R16A 2Y0CA 1Q1NA 2P9CA 2DU8A 4E5YA 1A4IA 2PLAA 4ALIA 4KMSA 1HDCA 2O3UA 1HF3A 1ZK1A 4WEQA 1HDYA 3KM0A 4BHTA 4D45A 4MKZA 1TT5A 1LSOA 4JJIA 3ZN2A 4CLHA 1BHSA 3LVFO 4IGFA 2B35A 3TRIA 3ITKA 3DO5A 4GSKA 4E5NA 3RUFA 3OIFA 3KSDO 5BSEA 3D3WA 4RVSA 1VM6A 4NDNE 1D1TA 2G1UA 1K3TA 1HE4A 2C20A 1H0KA 3RUAA 4B7UA 3AOGA 3PJDA 4PVDA 4WNCA 1TXGA 2YJZA 3F5SA 2AQKA 1ZNQO 3K8ZA 4YJDA 3LQFA 3MJ4A 3CXRA 3NKLA 4FJ1A 3W8DA 2BELA 3FWZA 3WQQA 2O7QA 4R5HA 3ZNNA 3WGTA 1WMBA 2DFVA 3DBHB 5ER9A 4M1QA 4IPTA 2DTDA 2PKRA 3F1KA 1BG6A 4ZQHA 1SZJG 3NEPX 2C07A 5CDYA 2VWQA 5J23A 3EDMA 3ZI0A 3G17A 2Q2QA 3AOEC 3E03A 4PLGA 1ORRA 1G6KA 4HNGA 1I33A 1NASA 2OL4A 4I1IA 2EG9A 3VZPA 3E6AA 4FCCA 3MWDB 3NJ4A 3OJLA 1UUFA 2TMGA 4HUJA 2RH8A 2PH3A 4I9HA 5TNXA 4Y9DA 1U3UA 1ZUD1 3GGOA 3GA0A 3ZHZA 2ZTLA 1Z74A 4RLHA 2LDXA 3IP3A 3WXBA 4PRKA 5IFLA 1P77A 1RM3A 5JY1A 5MDHA 1PR9A 4W82A 4LW8A 2VWPA 2H5LA 3OIDA 2QRLA 1E3EA 1LRKA 4PG6A 1B8VA 3TL3A 1XQ6A 4PN3A 1LA2A 3LK7A 3QWBA 3UXYA 1M6WA 4RF4A 3PTZA 5BT9A 4JNKA 1BXZA 4BO8A 3GNQA 4R41A 2DBVO 2EERA 2D59A 4DPMA 3CSDA 3UFXA 3WNVA 1X1EA 3DMTC 1RWBA 3GDOA 1HLPA 1PGJA 2I9PA 2O4CA 1WDMA 2QIOA 2D0IA 3ORFA 4DMMA 3I9NA 1K6JA 1KBZA 5B4UA 4UEKA 3JYPA 3AI2A 5TS3A 2RAFA 1P1HA 3GK3A 3WR5A 3LDHA 2O3QA 2WYVA 4DL9A 1NBOA 4J6FA 3I9LA 4J9UE 4DMLA 5A9SB 5A02A 1PJTA 4AJ4A 3DHNA 3MOIA 2FOIA 1WMAA 3ZDFA 4MVJP 1B26A 2Q49A 3H9EO 1R16A 4IZIA 3DOCA 4ND2A 4ND3A 1T1SA 4OM8A 1FDUA 2PZKA 3IC5A 3IOYA 1NNUA 1HE3A 3GGGA 3WMXA 4R1TA 1CIVA 3QWHA 2QG4A 1K6XA 3PP8A 5F5LA 4XQ9A 1NYTA 4CLXA 1Z6ZA 3B1JA 4RPGA 4YA6A 4GBJA 3ZNQA 2UVDA 1EK6A 2HMSA 3ZWPA 1UR5A 3WS7A 1Y5MA 1YGYA 4BS9A 1VL0A 1C3VA 4UAGA 1A27A 4I5EA 2YYYA 3E5RA 2RBEA 3AY3A 3QE3A 3DFZA 1DJQA 1K5HA 3Q1LA 1YQDA 5JFOA 1HDRA 4ZA2A 4XQCA 1EK5A 2ZTMA 5F3RA 2CFCA 4YJFA 4J9VA 1W73A 2PZMA 1E1NA 2GERA 4CUJA 2QQ5A 2VUSA 4EGFA 4W7HA 1V3UA 2DBZA 5K0ZA 3RC2A 3RUCA 3DTTA 2PNFA 1I01A 2IZ0A 5AOVA 2FSSA 2Q1UA 3DC2A 3L4BC 4OHUA 2EHDA 5JSFA 5CFZA 2E48A 3OJ0A 2CSUA 4XYLA 2YV3A 3NTQA 1E0DA 2V6BA 4G65A 2JJYA 2DBRA 3VPXA 5KTKA 2GN9A 2FMUA 4Z0TA 3I9KA 1YONA 4YAJA 2YUTA 5KVVA 3DBHA 1X0XA 2Z95A 4PRLA 4B3HA 3AUAA 3OP4A 2AG5A 3TZHA 5JAMA 2OP1A 4ALNA 3WQRA 2WJPA 4TVBA 4IS3A 5I9NA 4BO6A 1GQQA 2C54A 1YQXA 4FGWA 2VHYA 1TVEA 2PA3A 3KEQA 1OZAA 1X1TA 3PDUA 4UVGA 1E3LA 1N5DA 4WCFB 4J0FA 1UZMA 2SCUA 4BNUA 1DDOA 2P91A 4EEXA 4L73A 5L40A 3D0OA 2P68A 3GEGA 1BSVA 2PFGA 2C7GA 1PGQA 1JVBA 2HMVA 4A27A 4Y6RA 4YB8A 2RHCA 1I3LA 2EF1A 5JO9A 2AHRA 1KOLA 3ZU3A 1GU7A 2XF8A 2FR1A 3FSRA 1BW9B 4E3ZA 2YV2A 1GYRA 3AM5A 1U5AA 1Z73A 4NMHA 2NLOA 5F1OA 1HTBA 3E9MA 1SCUA 4CMBA 3A4VA 3LLVA 4DLBA 4FOOA 1QYXA 2JAHA 5U9CA 3PWKA 3WIDA 3U3XA 3WYBA 5IN4A 4OKIA 1UZNA 3D5TA 3HN7A 4J3FA 3ZV3A 5G2OA 3JSAA 4PFJA 4JLWA 4NHEA 4XRGA 3MOGA 1E5QA 2ZJ1A 3KSZO 3M6IA 1J4AA 3PZBA 1JAXA 1Y9EA 4J1TA 1HXHA 1FMCA 5CDTA 1AN9A 3DWFA 4YRBA 1MFPA 2R00C 4KUGA 2HRZA 5ADHA 6LDHA 2CD9A 3TQHA 1BXGA 3OFSA 1H6DA 1LLDA 3BTUA 4BNXA 1SC6A 3P7MA 1B8PA 4TRJA 3JQAD 3OQ1A 3K31A 4RL6A 4GX2A 4E32A 2VYND 2JCVA 4EITA 2V7PA 5ENDA 2W2KB 4J7CA 1YXMA 2XAAA 2OXIA 3G1TA 4N5LA 1PS8A 1N1GA 3K2BA 1M76A 3HQ4O 2VT2A 1GEEA 1U28A 1KVUA 5G0VA 2UV8A 2C82A 4BGVA 3F46A 1IB6A 3GRPA 3QV1A 4FFPA 2GPTA 3BHIA 4RQUA 5F21A 2NVUB 1DLIA 2Y0DA 3LU1A 4FSHA 1VPDA 2YHUA 2GN8A 4OKNA 3OQ6A 4LGVA 2HUNA 4I08A 5A05A 4OSOA 5C37A 1P33A 1DBVO 1LTHR 1WAMA 5GZ1A 1GTMA 3BYZA 1N9GB 3DZGA 2X23A 1R37A 3WG9A 4NNJA 4RDHA 3ZV6A 4JBIA 1NX6A 2OORA 1BRMA 1QV6A 2WD7A 4BNJA 3Q3CA 4ALLA 4TQGA 1Y8RA 4WLOA 1YQGA 1SB8A 1ZSVA 4WKGA 3UICA 2FHSA 1KETA 3IDSA 5DBIA 1KEWA 2EJVA 1YB5A 4G5HA 3QRWA 2JD0A 4RF5A 3JQAB 1OFGA 4DWVA 4BO1A 1KVSA 4XYMA 2C0CA 4IDBA 4LRTB 2D2IA 3GVCA 1Q0HA 3ABIA 1VSUA 3GDGA 1GQYA 2HSDA 5B4VA 4JBGA 1O89A 2O3JA 3RAJA 