4FIZA

Crystal structure of the binary complex between a fungal 17beta-hydroxysteroid dehydrogenase (apo form) and coumestrol
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
260
structure length
260
Chain Sequence
b'YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 17beta-hydroxysteroid dehydrogenase
publication title Crystallographic studies on the flavonoid inhibition of a fungal 17beta-hydroxysteroid dehydrogenase
rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase/oxidoreductase inhibitor
total genus 109
structure length 260
sequence length 260
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fizA00
4ALJA 4YT5A 4ZN6A 4HADA 2NU8A 3GG2A 1PL8A 1ZK3A 1KEVA 1I33A 3ADOA 3M1LA 4LGVA 5L3ZA 3CEAA 5TF4A 2BELA 3WGOA 2W90A 4DTIA 3A28A 3JSAA 2A35A 4DLBA 2J6IA 4IMPA 3VH3A 3VKVA 3L4BC 1A9ZA 1I30A 3IP1A 1QV7A 3FI9A 1X14A 3MCVA 3NJ4A 2X86A 2VCYA 1AHIA 1B15A 1LQUA 2DT5A 4NFHA 2Y1CA 4E2WA 2WSBA 4HNGA 3ICCA 4E6PA 1Y6JA 4W99A 3KVOA 1HTBA 1P31A 3MZ0A 3RBXA 1LQTA 3GHHA 3QWAA 4GH5A 1ZW1A 3FNEA 2DM6A 5DOVA 2V6BA 1K6XA 1PJLA 2I5PO 4CLEA 5CDSA 2PFGA 3H5RA 1S7CA 2GDZA 4I1IA 1FDTA 3MTGA 4J1TA 5TJHA 3ZHXA 2A94A 5JDIC 1N8KA 4KDEA 4M54A 2GERA 2ZTVA 3GQVA 2IZ0A 1EUZA 3Q6IA 3TJRA 3EUWA 2EKQA 4UULA 3EZYA 2E4AA 4FFLA 1LDGA 3D3EA 5AYVA 1XGKA 2B4RO 7MDHA 1QORA 1ZEJA 2I3AA 3QVOA 1T24A 5EQFA 1CJCA 2DAPA 2LDXA 1PJQA 3OMLA 4WPGA 3G49A 4OKNA 3DZJA 3RSHA 1GCOA 2AG8A 1DDOA 4MVJE 1ISHA 1ISMA 2PD3A 1A71A 3FD8A 3TZQA 4BNIA 2O4CA 4BVAA 2BI8A 2JD0A 4JIGA 2PGJA 1T2CA 2BMAA 4YQZA 2OP0A 2B83A 3ICPA 3OJOA 2NU9A 4U6QA 4DC1A 3V1YA 2CDCA 4DPLA 1SB8A 4QFCA 3WB9A 4KWIA 3H3JA 3PRJA 2JAHA 4LRTB 5DP1A 1E3LA 1R15A 3AWDA 1K89A 3U4DA 4CM4B 3G1UA 2XXBA 1I2BA 5AXAA 3INGA 4IINA 5KKCA 5GY7A 4CLHA 1HETA 4WUVA 3AFNA 3I23A 4E2XA 4MVJI 3PWZA 4XA8A 1R37A 1B3BA 4IZIA 4O59O 2HLPA 1NNUA 2EIHA 1DBVO 4K28A 1E6WA 1W4ZA 1E1LA 4IQ0A 1MC4A 3RCBA 3RAJA 2NV6A 3P5SA 4CODB 5I7FA 2GF2A 2RHRA 3PQDA 4AJ4A 5IXYA 1ORRA 1I2ZA 5DBFA 4UEKA 3HN7A 1ZIDA 1B2LA 5A9SA 1Q0HA 3KYDB 5KTKA 1O8CA 4NBRA 3M6IA 1ZSNA 4IDCA 4DYDA 1PJCA 1DIAA 2ZYAA 3ETEA 3WXBA 3BHMA 4C4OA 1FF9A 4MINA 3WQSB 2W98A 3FWZA 4L74A 1LSSA 4CM4A 1U3VA 4E0BA 5ES3A 1D3AA 3RC2A 1LSOA 2ZTMA 4AICA 2P9CA 4UVDA 1W6UA 1AE1A 1BWSA 3QQPA 3RJ9A 1E3EA 1SB9A 4M49A 1WXDA 4ZQFA 4RPKA 1DRVA 4CV3A 4B4UA 3HHPA 4WCDA 3U4HA 4D0RA 3E1KA 4R5HA 1VKOA 4L76A 1GUZA 3JCZA 4PLCA 5ICMA 2PZJA 3KYDA 4DQVA 1QSGA 1EVZA 1RJWA 3ZU2A 4FFMA 1ADFA 5A5FA 1LDYA 4JP2A 4WLUA 3GVCA 1PTJA 1K6IA 2FRDA 4EJ6A 2G1UA 1M75A 2IYPA 5KCZA 1UP4A 4UUOA 4QO8A 3VPXA 1YJ8A 1I0ZA 3E9QA 1H9AA 3ANNA 4HFJA 1V3UA 2EP5A 1C1DB 4E4YA 2ZQZA 1GV0A 1LA2A 1UAGA 3RC9A 2GR9A 1D8AA 3AUAA 1ENPA 1E3JA 2F00A 3A9WA 4FJ0A 3VPFA 5A5EA 4QO7A 4B8WA 2FY8A 2X22A 2HMUA 1P45A 4A0SA 1I24A 3OETA 4MJLA 2AHRA 4L75A 2BI7A 1VJ1A 3PLRA 4OIMA 5L4NA 1CETA 5H83A 3DHYA 3F5QA 1H6CA 3SEFA 3C7DB 4JJIA 4BKPA 1CDOA 5L51A 4XZ3A 3QE3A 2A4KA 3PYXA 4IDDA 3DO5A 1EBFA 4IJKA 4F6LA 1N1GA 2W2KB 4W4TA 3L4SO 4L8VA 4LW8A 5B4VA 1VL0A 1HXHA 1R6DA 4OMUA 3DWFA 4MPDA 3S2GA 3JD3A 1C1DA 1Y9AA 4KDFA 1EVYA 1SO8A 2E48A 3K30A 3A4VA 1Z7EA 3OSUA 3LK7A 3OA2A 4NBTA 3LF2A 3AM5A 3PGJA 3PI7A 1YBMA 3NKLA 2DTXA 3BIOA 1BXKA 3DHEA 3FRJA 1WVGA 1YOVB 2EG9A 1IOLA 1ISGA 1B8VA 3GN1A 3QRWA 3RUFA 4YQYA 1PL6A 1ZMTA 3GZNB 5KJEA 4E5YA 5JDIA 3L77A 5A02A 2Q2WA 5AQ1A 1W8DA 2BGMA 3EAGA 4IDGA 5KVCA 2HJSA 1I36A 3ZW8A 2W2KA 4G65A 2FWMX 3LC1O 2EHDA 1K5HA 2HRZA 2YUTA 2FR1A 3FR8A 4FSHA 3I9JA 1OMOA 4DLLA 4OQZA 2FSVA 2QIOA 1DHTA 5FFFA 3HADA 3RWBA 2P9EA 4R1SA 1KVUA 3RC7A 3I5MA 4CL8A 4MIYA 3KSZO 1R12A 3I9NA 1NPTO 1MGOA 4GX1A 1C0LA 1WLYA 2P5UA 4J4TA 1YOVA 4GAEA 5G0WA 1PR3A 5JCJA 4RDIA 4CM6A 5ADHA 3CKYA 3D64A 1ID1A 1XDWA 2AE2A 5I9MA 1EDOA 5THQA 1CQIA 2H6EA 3EHEA 4XQGA 2Y67A 3GAFA 3D1LA 3F4LA 3FBGA 4GMGA 4PG6A 4E32A 1V9LA 4XIJA 3QJ5A 4DC0A 1J0XO 1HE3A 2X7HA 4CMAA 4E5MA 4BNYA 4A73A 4BS9A 4J16A 3RBZA 1YQDA 4J6FA 4LVUA 1MA0A 4ZRNA 2WTBA 4AFNA 1GYQA 3KEOA 1XELA 1YQXA 5JAQA 3RI3A 2GUGA 2RAFA 4YT2A 1NWHA 2JCVA 1SCUA 1PGQA 4OH1A 1KIFA 2O3JA 1UUFA 1LTHR 1X0VA 1O0SA 3UKOA 1EVJA 4OQYA 3DR3A 1EFLA 4Z9YA 1MC5A 4NBUA 1YVEI 4GKVA 1QLHA 4H15A 7ADHA 1Z75A 3U09A 3RVDA 4YRBA 3P2YA 4YAKA 1NBOA 4B4VA 5T64A 3K8ZA 1IB6A 5HTOA 1LJ8A 3MJ4A 4YAJA 5G0UA 3LQFA 2P4QA 1JAYA 2W8ZA 3I3OA 3I4FA 3PK0A 4LCJA 4PVCA 5F1OA 5I8ZA 3ZWCA 4Y6RA 4CMHA 2ZTUA 1YGYA 5BT9A 1UZLA 2ZKLA 4XR9A 4IDAA 4XJTA 1C14A 1LLUA 1NXQA 1GAEO 4DXHA 1PGOA 2Y1OA 4FIZA 4FCCA 3QIVA 