3KEOA 1HDZA 3ZWWA 1B16A 4QFDA 1O8CA 2VUTA 2Y93A 3OMLA 4ZRMA 2BF7A 3BMNB 1SO8A 3FBGA 3GVXA 1R4MA 4NJMB 4TZKA 3AW9A 4UUMA 3RBVA 3ZHBA 2BI8A 4EUFA 3HDQA 4Q3BA 1P45A 2X5KO 4B7CA 3S1LA 3X2EA 4BNWA 1XHLA 2Y66A 1Y8RB 2X4GA 4GVLA 4D43A 5GY7A 3PK0A 2C7VA 1BDBA 2AE2A 4E2ZA 2HAEA 4NBRA 3KETA 3K30A 4Y98A 4FFOA 1B8UA 4XRRA 3NDJA 2NADA 4CLDA 2G17A 5DP2A 3ROMA 4PGFA 4DPLA 2VQ3A 2XPCA 4XB2A 1EUZA 2ZB3A 3FTNA 1ZEJA 4MKXA 5T5QA 3GEDA 5T6BA 3VTZA 3C3XA 4XDYA 3I1JA 2O23A 3CEAA 5HS4A 1EQ2A 2GN4A 3C1OA 3CMMA 4W9NC 4Y6SA 3EC7A 4ESOA 7ADHA 1ZH8A 4FDAA 5FWNA 4LMPA 1UXHA 4Z0HO 2VYNA 2BH9A 4ZQFA 4KQXA 3WSVA 1G0OA 1O95A 1H6CA 3OECA 1W6UA 2B5VA 4BNNA 1LLQA 5JBIA 4WCFA 5TJ9A 4Z9FA 3OETA 5CEFA 1SNYA 2BFOA 4I9UA 3O8QB 2EP5A 4G2NA 2O48X 1H93A 2CMDA 2OBNA 3B1FA 4UVDA 2B69A 5T67A 5ES3A 2ET6A 4IM7A 4BIIA 3V1TC 1E3WB 3S55A 4NK4A 1GDHA 1YVEI 4YAKA 2AEFA 3GG2A 2YQ5A 4FC6A 4II3A 1TI7A 4BKUA 3O26A 3OEYA 1RYDA 3NT2A 4IJWA 4CMEA 4DBZA 1HDXA 2VYVD 3H5AA 5G0UA 5IXYA 4LSWA 5JYEA 2GNAA 1B0AA 3EW7A 2QZZA 3NGLA 4JBHA 1D1SA 5BNFA 2Q50A 4E12A 4BNTA 1IL0A 4FBGA 3KYCB 4HKTA 2GZ1A 3UGKA 4BUCA 3U9LA 4DIFA 1PL7A 1JDJA 1CRWG 4P22A 1XEAA 1ZK2A 1YS4A 2I3AA 1WLYA 2C5EA 3LZ6A 4QTZA 4U5QA 3ANMA 4XJSA 4YDRA 1ZMOA 5ICMA 5L7TA 3JD1A 4WECA 4YACA 1I24A 1CQIA 5DP1A 2Z5LA 3Q9NA 3B6ZA 3EAGA 2BD0A 5DULA 4CM4B 4RPLA 4YAIA 4DUPA 1QR6A 2GRAA 4YEDA 1EDOA 4XX0A 1GCUA 3IQDB 5CG1A 5GZ3A 1NQAO 3MJVA 1IHYA 2Y99A 4GSLA 1DB3A 2Q46A 1P1JA 2VZ8A 1DC5A 4XR4A 3TOZA 3GHYA 2O7SA 2WE8A 1TLTA 4WLNA 1Y8QA 3MJEA 3OJOA 3TJRA 3DOOA 5H81A 3TFQA 4D79A 2FR0A 2XXBA 3WGYA 5JAQA 3NYWA 5IG2A 2RCYA 1KVQA 4OAQA 3TDKA 4BO7A 3U09A 1LDBA 2DTXA 2VYVA 3GQVA 4MP6A 1IOLA 5IJZA 5C3MA 3HE3A 4DTIA 1OMOA 1VE9A 5IN5A 3F47A 3ZV5A 1UJMA 3BMCB 4BGUA 1P31A 4N54A 2VCYA 1ZO8A 1NQTA 4UUNA 3TZ6A 2YHIA 3FBTA 2AW5A 1QKIA 4FJ2A 2X1HA 2J3IA 5A5EA 4J2HA 8ADHA 5JY6A 1PIWA 1PS9A 2TMDA 5JDIA 2ZCUA 1DO8A 1R0SA 4U7WA 2WTBA 5IDYA 1GUZA 2W8ZA 4JQCA 3QW2A 4AFNA 3N7UA 2X8LA 2WWRA 1U8FO 4CMGA 4CMEC 3JV7A 2HMWA 3P5SA 4NFSA 1PL6A 2CVZA 3KBOA 1NQOA 1WZEA 3H9QA 1DAPA 2Z1MA 3TWOA 2VHXA 1D7OA 3PVZA 3TPCA 2CVQA 1ZMTA 1GYQA 4BNKA 2JCXA 4ZGWA 1RJWA 3Q6IA 4W4TA 3ZWOA 2I66A 4GL4A 1UXIA 4CMCA 1ZK4A 1P44A 4WCFC 5EESA 2WEKA 5THQA 4RPHA 5DZSA 3AY6A 2J6IA 5CEEA 2P5UA 4F45A 1ZKMA 5IF3A 3D7LA 3BTOA 4MVJD 4HXYA 2FN7A 5A04A 4PG5A 5A1TA 4BQPA 5HM8A 3GMDA 1QYVA 4G81A 4EI2A 1Y1PA 4BOYA 4R4JA 4YPOA 1VI2A 4WASA 1I3KA 3PQDA 1U7HA 5H83A 3WLFA 1W4ZA 1XQ1A 4TZTA 1OOEA 2UYYA 1VL6A 1ZSYA 4CUZA 3RJ5A 4WJZA 2Y0EA 4WNIA 4CM3A 5L3ZA 3ENKA 5IZCC 1E1LA 4ZQGA 1QG6A 2IZZA 5FFFA 3RBZA 1WP4A 1LSSA 3SC4A 3DB2A 4RZIA 4E0BA 4CM7A 3HDHA 1KERA 1RM4A 5U1PA 4B3JA 3QP9A 3PPIA 1EBUA 1C1DB 4A0SA 1PJBA 4UVIA 5AVOA 1DJNA 3WWYA 2QYTA 3GPIA 1FDTA 4GWGA 5EINA 1S7CA 4CM9D 2O4UX 3KO8A 4FOSA 2A92A 2QRJA 3OH8A 3ZNPA 5CPBA 3L9XA 4PLHA 1Z45A 1T26A 4OJNA 4L75A 4EJ6A 1GEGA 3VH1A 3GUYA 3DHEA 4F6CA 1YBAA 3WJ7A 2DT5A 3AWDA 2YFQA 5L53A 1GPDG 4BL5A 3R3JA 2HU2A 2X58A 3IKTA 3NTRA 4PG7A 4RZHA 2A94A 3SLGA 3BMOB 2H9IA 1VJ1A 3HDJA 4R01A 3DONA 1MX3A 1AGNA 4H7PA 4IQ0A 4E5PA 4EYEA 2PD6A 3DHYA 3SX2A 1EDZA 3AM4A 5KOIA 5L45A 4GMGA 4DIBA 4AVYA 1PJLA 3PJGA 3S8MA 4ALJA 3ZCXA 1MFZA 1UP6A 3QSGA 2ILTA 3L4SO 1B3RA 2G5CA 2UDPA 1LDGA 1NPYA 3CZRA 5L4SA 4RF2A 3F3SA 3PHGA 1YOVA 1VKNA 2WYWA 4IGEA 3A14A 1IYZA 2V6GA 4XJTA 1T1RA 4J0EA 3KYCA 4GMFA 2VRBA 2WE7A 4I5GA 4DYDA 4BMSA 2EWMA 1YJQA 1DC4A 5AXBA 3OA0A 2PGJA 1F06A 4PLWA 4FD3A 1DIBA 3R6DA 3F9IA 4CLOB 2RH4A 4EJMA 2PZJA 3ZWMA 4HV4A 1XELA 1JA9A 2EGGA 1MP0A 4X54A 1OI7A 2FR8A 5JC1A 3NT5A 3RROA 2BI7A 2GO1A 2FP4A 1AHIA 3UAGA 3GAFA 3FCOA 3GR6A 4W99A 3OJFA 3OQBA 1PJQA 2G76A 2IEBA 3RC7A 2A4KA 2YV1A 5JE8A 4OOFA 4UVEA 3V5NA 3PHHA 4ITUA 1VSVA 1YBVA 4GQAA 3DAGA 