3ZWXA 3ZDFA 1AHHA 1B7GO 1QR6A 4UREA 2OXIA 2D0IA 2NQ8A 2FN7A 5A9SB 3FNFA 1GZ6A 2HSDA 4IZHA 8LDHA 3DBHA 5C7IO 5DNAA 2HU2A 1TXGA 1YL7A 4TZTA 1WMBA 1YKFA 1WPQA 3BTOA 2AQIA 1XCBA 3FTNA 3KSDO 4I5FA 2W2LD 1ZMOA 5TT1A 1P1IA 2FOIA 3WDSA 4RJTA 3BHJA 4BV9A 2HK7A 1KVRA 1Q7BA 3VZPA 4R1TA 1DRUA 2HK9A 3GVXA 3ONFA 2BF7A 2YFHA 2IZZA 1GYPA 2HMTA 4PG5A 4O5OA 4EJ0A 1OC4A 4FB5A 3KUXA 3NRCA 1E92A 2BGKA 3WGZA 3HUDA 4MKRA 3T4XA 3ROMA 3U62A 4WEOA 3BZUA 3H9JA 2B5WA 4DMMA 4ZQBA 2X0JA 4BO6A 3DDNA 3K6JA 4RGBA 4J49A 5I7VA 1GCUA 2QX7A 4J9VA 4L4SA 1T2FA 1Y1PA 2NUAA 3BMQB 4BGEA 5CDTA 1ISIA 4F45A 1D1TA 3ABIA 3L6EA 4B3HA 4DMLA 3PZBA 1F8GA 3B20A 3IKVA 3GNTA 1U3WA 4ROSA 3H9EO 3JQ8B 5G0SA 4FD3A 4GI2A 1SOVA 1F0YA 3PYMA 4Y8VA 3Q3CA 3WTCA 3W6UA 5CFZA 1HKUA 4E2YA 2PV7A 4FR5A 2J3HA 4Q39A 1U4SA 4RPLA 1X1TA 2CD9A 2YW9A 4CUKA 4ND3A 3SBOA 1ZEMA 3VC7A 1T1SA 1UZNA 3O4RA 5TT0A 2X9GA 2VRCD 1YDEA 4RZIA 1GADO 3AJRA 3NT4A 4N54A 5CPFA 3GAZA 4BO4A 1QYCA 2FR0A 2ZB7A 4RO0A 1SNYA 4FQ8A 2Z1MA 3JYLA 1VI2A 2DBRA 3ZNOA 1AGNA 2CF6A 2VYVD 4RF3A 5K9ZA 2HO5A 4BNLA 5IDXA 4J7CA 1VJTA 1PS0A 3ZHYA 3G17A 3IQDB 5A03A 5CG2A 2AQHA 4LCEA 4KWHA 3JQ8A 4XYGA 4YAEA 4CMEC 1JWBB 4BB6A 2BFOA 3DTTA 4IDFA 2HKIA 3QWBA 4PG4A 2E6UX 3DMTA 4LSMA 3UN1A 3WLFA 3PHGA 3JTMA 4OO3A 5IG2A 1D1SA 4MKXA 2X5OA 4PIVA 3DHNA 1JW9B 4CUJA 5HM8A 2ILTA 3LU1A 5L40A 4WOJA 4CM8A 2Q1TA 4XGIA 1MG0A 3KV3O 2PLAA 1XQ1A 4NU6A 1ADGA 3GEMA 3L6DA 5L9AA 3FNHA 3AY3A 2JFFA 4IPTA 4E30A 3TDKA 2CVZA 4BB5A 2P91A 1JU9A 2PWZA 3K2BA 4HXYA 4P8RA 3HE3A 1P77A 4PG8A 9LDTA 2WWRA 4TVOA 4IUYA 3PGXA 4IS2A 2VWQA 3WMWA 2C82A 3GN2A 3JQ6A 4MVJP 3TN7A 2OOSA 2Y1FA 1XQ6A 3F1KA 3ANLA 1RKXA 4M87A 4J0EA 4EDFA 3AY7A 3DZGA 2FZEA 8ADHA 1EQ2A 4OL9A 3NAQA 3VH4A 5JC1A 3PJGA 1LI4A 3V2HA 1MFZA 4UVHA 2I6TA 3RUAA 4PZCA 2WDZA 2F1KA 4IQGA 3Q11A 3HSKA 1T26A 1P9LA 1GEGA 3OQ1A 2DTEA 2OMEA 3I52A 3RKUA 3BHIA 5GZ3A 5JY6A 3C1AA 2V6MA 4ZA2A 3DZHA 1LRJA 2J3KA 1RM3A 3D5TA 3H6KA 4I9HA 3RUEA 1PS9A 4KUHA 5G0VA 2J5QA 2E37A 3NDJA 4HY3A 3DEYX 2VT3A 5JLAA 1C1XB 1PJBA 4CL3A 4A03A 1N92A 5EIOA 4U0KA 3FNGA 2DFVA 2JAPA 1M67A 1JKFA 5KJ6A 5FEUA 3LSYA 1O89A 4JP3A 5L4SA 1LC3A 3Q2KA 4D7AA 4KP7A 4XB1A 1H6DA 1AXGA 4YTEA 4HFMA 5DCYA 4MP3A 3UOGA 4K9DA 1N1EA 4GLOA 5FI5A 1UJMA 3R0IA 3WSVA 4PG7A 1VE9A 1UXGA 3RUCA 1T2AA 2EW8A 3EVTA 3PJDA 4S3MA 2I65A 2YV2A 1R0LA 4R51A 1O6ZA 3I9MA 4YBZA 1UP6A 5MGBA 3DAGA 2ZB3A 4BO9A 3VHRA 1AUPA 1C1XA 1TT5B 1YDWA 3UXYA 4RLHA 1KY5A 2JD1A 3JD2A 1DFIA 2YHUA 4DUPA 3IOYA 3W8EA 3DB2A 3LF1A 5IDYA 1FK8A 1GL3A 1Q0QA 4B7UA 1ENOA 5IN4A 4WLFA 1XIVA 4EZBA 1HZJA 4YACA 1GPDG 1WMAA 3L9WA 1R4NA 1FMCA 1I3NA 1PQWA 2AEFA 3DXFA 2CVOA 4R4JA 2FMUA 1PQUA 4INAA 5BNFA 1LDEA 2YV1A 3CTMA 5TX7A 4PGFA 1WZEA 5EESA 4NBWA 1UH5A 2YY7A 4JXKA 3GRKA 3HFGA 4Z0TA 1HE5A 3OP4A 4OGWA 1FXSA 2TMDA 2XXJA 4KQXA 1UDAA 3JYNA 2XF8A 3DZFA 2NVUB 1TT5A 4R69A 1MB4A 3QW2A 1QKIA 3AI3A 3NT5A 3DMYA 1IY8A 5AVOA 1XSEA 4DIBA 3C1TA 2Y0DA 2DU8A 1YL6A 1HYGA 4CMIB 2EWMA 2DKNA 1L1FA 2NTVA 1YWGO 3L07A 3N58A 4OXNA 1H6AA 1DAOA 3VAZA 2PKQP 3D4NA 4I8XA 3C3XA 5CG1A 3I4CA 3U3XA 5F5NA 1IPFA 2QRKA 4MKZA 4BO2A 1KS9A 4WECA 3H8VA 1TA4A 1PJ4A 1ZH8A 3QWFA 4AJPA 5IZ4A 3STHA 4YT8A 2JFHA 1ISFA 3WNVA 1T4BA 1XU9A 5F5LA 4KTTE 5ER9A 4J1SA 4QQRA 1U8XX 1E6EA 2NVUA 1U4OA 4UEOA 2FPIA 2X58A 3G3EA 3H3FA 4AJKA 3PJEA 3TSCA 3INRA 3QVWA 4GVLA 1HEUA 1QXSA 2X9VA 4PLVA 2IXAA 4CMIA 1Z74A 3EW7A 2GYYA 2VUTA 4B4WA 4JROA 1F8FA 2C29D 2P68A 4RORA 4HV4A 3JQFA 5DULA 3GR6A 1EVIA 4H3VA 4CPDA 1NHWA 3O38A 4HFRA 4BO7A 1W0CA 1G1AA 3E9NA 4R9RA 3UCEA 3GDFA 4RQUA 3VTFA 4RPJA 1R0SA 1FDUA 3LC2O 3WWYA 3PXXA 4L4XA 3P2OA 1KEUA 3JQ7B 2HQ1A 1P74A 2IZ1A 3U0BA 2ZJ0A 1AN9A 1DJNA 5U4QA 3ZWMA 3BTSA 2EV9A 1P0CA 5T8KC 2R00C 3WIDA 4TRNA 4MVJG 2OP1A 3SLGA 1Y8RB 5KVVA 5LCXA 1GZ3A 1MXHA 4N5NA 5AOVA 5L45A 3S1LA 4BNVA 4GPD1 4J7UA 2ZQYA 1P33A 3ITDA 3DAFA 1XHLA 4PLTA 2YDXA 3DOCA 3U4CA 3ZWOA 4L4RA 3GNSA 4II3A 3RQSA 2WD7B 5F1KA 4AJ2A 2PH5A 4FOSA 1DAPA 1X1EA 3VOSA 4IJVA 3BYZA 5TSDA 4CQMD 5TC4A 1EUCA 4CR7A 4GGOA 4WOKA 1SMKA 4UVIA 3TL2A 3SVTA 1YRLA 3OQBA 2VHYA 4FFOA 3JQ7A 2DBZA 1WNTA 1Y9EA 2WE7A 4L73A 4I5GA 1Y8QB 3ZWWA 1X13A 1DIGA 1ZJYA 3GGGA 1ZUD1 2HDHA 4J9UE 1GDHA 5F1PA 2B0JA 2V65A 1YB5A 3B1JA 5EL0A 3OHSX 3LT4A 2W4QA 4BKOA 1HRDA 1Y8RA 2IXBA 2JHGA 4WKGA 4B79A 2YFQA 4N18A 1LLCA 1U9JA 2XOXA 3C24A 3PHIA 4N5MA 1M76A 3AOGA 2Q49A 2YHIB 1HYEA 1ZK1A 3JQAD 1ZJZA 2WD7A 4R54A 5KVSA 4TWRA 4CR8A 3WX0A 1VKNA 4K6FA 4UEJA 4HWKA 1JA9A 3GVIA 5F3RA 2OGUA 4R5MA 1HF3A 