3W8EA 4LK3A 4WLUA 3TSCA 3P2YA 5CDSA 3RFTA 3KB6A 3HB4X 4CR6A 3TNLA 4U6QA 2X86A 1UXGA 4BNVA 3I5MA 2AG8A 4OYRA 1I3MA 3KZVA 4MDHA 1U7TA 1ISJA 2ZCVA 3C85A 1R4MB 4TMFA 1NP3A 3O4RA 4BNYA 4B4UA 2YY7A 3WWZA 1E7RA 1LC3A 2ZB8A 3UH1A 3D64A 3D3EA 3WB9A 5JC8A 4IMRA 4WLVA 4BNZA 1KY5A 1V6AA 4KQWA 3ZNOA 1K6IA 3EYWA 1RPNA 1KC3A 3VZRA 3AUUA 3QVXA 3R3SA 5TT1A 3Q2IA 3DZKA 5AXDA 3H7AA 3VH3A 1NM5A 4OXYA 3VKUA 3DBRB 2J8ZA 5THKA 4DVJA 3ANLA 4K28A 3I6IA 3GZNA 3RUIA 4CMIA 1NFQA 1T2AA 2W2KA 2J3JA 4HFMA 4WCDA 4KOAA 2EW2A 3ENNA 1YDEA 3GN1A 4HADA 2BGKA 3BHMA 5BNIA 1ZJYA 3PHLA 4ZU3A 4A03A 4XR9A 1TA4A 5KKCA 1LSJA 2AE1A 4XWYA 3ZHXA 4J7UA 2NVUA 4ID9A 2GUGA 5ILOA 2P9GA 1I5RA 1HT0A 1ZFNA 1UDAA 2EW8A 4L0QA 1Q7GA 4UUPA 3ZU2A 3VZQA 4BKQA 4J49A 3WGGA 1SB9A 4E5MA 3INGA 2X0NA 4FGSA 1WDLA 2VNAA 1UP7A 4J16A 3T4EA 1JVSA 1WDKA 4ALMA 4PZEA 1MG5A 4JCOA 2D8AA 3ROPA 3KUXA 1CWUA 3Q2KA 4CR7A 3HADA 1TT5B 3JQEA 3NRCA 3RUHA 1GCOA 4KWHA 3L6EA 1F8FA 2AQ8A 4EEZA 5EERA 1NTOA 2X0JA 3I23A 4XIJA 3NT4A 4IJUA 5TC4A 4RLSA 1CJCA 4NJOA 1PWXA 2OMEA 4O63O 5DOVA 4AL4A 4I8XA 4MP8A 4II2A 1GZ4A 2NU6A 3JD4A 3ZZNA 1X0VA 3GN2A 3INTA 1XG5A 4BMNA 2PD3A 3RU7A 1NVTA 2BLLA 1K89A 2J5QA 2HCTA 3AK4A 1SOVA 4GH5A 1VJTA 3D5QA 2ZYAA 3UVEA 4TKLA 1J5PA 1MC4A 3FF4A 3KLMX 1ADGA 2PR2A 2ZJ0A 1ML3A 3HWRA 3SVTA 3BZUA 1A4UA 3GG9A 4ALKA 5BNTA 1GZ6A 3U0BA 2VWGA 2HMUA 4RVDA 3G3EA 1VLLA 3E1KA 2X0RA 3HFSA 4IDCA 2PV7A 3WJAA 4ND1A 2J3HA 3LF2A 1HL3A 3LT4A 3RD5A 1U3WA 4RGBA 2CUKA 4K9DA 4D44A 4L74A 2VOEA 1GV1A 3PWZA 1E1MA 4UVHA 1PJCA 4MPDA 3WGQA 4E5KA 1A5ZA 1EMDA 1Q2XA 1FK8A 4QSMA 1KVTA 4MVJM 1LDNA 3VDQA 2IYOA 9LDBA 4IY1A 1O94A 1PSDA 3JQ9A 2Q99A 2HK8A 3D4OA 5DCUA 4DREA 4GX0A 4W9NA 4NG5A 3RSHA 2IZ1A 3DZHA 1WVGA 3H5NA 4GLOA 1L7EA 3GMSA 1MG0A 4QFCA 3K96A 3LC2O 4ROSA 4AJKA 3PIIA 5F5NA 1UP4A 1UAGA 4IQGA 3WDSA 1HETA 4AG3A 1KIFA 1S6YA 2F00A 3Q11A 2DBQA 4YQZA 1E3WA 2X9GA 4RO0A 1NHGA 1JAYA 2VTDA 4PLFA 5C7OO 5JDIC 1MGOA 1PJ3A 3KHUA 3M2PA 1EUCA 3QJ5A 1GUFA 3L9WA 3TZQA 4CM9A 2Y68A 4GX5A 5AQ1A 2DM6A 4D41A 3DAPA 4KP7A 4N5NA 5JMPA 3SJUA 4CPDA 4WK6A 4OGWA 4J4TA 5FEUA 2I99A 1ARZA 2DVMA 1KEPA 5B37A 4J90A 4NBTA 5DOZA 1NHWA 4O0LA 3AU8A 2E49A 4GLLA 1YJ8A 2ZB4A 1E7MA 1Q7BA 2OGUA 3JD3A 4BB5A 4OOEA 3RASA 5T57A 3H3JA 1PZHA 4CMAA 1L7DA 4XB1A 4M87A 4S1VA 3HDYA 3H3FA 4MVJG 2X9VA 4JIGA 3DZJA 3O03A 3C1AA 3H65A 4CM6A 3IKVA 3L0DA 4IQ8A 4M54A 3EK2A 4OQYA 4JJGA 1GY8A 2EKLA 3GZNB 1YO6A 3LC7O 3HG7A 4DIOA 1P74A 5EQFA 3I3OA 2AQHA 4HFNA 4PIVA 2VRCA 1DSSG 3F4LA 3VOSA 3LSYA 4BNHA 5IZCA 3NV9A 4J43A 1ADBA 1AXEA 1Z7EA 2AMFA 5EPOA 1X13A 1A9ZA 4OQZA 2H1SA 1NVGA 3HUDA 4GAEA 4ZN6A 4WPGA 3JCZA 4QX6A 3K9QO 2DUWA 2WD8A 3RJ9A 5IXSA 2AEMA 3GPDG 2NM0A 4BO2A 1PJ4A 1ISMA 1E92A 2EXXA 4NU6A 4XCVA 5A9TA 4ZICA 3KYDA 4IINA 4BMVA 1EBFA 3FRJA 2GR9A 4IDAA 3E9NA 4Z6KA 4HNHA 3U4CA 1K2WA 3K6JA 4DGSA 3T4XA 2VZ9A 1P9LA 3MZ0A 4GGOA 2X0IA 5C5IA 1V8BA 2VHZA 1HYGA 4XD2A 5KJ1A 4O1MA 1ZK0A 1Q0LA 3C24A 3L6DA 3ST7A 1HSOA 4QUKA 2CVOA 4Z9YA 1JQBA 4FFNA 3H9JA 2FRDA 4JJFA 4QXMA 3DR3A 4AJJA 4R5MA 2YW9A 3F5QA 2Q1WA 1TEHA 1U4SA 3LT1A
chains in the Genus database with same CATH superfamily
2EKDA 1J8MF 3ZIAA 1EJ6A 2QEQA 4R9RA 1M66A 4PLPA 1CETA 1TC2A 1D04A 3FNEA 4MRRA 4UNQA 3RFVA 4BVAA 1XDWA 2AG0A 3DOFA 2RKOA 2W6IA 3T1OA 1EFAA 3FA2A 3I53A 2FPGB 4WADA 3M6WA 1O8BA 2FPRA 2GO7A 3W0LB 2GNOA 4G8CA 3CJRA 3NUZA 4J07A 4CIDA 3K16A 4DIEA 1YJBA 4XLZA 4MPPA 2PT5A 4WWHA 2DPGA 3PQ4A 1N6KA 5ENVA 4IEIA 2G70A 3E05A 5YASA 3UTCA 3WNBA 3OBIA 1NAHA 3RU3A 4C1BA 1NUHA 2OZKA 4DWOA 3VVCA 1KDPA 3TTSA 2R96A 3B1KA 3M1IA 2ENWA 3QBTA 1KSFX 1L5VA 4ILKA 4NYMR 4MP3A 4DJDC 2HR1A 1QX4A 1PD1A 1Q57A 1ACLA 3ONEA 3CUKA 2F9MA 2M98A 1YASA 1B43A 3QVLA 4TXNA 3ZUGA 2HI0A 1JJIA 3EVGA 3MTEA 1KAOA 5FBKA 1KU6A 1JU9A 4TTSA 2R25B 3M9LA 2ZULA 4RCVA 4B4WA 2GN0A 4JLSA 1S7GA 4KR9A 1OYYA 4DSAA 1M0SA 5CW2A 5L7WA 3SR0A 4YP0A 1IMJA 3NAQA 1KC1A 2BEWA 3C97A 1A96A 4EUHA 1Q6ZA 4BAGA 4WBNA 1SHUX 2X6TA 2LTAA 1Z5UA 2V4ZA 4G2TA 4LE2A 1QU2A 2GYWA 1KOFA 1YI0A 2YMPA 1ZR4A 3M83A 2HCBA 2FVXA 3WB1A 4LJ5A 1XZNA 2HRBA 3FDZB 4MW6A 3SKYA 1UAAA 2OVFA 4XM0A 2R6JA 4LNUA 4ZK6A 2GARA 1BVUA 1JLRA 3FB1A 4B4VA 3DOHA 3M6VA 4G8JA 4QXOA 3R7FA 2DECA 3CU5A 1N6LA 2R85A 2ZKIA 2D2FA 3IVCA 4JJ6A 2VDVE 3JAMA 1MH9A 3ZV4A 2BMAA 2BPOA 1C9DB 3L7CA 4QJBA 1F6WA 3LY8A 3GLGB 1EUYA 1G1MA 2I54A 2UZ0A 1JR3E 3L93A 4W5OA 1Z4PX 4PQRA 1M1YE 3DTVA 3OF5A 2JD1A 4HGRA 3J7AC 4AY2A 1XQYA 4I6JA 5FEMA 4RKWA 3JYQA 3REQB 2FEWB 1TQ6A 4S1OA 3V2HA 1QNLA 2XMBA 3R74A 1ESDA 1AA6A 2AQIA 5C8XA 2VLBA 4EECA 1TAHA 1GPBA 3VU3A 4CEJA 1B15A 1JP7A 1TM4E 3O2QB 1RWWA 2X4IA 4B79A 2WHPB 4BMPB 3FCSB 4Q7MB 3W5HA 1C2TA 1SVNA 4LC9A 3HNPA 3WMGA 3TGLA 3RYCA 1JQAA 4BN0A 4UBLA 4CHTA 1G5RA 5CDUA 5D86A 3ZWCA 4P7GA 1JG3A 4PLFA 1KEUA 1HT1E 3L7JA 4LC1A 5COQA 5ERGB 4UUAA 3R0XA 3LT0A 4HO1X 4B4OA 4IKEA 4TOIA 1Y3CE 1RHKA 2BHRA 5I9TA 1I6LA 1RDFA 1NW8A 1SRQA 4CFZA 4G5QA 4BFTA 2AD5A 4GZ3A 2QZPA 3GOHA 1MPXA 1OGYA 3DTYA 4AIRA 1Z28A 4BO3A 2D0OB 3IQFA 4ND6A 3VOBA 4CTJA 2JJ8A 3E7XA 2AR7A 3MXTA 4HN2A 1VYUA 2NTVA 5BT8A 4GQIA 3S8YA 5CXXA 2GZDA 4PLCA 1CYDA 4WUTA 2REQA 2PGDA 2QVZX 2I55A 4UJ5A 1MOPA 1DKNA 3HJAA 5IKXA 2G88A 5BWBA 3HSKA 1SBZA 3DAFA 4GOLD 3TQCA 3HDGA 3I2YX 4AJLA 3NXSA 1V43A 5D2CA 2J87A 3UMGA 2RGNA 1JSRA 3UWDA 3UW3A 1EVIA 2FSHA 2DQSA 3QOFA 2A35A 3FCYA 3GAZA 2HB6A 1ZN8A 1DKUA 2G8LA 1NXVA 3JZFA 2B6NA 5IDWA 4PO1A 1JF8A 3E23A 3K3PA 3ZGXA 2NXWA 1X1DA 1TD1A 3H8VA 2H8GA 2LD4A 3OTWA 1W8IA 1E89A 2W8BA 3RIEA 1E2HA 4TPKA 5DLEA 1EIZA 1KS9A 3H9BA 3IHWA 4MS1A 5BR8B 1OH6A 4ZV9A 3RE1A 5TPWB 1M2WA 1PZEA 4BVFA 4YCCA 4Y2HA 1E2GA 1TMOA 1L3CA 2J5BA 4N5DA 2UUPA 3WXMA 1IMOA 2HPVA 1PS0A 1YWGO 2IHTA 2YNMA 4YN3A 4FKMA 4F2HA 1GG2A 2SKCA 5T4EA 3AEUA 1FOEB 4YUYA 5HRCA 1BS9A 2O57A 3OIVA 5CX1B 1JTVA 1TF5A 3NBXX 1KI7A 1EZ1A 3S2IA 8OHMA 3VPFA 1WBJB 5SZIA 3KQLA 2WU4A 2QNBA 2XW6A 3E9CA 4RADA 4BO4A 4G25A 1BWQA 1IE3A 4YUZA 4K6GA 3T7EA 3VKWA 2ZJ6A 5BNZA 3SYLA 1U6KA 5IEBA 1Y8AA 4RVFA 4TL7A 2PM8A 4YV2A 4GR4A 1SD5A 2OTCA 2ROQA 4PZDA 1NTRA 5J58A 1NT4A 3KQPA 2XCQA 3NVAA 3A2MA 3EGOA 4LXTA 3YASA 4MKHA 2RGBA 2XT9A 3VISA 4QUHA 4J0HA 5FV7A 1RAFA 5K0CA 1KJQA 2C5AA 2HH9A 4ER5A 1KP2A 5BR4A 2W2LD 2NXCA 4CF6A 1PFVA 1G8FA 2X41A 5K4GA 3PEWA 4MIOA 1PJZA 3SSOA 1NVAA 4IDNA 1YV9A 2ZT6A 5CA1F 2Z8YM 3S2YA 1UAYA 5GOZA 1XDGA 2JFHA 1AKNA 1HOTA 2NYUA 2QLLA 3QFCA 4D9HA 2C78A 1U3VA 4FQ8A 1YZYA 2YMLA 3M5CA 3OPYI 4R40A 4YTEA 4OHZA 3EEFA 2CDBA 2X40A 3QWFA 4RKRA 4XFJA 4WKOA 1J2JA 4OQMA 2AZMA 2JGKA 2ZWOA 1T5SA 4HLDA 2FPIA 4G1CA 3KLNA 4MW4A 3TQQA 2WNIA 3FTCA 1YQQA 3INRA 4OGKA 4CCSA 2ZJ3A 1ZI8A 3G2MA 1OA1A 2PEYA 3I1IA 3TVDA 1FTWA 4AJHA 3HHEA 5IJ0A 4KH0A 4YAFA 3D1LA 1DCKA 1E1QA 3NHRA 2Q3BA 4UKDA 4WOCA 3UAYA 1D2EA 4BMYA 1GIAA 1XBTA 2ONYA 4FFDA 2OHGA 1N5JA 2PCJA 2VDUE 2BHNA 4IYJA 5F51A 2H9AA 1IN6A 3LGSA 4X71A 5CK5A 2WOJA 1V7PC 4D3ZA 3K05A 4A92A 3COPA 2FN3A 3NIWA 3G0IA 3KQSA 3LF1A 1SAYA 4QRIA 5KIAA 2OB2A 2ZAYA 2QAJA 1DFIA 1IUKA 5CURA 4BKRA 2J9FB 3TQOA 1N2ZA 2IEAA 1PQUA 1T9CA 2J7PD 3LQRA 2IU4A 2XMDA 3GELA 3OD1A 3MLEA 3WL6A 1Y4ZA 1D4OA 3BMOA 2X3UA 1YTUA 4FHFA 5K2MA 5EHGA 3OMXA 1W1UA 1A8QA 5AK5A 2ZI9A 2XDWA 4LHEA 5CRIA 4E7PA 2W0SA 3ABQB 5LB4A 5KHOC 3LTNC 3BDIA 1PU2A 5DM1A 1TLFA 3PICA 1D2HA 1GZVA 1XDBA 5CJPA 2ZQZA 3AHJA 3L5OA 1G9TA 4HAVA 4YLEA 4DLUA 5TF0A 3HPQA 1ZG3A 3HUEA 5F1PA 3X2FA 5LMZA 3LRTA 1ZCFA 2ZUTA 2BJHA 1NJGA 1AF7A 1QFYA 1ZEMA 1YUMA 2VAXA 4IIUA 5G40A 3RU9A 3HNOA 3H8SA 3PNSA 2C2GA 3DV2A 4BVBA 1E9CA 3GMIA 2EC5A 5JFGA 4ZDIA 3ED1A 4YR9A 4GE0A 5E1OA 3AVTA 