4NH4A 2GZ3A 2GN9A 1DIBA 1ARZA 2ZTLA 3WTBA 1A72A 5TLSA 5G4KB 1XKQA 3K9QO 3B1FA 4W82A 4CM9D 4QECA 1PR9A 2G82A 5EN4A 1Y7TA 2UYYA 4R41A 5LC1A 4ZRMA 4NDNE 1Y8QA 4OYRA 4WEQA 4BO3A 4YJGB 3GLQA 2J3IA 3ENNA 4DQUA 3GMSA 1EEHA 4OKIA 3UFXA 1LU9A 4BHTA 1U3TA 2B37A 3PHLA 4RPHA 2YHIA 1QLJA 5LDGA 4IIUA 5JBIA 5CEJA 4OM8A 4GKBA 1P44A 4MOWA 5A04A 3GDGA 4RZHA 3U49A 2YQ5A 3WQRA 5BNTA 3K5PA 2C5EA 4B3JA 4AJIA 3VZQA 1B8PA 1HE4A 5G4KA 5DF1A 1YH3A 2O2YA 4K6CA 3AI2A 1LSJA 4J7XA 5KJ1A 4YJGA 1ML3A 2RCYA 4RVGA 2Q2VA 1GTMA 2DPGA 5GZ1A 4Y9DA 1GR0A 4TROA 3PFFA 1NAHA 3NGXA 3ZWVA 1Q7CA 3AUSA 1Q0LA 2O4UX 4U6SA 2HUNA 4J43A 2HJRA 4AG3A 5DCWA 3TF5A 4DQXA 2CF5A 5G0TA 4J4HA 4JX8A 4YJFB 5KVQA 3Q9NA 4PLZA 2V6FA 4I9NA 2CNBA 2OORA 4YDRA 1L7EA 4WLVA 4IY1A 3SX2A 4EYEA 2CVQA 4CLDA 1H2HA 2PD6A 3L4BA 4JQCA 3E9MA 4UUMA 4XQEA 4NMHA 3TZ6A 2XAAA 2Q1UA 3RUIA 4A7PA 5TQVA 4JNKA 1FDVA 4TRRA 3EZLA 5K6AC 1IE3A 5C7LO 4E2ZA 3LLVA 1KVSA 5C3MA 1K2WA 2P5YA 5I7SA 3BXXA 2JHFA 1EMDA 1YQGA 3ULKA 2DPHA 2RHCA 3D7LA 3JD1A 1BW9A 1E7YA 2GZ1A 3HQ4O 1E3WB 2IEBA 2PK3A 5B4UA 2RH4A 4XGNA 3V2UA 4RCVA 3ZI0A 4FGSA 3ADPA 2YQ4A 4QEDA 3DBVO 2BKAA 4YJFA 3RUHA 1E1MA 3ZNQA 3ZV4A 1QRRA 1E7WA 5ENDA 1D4FA 5KWEA 1CQJA 2GLXA 4YPOA 1UZMA 3JQEA 1QYDA 4ZQEA 1NQ5A 2DLDA 1WDKA 4BNZA 4I5EA 5T8KA 5L53A 2R00A 1PGPA 1U3UA 1PWXA 1V6AA 3S2EA 3TQHA 3NV9A 3QV1A 1E7SA 4YEDA 1JN0A 2RIRA 4JN6B 4NFYA 5BSGA 1JTVA 1RM5A 2D5CA 4D0SA 1LRLA 1H9BA 1MUUA 1DOHA 2VYND 1P1JA 4Y6PA 4GLLA 4FW8A 3KO8A 1VJ0A 1E3WA 1V8BA 3JQCA 1ZCJA 3Q1LA 3FWNA 1HYHA 3ON5A 3WS7A 2Y1EA 1J6UA 4W9NC 1Y5RA 4MVJF 2I9PA 3WLEA 4Z3KA 1DHRA 3JYOA 1U7HA 2X1HA 3IUPA 3E18A 4RVUA 2B35A 4LVCA 1LDBA 2POQX 3TL3A 1NTOA 4YA6A 4DL9A 4XYLA 4G2NA 3F1LA 2HMSA 2H9IA 4QTZA 4DIFA 1OZAA 5HS6A 2CUKA 2H5LA 1C0IA 3WQQA 4AJJA 1PJ2A 1WP4A 2VNAA 3CXRA 1I3LA 1VSUA 5DZSA 1D7OA 5KIAA 1J49A 3ONEA 4HBGA 1LX6A 2X6TA 4J4BA 2EKPA 4GSKA 3AK4A 1BXGB 4DLAA 1DO8A 3H5AA 4AJHA 2JD2A 3H9UA 4HUJA 4B7CA 1LEHA 3NGLA 1DLIA 2C20A 3DBHB 2JJYA 3FSRA 3PEFA 3W4JA 4PFJA 3LC7O 5HWSA 2ZK7A 3GA0A 3HB4X 5FYDA 4BKRA 4B3IA 4YJDA 4F6CA 4MP6A 4XYMA 4XKJA 3HNPA 3K31A 1EFKA 4P4GA 4RDHA 2BLLA 2Y93A 3RU9A 1BVUA 2NACA 4KOAA 1PJTA 2AQ8A 5U9CA 2FPGA 3KZVA 5I9LA 5IF3A 5BQFA 4E5NA 1BGVA 