2GT1A 5FNVF 4F38A 4FZRA 3JYNA 2B37A 5EGSA 2COUA 2UZ1A 2J5KA 2FFQA 3WL5A 4A7PA 3PBKA 3IB3A 2YNMD 1ZXBA 3F4BA 3UUWA 1EH5A 1BMQA 3MJSA 5BWOA 1LTKA 5TMDA 4F04A 4ER3A 3E82A 3BWBA 4HDMA 2OAGA 4E46A 3NM4A 1MEJA 3LTEA 3W6NA 3R0JA 4LRYA 1M6VA 4JT8A 4S12A 3GZTB 5I6DA 1FXUA 2RSLA 1J0XO 3BIFA 3KU4A 4D4HA 4MVJH 5C1PA 2WJ3A 4V38A 4D4KA 2CXNA 3NHKA 3BXEA 3T06B 1GVHA 1B74A 3A6FA 4YRSA 1JDVA 2PKQP 2W6QA 4QHYA 5K0NA 1SKMA 4Z4EA 2EKBA 4GOXA 2X15A 4D3SA 4DOMA 3NB0A 1L7NA 2ENUA 3H04A 5DSXA 1P7YA 3PUJA 1F8UA 3L7NA 2HXSA 1CZUA 5F5XA 1HNNA 1DIGA 3QVJA 2FXVA 3M34A 3GFPA 1UMCB 1ST3A 1JIQA 4YJHA 4BE4A 2F1OA 3PQ8A 3NHPA 2CF5A 1WTCA 3O4GA 5B7QA 1CD5A 2R1TB 2WHYA 1LB1B 3SC6A 3P9YA 2CEAA 5ALKA 4QGFA 2Q62A 4ZU6X 5IAEA 4YRIA 3ORQA 1AUOA 1D2CA 1L1QA 1QYWA 3AFOA 2D5BA 3BMQB 3FYTA 4QQ8A 5AVJA 1BWPA 3DXZA 3IUNA 4M0FA 1MR3F 1E59A 5CBPB 5DKFA 3W5JA 4IG9A 2FWAA 5FIUA 1P0CA 1DKQA 5JI2E 2E3JA 4MV6A 5EFOA 1S02A 4MV5A 4OJKA 4X20A 3VU1A 4Q7QA 5KNCD 3P52A 2I2WA 4YJHB 3AUSA 5IM4F 1A4XA 4EB3A 2JIZA 1M1YA 4CMIB 4J4BA 4DQXA 3E5MA 1JL3A 3OPNA 3ULKA 4BQRA 4KAXA 4D3FA 3VR5H 1UDWA 2ON6A 4O4HF 4ZCLA 2JCYA 4HN9A 1A7KA 3CLUD 3KPVA 1PT6A 3PDJA 5BSHA 3F6YA 1OROA 1Y9AA 2HLPA 2JCGA 2BI4A 3DE6X 3LYHA 4JLVA 3QVSA 2BFPA 6CHYA 2X4DA 3QHAA 3QIVA 1FLDA 1R50A 3JYOA 4FWIB 2YWDA 2ODEA 3FVRA 3WGMA 5LIRA 2R60A 1RXUA 3W8FA 2PNJA 1G2IA 1XTJA 3EXFA 3PE6A 3PL5A 2B2XA 3PPWA 3FNHA 3WK5A 2NSDA 1VC2A 1ENOA 3HCBA 3UATA 5CA1A 1X3LA 4D9BA 1VPLA 2V7TA 3AKYA 2JJ1A 2ERCA 4AI6A 2YCLA 3ZWAA 4BWGA 1BHQ1 1NVVQ 4RORA 1HYEA 5CVCA 2CBGA 5J3JA 1V35A 4DC0A 2W4QA 4HVAA 1OHHD 4R98A 2O3SA 4Y1GA 4ESHA 4YT5A 1XDUA 3FHCB 3BHNA 5TGTA 3DLAA 3G0OA 5KCZA 5FBLB 3W79A 3L7BA 3PNQA 2GCOB 1J0CA 4MIKA 4DMRA 1E1KA 3A06A 3ZW9A 1EUDA 5MN5A 5JNVA 2BBWA 3LUJA 2FZVA 4QEKA 2R8YA 3KZNA 2GRJA 3K0KA 1JW9B 1EIWA 3WYDA 3I83A 3PPVA 3IUPA 4QUJA 5AXAA 4X97A 1ONSA 4KZPA 5LQCA 2I1QA 2J32A 1C14A 5DRYA 1IUOA 5E4TA 1TTPB 4TM7A 3O8LA 2I7TA 3VNVA 3NTOA 4X41A 1W0KA 3A1NA 3DT9A 3RTGA 3MT8A 2OFPA 3H13A 4B2LA 5I01A 5G0WA 5JQGF 5EJ4A 3DV0A 1GA1A 2X7XA 5AQEA 2DGDA 4E2YA 4EG3A 2BGGA 4AP6A 1C5KA 3AVUA 3FUWA 1FDSA 3IULA 7REQA 1SEVA 3P2OA 1G60A 2XOKD 1OH7A 1E4EB 2V6JA 1FLAA 1N4DA 1PEDA 3G7UA 4D8WA 3KT6A 1M34B 1FPMA 4F3YA 3V1KA 4D57A 4LK2A 3L79A 2Q07A 1DWOA 2RHJA 2UZAA 2PO7A 3FFAA 1CIJA 3GFRA 1T5DX 2DQZA 2WKWA 1T2VA 5KQLA 5BUZA 5BRAA 1UM8A 2OLJA 2ZS8A 4ZAZA 1O0BA 1P4RA 4JP3A 1J8VA 4HQRA 1SG9A 3EY4A 3MWGA 4U0KA 5EKSA 5JBNA 4LI0A 3ZH2A 3VKVA 3K4PA 3H0CA 3AB3A 2ANCA 4OLAA 3EG9A 2W6ID 4WXEA 2Y1LA 4YT4A 1U2TA 2ZVPX 3FWKA 4NZZA 2AXEA 1PDOA 1P5JA 4X9XA 1MF7A 2PQ6A 4ML3A 5EIEA 3BTSA 3CGWA 3BWVA 1UKYA 3CR7A 2GYUA 5KX5A 3A9WA 4YRKA 3UBTA 3S4YA 1T35A 4GC9A 1U9ZA 4L0CA 3V48A 2DMRA 1T9ZA 2OZVA 3EUWA 3RYTC 2BMVA 3LUDA 1NMXA 2R47A 4DSUA 2WB2A 1L3IA 3QMMA 5BOVA 1OZHA 3U7QB 3BKXA 3DE4X 1H6AA 1UZLA 4HWGA 3MCTA 3NDRA 4ZI3A 2FCRA 1MX1A 3EOZA 4E5DA 4P4NA 1CUWA 3G8AA 4HSGA 2CGEA 2NG1A 3VC3A 1XLTC 4QO8A 1P1RA 4B6OA 4LF5B 3ISVA 3OUUA 4KKXB 3L0IB 5K0FA 4QNMA 1Z18A 1YOVB 4GZ5A 1EQUA 2NTJA 1V3VA 3VSEA 5K6AC 3D7RA 1KMQA 2PX0A 5H82A 4V3CA 1U7PA 5JOQA 5GWXA 4CJXA 1TUEA 4JN6B 2QM7A 4YCDA 4ZKEA 4A73A 5HKAA 3COJA 2ZBPA 1XN1A 4LG1A 1L4UA 1WTAA 1VQ1A 2ECKA 3H5VA 4HLQB 4PIMA 5BSRA 1Z2AA 4MW0A 3TCXB 4B75A 5BPFA 5BW8A 1VMAA 4NEQA 2GDZA 2I67A 4ROTA 2AC4A 3U17A 3GRCA 1Z06A 4DDHA 3TNFA 5LMNB 1JDPA 1D3AA 1H69A 3OT5A 3ZS9A 3FNFA 2H8KA 4IP0A 1F20A 1OI4A 2RGDA 4FT2A 3B70A 5MFPA 1C4XA 2ZYSA 3PL1A 3B2QA 3COYA 3GFGA 4Q39A 4YP5A 5AJYA 5T41A 1G9XA 1FVHA 1L5SA 3VO1A 1P0FA 1GO2A 4KGZA 3BD7A 1ZIPA 3IAXA 1W0JD 5E7QA 2NUPB 4Q00A 3S2EA 3WV5A 2A0XA 3P45A 1HNWB 3HJGA 2QSZA 4P4UA 4EY7A 3HRHA 3T3PB 3CPSA 4C21A 5AVXA 4YHBA 1PV1A 2ZE8A 4BWVA 1QANA 1U3TA 3AJAA 5EJFA 4HDSA 