2C59A 3ZN2A 3WJAA 4YCAA 2PA3A 4ALLA 2PKQO 2VRBA 3RC1A 3OJ0A 1BXGA 1NQTA 1U7TA 2P9GA 5CDYA 5K0ZA 1IUKA 4JJGA 1KVTA 5JDCC 1PJSA 5KKAA 4BNMA 5ILGA 3FN4A 4RF4A 3CMCO 4WLNA 2I66A 1NR1A 4WK6A 4G81A 3EGOA 1RM4A 4FFNA 4IDBA 2UUOA 3TPCA 1YB4A 1SC6A 3MJCA 1XU7A 4CMKA 4AVYA 3PHHA 3C7AA 3I83A 1WWKA 3PIDA 1VRWA 2UUPA 3ZWAA 5BSHA 3BA1A 4M8SA 2ZATA 4M1QA 5KNLA 1HWYA 4XX0A 4ND1A 5JW6A 1MX3A 2C2XA 4D44A 3ZH2A 3NDIA 2EGGA 2C54A 2GO1A 2Z5LA 6LDHA 3IL2A 2OBNA 3BMCB 2ZYDA 1HSOA 1NQOA 3COSA 3JYQA 1U5CA 5DT9A 1KEWA 1XA0A 1E7MA 1ULUA 2VHVA 4L9RA 4JBIA 3UCXA 3ZZNA 1UAYA 5IDQA 4OSPA 2CDBA 2O7QA 2OO5A 4D42A 4ZQHA 3L6OO 2DTDA 1RWBA 1GPJA 3WGHA 2CY0A 5COAA 3GK3A 1F17A 1U2DA 1PSDA 2NVWA 3OECA 2C7GA 3QLJA 4NK5A 4U8GA 4LMPA 3M1AA 5K6AA 5JO9A 4YVFA 2QZ9A 2GD1O 3G1TA 3HWRA 1ZXLA 1HE2A 4Q3CA 4L0QA 4TKLA 4CMJA 1OOEA 3BMCA 2Q4EA 5HBRA 1E7QA 4OXYA 5KJCA 4BOYA 4BNKA 4R16A 3ZU4A 4EI2A 4XWYA 4CM8B 2DBQA 1BHSA 4HFNA 5JNLA 2DUUA 2NTNA 4O0LA 3CPSA 3GVHA 3W1VA 3NTRA 1P0FA 1R16A 4CV1A 3AUUA 3ZW9A 3HFSA 3BTVA 2OUIA 3OA0A 3V2GA 3DFUA 1G6KA 4UUNA 2OFPA 5KJFA 1J4AA 3ZWBA 5U1PA 3WYBA 4E12A 1HDOA 3DZKA 4CLOB 3WSWA 3RD5A 1LDMA 3VDRA 4EUFA 3AY6A 1NP3A 4UVGA 2IRWA 4CM5A 4EEXA 4B7XA 3CIFA 4J2HA 3EMKA 1QYVA 4OHUA 3HZZA 1YBVA 3OQ6A 2GN4A 4Y98A 5IFLA 1DIHA 3PIIA 3W8DA 3M2PA 2BRUA 1JVSA 2QQ5A 1EQUA 3N7UA 4EEZA 4FJ2A 4IJUA 1SBYA 3QA9A 4W9NA 3KETA 2ZYGA 2H1SA 4IJWA 2GCGA 1ZK0A 4CMBA 4CM1A 3F6YA 1KOLA 5I8WA 1BMDA 1K6JA 2EKLA 5TNXA 3TNLA 2GZ2A 4E21A 4NK4A 5EINA 3SC6A 1ZKMA 1ZZEA 3LT1A 3VKUA 1Q1NA 4CM3A 3B1KA 5L7YA 3RROA 1E5LA 3GG9A 2PR2A 3F47A 3W4IA 1RYDA 2HAEA 4JJFA 1I32A 1GZ4A 3C8MA 3WJ7A 1Z6ZA 4BQPA 3WNQA 1HDYA 4CLOA 1EZ4A 5HA5A 1Q2XA 3OM9A 3WICA 5FF9A 5I7EA 3NYWA 1HLPA 1Y81A 3CMMA 3QP9A 4NHEA 2WEKA 4H7PA 3QSGA 3MJVA 4QUKA 3ZCXA 4Q3DA 3IC5A 2A92A 4PLFA 1UXIA 3CE6A 3WGIA 5JXWA 3I1JA 4YXFA 4YR9A 3GMDA 4BKUA 2AXQA 4Z0PA 1ENYA 3GOHA 3HDYA 1JDJA 3Q2IA 2NU7A 3NEPX 1R4MB 3GF4A 2B4QA 3V1TC 6ADHA 3RASA 2CMDA 2QZZA 2CDAA 1YONA 4XCVA 2TMGA 3VZSA 1A5ZA 3TRIA 2AEJA 3ZU5A 1JAXA 1I01A 4EJMA 2B36A 4GBJA 1ZVMA 4F46A 3OJFA 1DSSG 1H0KA 1RYEA 1Z45A 5JCJD 3W6ZA 1HSZA 4Y67A 4IBOA 4MO2A 2J3JA 3WYCA 4FDAA 1X7DA 4CM9A 3JQ9C 1ONNA 1H93A 1VLLA 2VHWA 4IXWA 4XD2A 3WBFA 2AA3A 4BNHA 5MDHA 1P1KA 1H5QA 4NPCA 1MLDA 3C7CB 5CDGA 1PZGA 3KRTA 3MJSA 4S1VA 5JDCA 1KBZA 3KOUA 3VPGA 5A06A 3KXDA 4C7KA 5CEEA 1R4NB 2JL1A 5T6BA 2PY6A 4X54A 1R4MA 3WFJA 3NUGA 3PQEA 4KQWA 2R6JA 5A9RA 4GWGA 1BDMA 3HB5X 4ESOA 1NR7A 1XEAA 3RIHA 1LLQA 3ZNNA 3G79A 4PCVA 1M6WA 3O26A 5FI3A 1MP0A 4BV8A 3WMXA 4G5HA 1X7HA 3JQDA 4Z3DA 1ISJA 4JCOA 4OAQA 4HKTA 4YYZA 4RQTA 1ZK2A 3CZRA 2G17A 3IS3A 4XIYA 2EERA 4CV0A 3K92A 1MFPA 1KC3A 2DUWA 3R6DA 3FBTA 4AJNA 2GNAA 2JFGA 1DC4A 3KSUA 1XWFA 3SJUA 3ST7A 2X5JO 1GYRA 4OOEA 5JAIA 4KUGA 4IS3A 3V8BA 3DAPA 2QHXA 1B3RA 1MXFA 3QVSA 4CR6A 1YL5A 4OSOA 1H2BA 1ENZA 2O3UA 4GX0A 3PWKA 1A4IA 5ILOA 3P19A 4KUEA 3WYEA 3PVZA 3T4EA 4M55A 2YDYA 3MWDB 3FR7A 3U5TA 4IMRA 5COQA 4PLWA 3K2EA 4FN4A 4RVFA 4DPKA 3GEDA 5CHEA 2V6GA 2H63A 4XGKA 1GQ2A 2EJVA 1KC1A 3I9KA 4D3FA 3IDSA 3HDJA 4QT0A 3MEQA 2B4TO 4PLYA 2QRLA 3ZWNA 3R3SA 3GHYA 2AMFA 3IKTA 3GRPA 2O7SA 1PU2A 3AW9A 1G0OA 2O3QA 3GVPA 3I9LA 3ONDA 4UAGA 4IGFA 5JSFA 3C1OA 4NG5A 1LLDA 2FSSA 3C85A 2E49A 3E5MA 1DPGA 1O95A 1SEVA 5JC8A 1OI7A 1IHYA 4RLSA 1UXHA 1DEHA 2NLOA 3OIDA 3V1UA 5G4LA 4CMEA 5IZCC 2EP7A 4D3SA 3FF4A 4CQLB 2O48X 5JYEA 3WGGA 2O3RA 2Y0EA 2NQTA 4TQGA 3O9ZA 1S6YA 1U1IA 1QV6A 3MOIA 1WW8A 1GQQA 2D8AA 1CIVA 4ITUA 1QMGA 4BO5A 5AXDA 4ID9A 4W7IA 2J5RA 2ZIZA 4GWKA 1NVTA 3AM3A 2VYNA 4FS3A 1I5RA 3H65A 5JPIA 1JKIA 4BMNA 2YJZA 5ICSA 1CEQA 2V7PA 2UDPA 4DBVO 2RBEA 5DOZA 4MVJH 5BNIA 2C5AA 2J5KA 3KB6A 4KTVE 5AXBA 4EW6A 4FJ1A 4Q3BA 3EVNA 4D43A 2GSDA 3VZRA 3ZHBA 3H2SA 3GT0A 5TS3A 2VTDA 1R66A 5I9NA 1M66A 2XPCA 3ANMA 2NSDA 3WWZA 4CQLA 4RV9A 3QHAA 4FGWA 5HS4A 1EBUA 3TZCA 3ASUA 3LT2A 1NQAO 3OJLA 4AJOA 4BNTA 5CPBA 2FR8A 2IE0A 2PZKA 3PDUA 2EEZA 3RJ5A 1OC2A 3GDOA 1HZZA 1UDBA 3EC7A 1NFRA 1X15A 4UUPA 5JAZA 4IIVA 2ZCUA 3OJEA 4K26A 4GX2A 4CV2A 1K3TA 4D45A 4ZD6A 5ENVA 2SCUA 1PIWA 2VZ8A 3E03A 4RVDA 3LVFO 5JAMA 4CLXA 2YV3A 4U7WA 1UXKA 3H5NA 1A27A 2Q1WA 3OBBA 4BO8A 3O8QB 5C7OO 4RF2A 4Q3EA 3DBRB 4E33A 5ITVA 1DC3A 4E31A 3W4KA 3DL2A 4UVEA 4D41A 1NPYA 1UR5A 3ROKA 3KHUA 3JQ9A 5A3JA 1PS8A 3DC2A 2FZWA 5LDHA 5GZ6A 2VWPA 3GGOA 2I76A 1DRWA 2I99A 3PP8A 4GSLA 1KERA 3E8XA 1LUAA 3JQGB 1C0PA 1KY4A 1DIRA 4PRLA 5TIIA 4B8ZA 3I6IA 2QRJA 4Q9NA 4A10A 4J2OA 3ENKA 2DVMA 