4OPMA 2IYAA 3VH3A 4EW2A 4YRDA 1O6BA 2Q2OA 3EVNA 2H63A 1MORA 4HAOA 3D5EA 4I81A 5CX4A 3ZQJA 1YFJA 1XDDA 2KLHA 3QX7A 3AEQA 2WR8A 4TYNA 1N5KA 2NWQA 3W04A 3WZ2A 3LLUA 1R6DA 3UENA 3V33A 2ZI3A 2R86A 1N2EA 5EZ5A 2O59A 3ETGA 1ADCA 1XMPA 3C4JA 1DKMA 2LIPA 3C15C 3VU0A 4QO7A 3TEMA 4AICA 4M46A 1KYVA 4MWOA 3H0KA 1CQWA 1CUGA 5B55A 2DAPA 3SDBA 4R1PA 4IUYA 4K88A 1ZOSA 3QELA 4LJ4A 4RMJA 1DHTA 3UXMA 3WVNA 1L5FA 3L7DA 2JRLA 1E6MA 1J0AA 5JHGB 4LF6B 1JKJB 1FS6A 1F9EA 1RJ9A 2ZIAA 2RGUA 3K9LA 3N5CA 3OCYA 4PC1A 1JJBA 1H3NA 4TXHA 4U63A 4US0R 3X1JA 5ITZA 2ZRNA 4M4SA 1C7ZA 2VOJA 4BUJA 2WHRA 3WQBA 1F4LA 1V9LA 1HDEA 3NETA 5NULA 1MT0A 4I5IA 4WBSA 3JQFA 3UB2A 1KK2A 3BH6A 1OFVA 2RGNC 4NMXB 4PZCA 3TXXA 3ZE7A 4UTNA 3PX2A 1BGVA 4GPIB 1OFUA 1SUFA 2OESA 4RK0A 1Z7YA 2BMEA 4NBKA 4CIYA 1UMDB 1FBNA 2GVDC 1XCLA 2ZWMA 3D6JA 1QBGA 4UJ3A 1JFFB 3GFQA 4EP1A 4XVUA 5ADVA 1VLQA 2JAPA 2YVKA 4BQNA 1E2QA 5AVTA 4L02A 3HCOA 1J2YA 1OLXA 3OWHA 2FE1A 4HP8A 2PWAA 1X7HA 4BGEA 4LVCA 4MA4A 4R9SA 5CCEA 2DHCA 1P81A 4P80A 1QBKC 2BDUA 3F8SA 3HV0A 3W8NA 1K08A 2FJUA 2OBLA 4W5JA 4BDTA 2CT8A 4COOA 3I30X 5A1JA 1C1XA 1Y6JA 3AG6A 4KKVA 3B53X 5B5SA 5J1TB 5KTNA 3U0VA 5BQOA 4KRFA 1RRCA 4Q12A 5FBWB 5G02A 3T61A 5C7LO 3EGXB 4DR3B 1QHSA 4Y9TA 1PO7A 1UMDA 1G5QA 2IRWA 2VT3A 1K7YA 2QUAA 2A1IA 5GONB 1FSFA 1EFCA 1NFFA 4X8LA 1ANKA 2NV0A 3O2SB 4EY3A 3KKOA 4BC1A 1PYOA 3W5BA 3TO5A 4M0UA 3JRWA 4MKFA 1K86A 4JX8A 1B1CA 4Y2QA 3ROFA 3E7DA 4KGVA 5E6UB 1KAEA 4C76A 5E3HA 1IY0A 1P6UA 4B44A 1XYYA 2HCRA 5FNZA 1LZLA 1U28C 1CSEE 4UHBA 3QUTA 2QRNA 5B57C 5AI8A 1U0LA 5G4LA 1Y5LA 1C7EA 5JO0A 5DN9A 3SCZA 4K6KA 4GPD1 5IT0A 4I4TA 1DI0A 4CU2A 5K0GA 2X8JA 1MO4A 3LKZA 4BVKA 1Z2NX 5EZ6B 4K26A 1MDBA 2OO5A 1XKQA 3D0RA 4TKMA 4XX0B 5HIAA 2DG2A 1XLTA 4PX3A 1OZGA 2CHQA 3OU2A 4QBIA 2I2FA 2IVZA 5FLEX 4XZ3A 4URXR 1DJMA 1OFHA 5JMOA 2FEPA 2P79A 3H19A 5KYTA 2D7DA 5K7SA 1XRRA 2JI9A 2YVUA 4Q1CA 4N6GA 3ZU6A 3C8HA 4BGIA 4PE5B 2ZROA 1B3BA 4RS4A 4D8TA 1YA4A 1DEKA 5LQRA 2DKFA 1LPSA 3BFJA 3O1LA 1JQDA 1RQGA 1B6TA 1JIKA 3G7NA 4QQNA 4RZXA 2XAUA 3QPAA 4P0TA 4BLTA 4DIUA 4D46A 4V1CI 4YWJA 1FS4A 2QN2A 3WTBA 3WFJA 4YT8A 4BE7B 1QO0D 1XR3A 4J8PA 4WGFA 3UAVA 4BN5A 4M8IA 1RYBA 1YH3A 5IK2D 3V7FA 2V65A 5BV7A 1WE2A 3A6KA 2VDQB 3ILHA 3FFTA 5B3LA 2VTKA 3LUBA 3TR5A 1QH8B 3JARB 3RRNA 4WLEA 5LXTF 2FZKA 4O1IA 3RV3A 5SICE 1QAOA 4OQPA 4BB6A 1H8EA 2MSDB 2QTTA 4G9GA 2PKWA 5DHRA 1JEEA 4IMPA 4CXMA 5CFLA 3M9WA 3KTOA 1NAIA 3VZSA 4ZEMA 3A32A 4BRSA 3KJHA 1K0UA 4K6MA 2GJAA 5DHTA 5IC5A 4E6EA 4FB4A 1LUAA 1NQWA 4L16A 1JLHA 4QOIA 3ZIAD 4AO6A 1H22A 1H9AA 1AO0A 4FIZA 1E3SA 1YRWA 1Z8DA 4EZBA 3A4TA 2GK6A 3G79A 3ETEA 3KKZA 5IAKA 4EK9A 5B1EA 3VSDA 4N8EA 1GUBA 1I1QB 1ND5A 3W6OA 3W5VA 1HLGA 1FDVA 4XAQA 1K4MA 3SHFA 4EYKA 2Q3DA 5L3RA 5FWNA 5KWJA 1W4RA 1Z34A 3OZSA 4ZALA 4K9QA 4DMHA 3ID6C 3TSOA 2JBAA 3FZNA 1QXSA 3MQFA 1WR8A 5KJEA 3M7IA 1ZC3A 3PE3A 3IELA 1E77A 1JVNA 1O6ZA 1I4LD 3VPCA 3P2EA 1Y0BA 1ZYUA 3JQ6A 1P7PA 1H1LA 1MUUA 1FU7A 1ST2A 2WSBA 1ZVMA 2DPYA 4U4AA 1NLYA 3IUQA 4RHXA 3JX9A 4EG1A 4D9CA 2EFHB 3OF3A 4IHKA 3MHTA 2HXGA 3VYSB 1SXHA 2OHFA 2PWZA 3HN2A 5LC1A 5JYBA 2VH5R 1XRJA 3MPUA 1PNRA 2PXAA 4FYWA 3VKGA 4WQMA 1FP1D 1E9BA 3ENQA 3OAAD 1RXVA 2DLDA 3X1YA 4BECA 1QRRA 2QR2A 5A7GA 1NLZA 4XPIB 1SULA 4B3GA 4L28A 4B3IA 1RQPA 1M6VB 2UUBB 1R5JA 2H2FA 5IDQA 2XLCA 2XTJA 5DCWA 3FRHA 2PSEA 1DCTA 1XPJA 2RHRA 1CIPA 2AA3A 2AZXA 4YI3A 1J42A 1K6MA 1NRWA 2FPOA 3FH0A 3FUXA 5F7JA 2PXXA 2WJAA 3UMCA 3B20A 2ZJAA 1BOFA 4F06A 1K7XB 3IMCA 3QQPA 4PRZA 1XNGA 4BZQA 2NUAA 1KTIA 3OE7A 1EE9A 2B83A 4N4AA 2CXTA 2WSMA 1G18A 1IJBA 2ID7A 3E2PA 2W9XA 4MR9B 1P19A 3N2YA 2B5OA 3Q8LA 3I28A 1JXQA 3LD9A 4I1YA 1HFWA 2IYXA 3CF4A 3K1ZA 4Y1RA 5AVSA 1ZVVA 2PWYA 5KVSA 4FDTA 1AO3A 1EP2B 4G07A 5IKEA 5SYMA 2K7FA 2PUAA 2FVYA 1G63A 3ZLUA 1N1DA 4BVLA 1P39A 2B34A 1DC6A 2PTGA 1YS9A 1Z4KA 3H9GA 3ZNOA 1A7AA 3UEOA 5KTPA 4TVSA 3BFPA 2DWPA 3FD8A 3NYIA 5HIMA 5L8VA 2J7PA 5LOVB 2BTQA 5FYQA 1E2EA 3LZCA 4GT1A 4RH1A 4S3MA 4XDZA 4D5GA 2G72A 4HDRB 3EZYA 1SG6A 2VP4A 4IDEA 5HTOA 3W77A 3E18A 3GLFA 1YAHA 2HN9A 1JMVA 4ND5A 5CT5A 1NF9A 1EUQA 3N58A 2CK3D 3QKUA 4E2XA 2H7YA 4G3XA 1NVWQ 1PEYA 2P27A 1L8QA 2A9PA 3HR7A 1JG7A 4DV2B 5DE3A 1FF9A 4N9WA 1BTOA 2HY7A 4QECA 1C9EA 4CCWA 1NOKA 1MA0A 3T9DA 2VNSA 1BVRA 4GKJB 3L0OA 4DT1A 4CQMB 2CFIA 3KQKA 2DUJA 4EA9A 4Z1MD 2AF4C 3OM1A 3AZQA 5JZMA 3PC3A 4J3NA 5BQPA 3BK1A 1DWPA 2C3UA 4AY3A 4N5MA 2HK9A 3KWMA 5ENZA 1I7QB 1U0HC 2WYUA 5BSUA 5JV5A 1Y1KE 3LPAA 6REQA 3NX4A 5ELXA 5DBEX 1M9NA 1XHEA 1YK0A 1L7XA 2EIHA 3G2NA 4K46A 4PHFA 3MXOA 3O1IC 4DCGA 4MEAA 2FFRA 3D4LA 2PUEA 2CDCA 4EKEA 1LCIA 2QWXA 1WJGA 2IYPA 2II6A 1U81A 3IILA 1ZITA 4O2AA 5G4KB 5ALVA 1Z6TA 1M34E 4AC9A 4O4JA 1SURA 2DLCX 4FD2A 3EQ9A 3FHLA 2HJGA 3AL3A 5K8CA 2NQTA 4JL8A 1I3OA 1NVDA 2GCOA 2PGAA 4HH4A 1SCBA 3A3YA 1KL7A 5AFSA 2DT8A 2XJ4A 1U4OA 2F2TA 3UBMA 2KBFA 1ODTC 3QYPA 4H31A 1A9RA 3LLSA 3RGGA 4B0OA 3LNTA 2P7HA 4UDOA 2I65A 3GC6A 2YS6A 4MIEA 4HMQA 4R9UC 4NOKA 3GGJA 1H2FA 3JVUA 3DMTA 2QRQA 2CBXA 4PX2A 5JXJA 1ZH6A 1VRWA 2ONKA 1ISHA 4YQEA 5KU1A 4HXGA 2ZRAA 3KLPX 4R0NA 3GUCA 2RHHA 4PR0A 2Y1DA 3OE7D 1D03A 3I4CA 3GRUA 4WOBA 4EJFA 4POOA 2YIJA 4OXIA 4X64B 3DHWC 4IWNA 2WJIA 4FEGA 5KO2A 2I71A 2W0MA 3MTGA 1CS0B 1XCBA 2EJWA 3GFBA 3F6EX 3PGKA 1C0KA 5KAMA 1MW9X 1NBMA 4CI0B 3JVIA 3HDVA 1YHZA 2YJ6A 2FQXA 4YMWA 4EZIA 3HVRA 3B3JA 3IERA 2B4QA 3SDSA 3BTVA 1PGNA 5IU6A 3SN6A 1PNQA 1TJ4A 2VK1A 4LWPA 4M83A 4HQLA 3ZDAA 5KPJA 1SMKA 4LDPA 3SHOA 1NVEA 4OH1A 3H1AA 4KXUA 2ZB2A 1WZIA 3N0VA 3T7CA 4QXQA 3TW8A 3I2IA 1QUFA 5M7EA 2O3TA 3IESA 1Z2OX 3ONFA 4I5FA 4J75A 5BSFA 4ZCPA 4PYIA 3HVIA 3KV3O 2ZIZA 2IODA 2VXOA 2BEVA 3V3KA 5HHTA 3Q5GA 2Z2IA 3EUAA 4NMMA 2BEUA 4HLUA 4D80A 5HPYB 5JIBA 3WP0A 2OR3A 4NZOA 1B23P 3ZCQA 2IXAA 3B2EA 1DPFA 3KEGA 1L4KA 2IA5A 3JWPA 4EYGA 2A86A 3N39C 4HG2A 1Q84A 1W88A 1TOAA 3L4EA 1C0PA 3N76A 4GVPA 2HDHA 3M4NA 4JJAA 2HMAA 2JZOA 2YFYA 3L0SA 1K27A 3C3AA 4OB6A 4O5OA 3UHAA 1SUIA 4YRGA 3A28A 5G3ZA 1JDSA 3DD5A 4L6AA 2XB9A 3OBBA 4LOHA 4FFWA 4MWBA 3PZRA 3HEBA 2JG3A 4O4IB 3C7AA 2FX5A 4HI0E 1QYIA 9GPBA 1OWMA 1W8DA 2Z83A 1WBDA 2UUAB 3LVRE 2DULA 2LGJA 1GGEA 2ZWIA 4UUOA 5JW6A 5M34A 2AJLI 1RXEA 2R1TA 3KL4A 3KRTA 5F33A 1O6CA 1R18A 3ANNA 4MUKA 4CV1A 1LJ8A 1L8LA 5F3WB 3HB1A 4KUHA 3IQIX 3SVLA 3ESCA 3A11A 4LY9A 3PHJA 4Q1AA 5ETJA 5J5CA 5U4XA 3ROQA 1NULA 3HGQA 4GYKA 2H1VA 6PFKA 6Q21A 4BP8A 1WBBA 3TEJA 4WESA 4O08A 4YONB 4NK5A 1Y42X 5DX0A 1L1FA 1JQLB 4M1ZA 2MSEB 4L8GA 2Y0CA 7MHTA 2C57A 4BU0A 2WIJA 1DUSA 2QRVB 3KYIB 3WK6A 2XBLA 3KKEA 4ALIA 1AOXA 3G1WA 2WOOA 5CVDA 3OTIA 2O3UA 4PC6A 3GLKA 2L2QA 2HA3A 4HDNA 2AN9A 3HXPA 3ZTWA 4EKGA 1VIMA 2L18A 3CNQS 1DX4A 4D45A 2ZFUA 2O8EB 4MKZA 1Z36A 1R4ZA 2WP8J 4H35A 1QHHA 5EWMB 1F3OA 1EDBA 2IV3A 3TRIA 4D9FA 4MMZB 2R9VA 4GSKA 2BR3A 3RUFA 2XGJA 1DT3A 2HJ9A 5ESXA 1AKVA 1Z15A 1GZUA 3WL4A 3AEZA 2CBZA 3CUVA 4X93A 2H4WA 4AN4A 2G1UA 1HE4A 1K3TA 1LFAA 1XMVA 2PUDA 4QTXA 4Q66C 1DDGA 3ORHA 3PJDA 1JEOA 4MQFB 3S1SA 3KE9A 4GPAA 1W19A 3D43A 1PBNA 1Z0JA 2AMVA 3JPWA 3EPLA 4J0KA 3WQQA 4UE6A 4ZVQA 2GHTA 1AV6A 1YHYA 4WAUA 4XUDA 1T3LA 1TK2A 2X42A 3N8HA 3IVAA 5CM8B 4A0RA 1KYYA 3FY4A 4U7FA 3ZI7A 1CK4A 1U2ZA 2PKRA 3F1KA 3UYKA 1SZJG 3PUIA 1I0LA 1TKAA 1KF0A 5AK3A 5FD8A 1WQ4A 1ILWA 5J1SB 3DP7A 3NCHA 4CKCB 2CDRA 3G17A 1E3QA 3ORRA 3T9CA 4JITA 9ATCA 3AOEC 4JSRA 5CLLA 1L4FA 5K8TA 1SUEA 3HEAA 4ZO7A 1Y7LA 3DL4A 4QOFA 3RREA 4AUKA 1I33A 3Q8XB 3TVTA 3ZJ4A 5F1YA 4XCQA 1A77A 2Z8XA 3OJLA 4JJKA 3NDBB 2I6FA 4G0XA 2TMGA 5TNXA 1PW7A 1O1YA 3F96A 1A8SA 3E61A 5AK0A 1E6LA 3TXYA 3UMMA 4BNDA 3ZHVA 5DLDA 3IP3A 2G0AA 4M53A 3DMDA 3WXBA 5IFLA 3BPSA 1RRKA 1CQJB 2EFGA 4OXQA 1KZ1A 1RM3A 1NNLA 2FH5B 4ZAFA 5MDHA 2F3RA 2ID4A 2HU5A 2MYUA 3I6YA 5B2EA 1U8UA 2H5LA 3OIDA 4EI8A 2QRLA 2ZIWB 3QPUA 1NR5A 3ANSA 4TGLA 2EX0A 3OPQA 1LRKA 4F4CA 1B8VA 1MABB 1NRJB 3JPYA 4PN3A 1LA2A 1A9XA 1M6WA 2KW5A 4LTDA 5H02A 4JNKA 4RUKA 2EQBA 3DDHA 1BXZA 3E9RA 3MYRA 4PYLA 5JSHA 2ECQA 1VP9A 2IYZA 1MB0A 3B82A 3GNQA 5LPNA 4F6RB 3GQBB 1X1EA 1WO8A 3CUUA 1VCOA 1RWBA 2VJMB 1GPYA 2GYVA 2I9PA 2O4CA 3IPLA 1NW9B 4Y9UA 3SZGA 4JVMA 1P2DA 2J48A 1K6JA 4WHMA 1A5TA 1Y3BE 4P4SA 1S3SA 2HSEA 1AU9A 3HXKA 3DFFA 3ES9A 3JYPA 4JCCA 1N2HA 2RGAA 5TS3A 3MTIA 3LVBA 3DDCA 1QQ6A 1FZTA 5DNCA 4J9UE 4DMLA 3X0DA 4IUCS 4H60A 5A02A 3WADA 2PGIA 5TEVA 3ITEA 4DV5B 1VBMA 2X7JA 1W35A 1UOEA 4G8BA 4A36A 1WMAA 5ABPA 1B26A 4HZGA 2MSLA 3PUXA 5CITA 2MWMA 1TYDE 3QXJA 2C5BA 2XQJA 3H9EO 3DAHA 4V0RA 5KMGA 4M0LA 2VP5A 3UV3A 1FDUA 5KKNB 4D2IA 2D4HA 1CY4A 3KUDA 3S7TA 4AWAA 4BJ3A 4R1TA 1CIVA 3I32A 4KO2S 1G66A 2QG4A 1K6XA 3ZJTA 4GKKB 4W6QA 1MX9A 4XQ9A 2VJPA 3ELUA 3OQIA 4JOBA 3HZRA 1NYTA 1PV2A 3IAM1 1Z6ZA 3RADC 1KKUA 4JVNA 5HJEA 3KZ1E 4MQ4A 2JIRA 1AK2A 4GBJA 2EDCA 1O08A 1RMTA 1P2UA 4MRMA 4ZPXA 5JALA 1N34B 1GPWB 1UBCA 2UVDA 3A4YA 1D6JA 4B2IA 3ZWPA 1UR5A 7YASA 4LGCA 1TM1E 4ZVPA 2YRFA 1ILEA 4HCJA 3A6EA 1YGYA 4HMOA 4OUDB 3SQLA 2CVPA 4BS9A 5JJKA 3JYHA 1A27A 3R3UA 3TSYA 1K7FB 1BXRB 3MGGA 3TMYA 1AV7A 1VE1A 2JAXA 1E5VA 1YKSA 3NBYC 1II0A 1HDRA 3ESZA 3QG1A 4FI3F 2ZTMA 5F3RA 3TLYA 2V5VA 4AMYA 3TI7A 3EPJA 2Z6UA 1GQRA 4G24A 2IS2A 3TLAA 1DAHA 2E85A 4HTAA 2AMYA 4UQPA 1TM3E 2VPPA 2QQ5A 1KZ7B 5DI9A 4W7HA 3IHTA 3TDNA 2BUAA 1LVHA 2DBZA 4TTAA 1U8AA 4I9FA 4OHRA 2Q1UA 3L4BC 4OHUA 2FWNA 4C7XA 4GZLA 3UJ9A 2WG2A 4F91B 2C4KA 4JASB 3LO5A 5IRCD 2HJVA 3AHFA 3BDAA 3K8YA 4KIGA 1E0DA 4G65A 3C6QA 3LECA 3SYMA 2Y6UA 3FPEA 3VZCA 3WA6A 1KMCA 4C04A 3CZQA 5KTKA 1JHPA 2I62A 2GN9A 2FMUA 3R3WA 4MW9A 2FUKA 5K8IA 4DV0B 3OFVA 1XXHA 5KVVA 3LQYA 4KE9A 1XPRA 3NC1C 1BMTA 4PRLA 5DSZA 4B3HA 4MHTA 1G6Q1 3D6UA 1QRUA 3H97A 3OP4A 2Q5JA 3DMPA 1PWYE 2YH2A 4MUMA 4MVYA 1YJXA 3K0EA 2Q41A 1UFQA 4M37A 3ODPA 4N3BA 3T0GA 4D6XA 3HBAA 5TQJA 3I2GA 5JZSA 1RBMA 2QYOA 1GQQA 4JL5A 4NECA 1Q15A 3N70A 2IYQA 4PZ9A 1M7BA 2P11A 4KG7A 4MUAA 1ZD5A 2GVNA 3NIGB 3QGMA 1EXWA 1K92A 1L7VC 4IX1A 4PXYA 4BMXA 1XK7A 4OVKA 3VNSA 2F1RA 4CWAA 5C2JB 1N5DA 2C94A 3OX3A 4JEUA 4M21A 3S68A 4ACBA 4RLFA 2SCUA 3NHBA 2XVZA 3CVOA 4EEXA 1C30A 3GFTA 2AX3A 3PFIA 3D0OA 2P68A 4DCJA 2HX1A 5ITSA 4U7PB 1BSVA 4XIGS 5EE3A 5AICA 1QGOA 2OG1A 4TMZA 4Z1MA 4GYYA 1FJ2A 1Y37A 4YB8A 5DW3A 5JADA 4CF4A 3DLBA 2D0PB 1K4KA 3KQQA 4XXHA 1YFLA 2C95A 5E4FA 2PTHA 1SOMA 1DC7A 1T5TA 1W4CA 2Q5QA 1N78A 1TZCA 4DWWA 5LA6A 4ERXA 2H2IA 3DKIA 2NLOA 3ZKWA 1GGMA 2VUIB 5T3YA 1OFUX 3ZCUA 1SCUA 4P83A 4HUQB 1DIOB 1VE5A 3VGPA 3EVEA 5B6JA 4OQ4A 2N46A 4RZ2A 2J0EA 2WHEA 1Y33E 3OWXA 2B82A 4DABA 3A1CA 2QJRA 2Z8YA 2YVLA 3P2IA 3MSXA 4R8VA 3SDZA 4P3YA 4F71A 1Z39A 2HMYB 2KWIA 3GCZA 1JDZA 1ZGHA 1JH9A 4ASUD 1UZNA 2XYRA 3EFOB 3HN7A 4J3FA 4RH0A 1E5DA 1OLOA 1Z4IA 2W2MA 2YJGA 5G2OA 2CXHA 4AD8A 3AR3A 2R6AA 3MW8A 5HKOA 2ZJ1A 4QUEA 3HVKA 4EQZA 2VTVA 3LWBA 3RVPA 3M6IA 2NV2B 4WBNB 1Y9EA 1FMCA 2COEA 2H59A 2QJFA 3KU1A 3LNCA 4PTLA 3NYQA 1AN9A 5JEEA 2H0AA 5J2TB 3DCNA 3T41A 1P75A 3AXTA 3PXBA 2WAAA 2R00C 4QXPA 3SQWA 4MYUA 4PEVA 1W4AA 3I45A 4FFVA 4WA7A 5DTJA 3B6IA 4ARUA 5LL6P 2CD9A 1O97D 4LRWA 3TQHA 1D5CA 1VYVA 3IE2A 2JIZD 3CNEA 4JMLA 5DV9A 4DJFC 3BD8A 3T5MA 1IXRC 1FYEA 2ZR0A 4NABA 2G1JA 4YQFA 5I47A 3DLHA 4OJQA 3P7MA 4Y2VA 1B8PA 2A84A 1EP3B 4HMPA 1QLWA 2ILVA 3OQ1A 4RL6A 2VYND 4EITA 3GEHA 4AKTA 1WSDA 2QD5A 5EWLA 3SXUB 4X7BA 1ZGBA 4PINA 4WZ6A 4HC4A 3FNRA 3QEMB 3CWZA 1FP6A 2HADA 5TE9A 1ZJ5A 1PS8A