2PGDA 4BGUA 1IYZA 1NVMB 2PKRA 3CUKA 5L7WA 2P2SA 1A4UA 1KEPA 1PGNA 2BHLA 1VC2A 3O8QA 1BG6A 1FJHA 1BXZA 1HDGO 1NASA 1ZO8A 2QYTA 3DBRA 5JMPA 3WR5A 5BR7A 3IP3A 4K1LA 4R68A 2D4AA 3UW3A 4MVJD 2CFCA 4DA9A 3ZV5A 2W2LA 2JKVA 1NWCA 1X7GA 1LDNA 2CSUA 4MP8A 4MVJM 2X0IA 3RUDA 1EUDA 4EGFA 3BAZA 2WJPA 1GV1A 1KVQA 3CINA 3JQGA 4LISA 3M2TA 3PJFA 1VL6A 3BMNB 4C7JA 3AOEC 3D3WB 1DB3A 4FPXA 4PLPA 2G5CA 2PNFA 2OL4A 5IAAA 5BSFA 1U2GA 3GPIA 4JBGA 1PX0A 3VPSA 4ZGWA 3H9QA 3NJ8A 2VN8A 1TVEA 2OZPA 2NM0A 2IODA 4ALKA 4RVSA 3WIEA 5ITWA 2O2SA 1EE2A 1PZFA 5B4TA 5C5IA 5C37A 1ZFNA 3VVBA 1JKJA 1BDBA 2HMVA 3E82A 4ND2A 1DC6A 4NJMB 4DPMA 1SPXA 4Q3NA 3AU9A 5GMOA 5T5QA 1PWZA 1SEPA 2Y1GA 4MIEA 4BQRA 2O23A 3WFIA 3EY4A 4FFRA 1LNQA 1PL7A 3ZV3A 1BW9B 1TT7A 2GASA 5JCXA 1PGJA 2Y66A 4AJLA 3HDQA 1NFQA 1NM5A 1I2CA 1N9GB 1V3VA 3BMNA 1A7KA 2Y99A 4NIMA 4RF5A 3D3WA 4WNCA 4WCFC 1PZHA 5A05A 3KBOA 4NBVA 4NFSA 4Z6KA 5JO0A 1HDZA 2VRCA 4R3NA 2VNSA 1F14A 3AM4A 2OHXA 5BSEA 1Z82A 3SLKA 4O1MA 4P4NA 3U9LA 2VUUA 2Q4BA 5IZCA 1H94A 3FTPA 4GGPA 1UP7A 1EE9A 2PTGA 4PRKA 3D4PA 4TSKA 2VYVA 3TFQA 4IDEA 4YWJA 4NJMA 5T67A 4XDYA 2WMDA 1IL0A 1CF2O 4U0JA 4XR4A 4R3WA 2IDZA 2GN6A 1C0KA 3HG7A 1DFHA 3KM0A 4Z9XA 2DBVO 1IULA 1NPDA 1FDWA 2VOEA 5DBIA 3UHAA 2BFMA 3OFSA 4CUZA 4XRGA 3OF2A 1CERA 2X23A 1Y5MA 1N9GA 3ZHZA 4CLRB 2ZJ1A 3TWOA 3T7EA 3PLNA 5CP8A 2DFDA 3PTZA 1E3SA 4YB8A 2Q2QA 5COBA 4BMVA 2VT2A 5AXCA 4Z9FA 1N7GA 3PFWO 1I3MA 3JYPA 1W73A 3LLSA 2PH3A 3TZHA 1BVRA 1LRKA 3DZIA 1M2WA 1V0JA 4Z0HO 4CJXA 2VUSA 4R1UA 3ZNPA 4MDHA 1JLLA 3PDJA 1M6HA 1XR3A 3CH6A 1CRWG 2X5KO 1G0NA 1MV8A 2QG4A 2X0RA 4JLWA 4PN3A 3EK2A 1GEEA 3IJRA 3KLMX 4PLHA 2C7VA 3MTJA 3F9IA 4BGIA 1T2DA 4CLRA 2EXXA 3R3JA 1DC5A 3AI1A 3QWIA 1C3VA 3ETDA 3O03A 4BNFA 4RPGA 3X2EA 1OFGA 5L95A 2PZMA 3HJAA 3PQFA 4O63O 2GPTA 4BIIA 2JCYA 1AXEA 2P4HX 2QYSA 3ASVA 2ZB4A 1TLTA 3IJPA 4R1NA 4A2CA 1HDRA 5F21A 3DMTC 3A1NA 4W7HA 3UCFA 3Q0EA 3H4VA 3X2FA 4YRDA 3DQPA 3IUSA 3IIEA 3I9OA 1MG5A 2IEDA 3GFBA 3GZNA 2ZCVA 4ND4A 4AJEA 3E48A 4ZU3A 3T7CA 3OIGA 4CMGA 3OH8A 3W8FA 5IXSA 2BFPA 3DTYA 2WE8A 4ALNA 1N2SA 3MJTA 2X0NA 1IHXA 1O5IA 3U4IA 4WLEA 1ADCA 2G76A 2C0CA 4BL5A 5CEFA 2Y68A 2O3TA 3K73O 3S55A 1YBAA 4CM7A 3P7MA 1JQBA 1V35A 5A1TA 1HLDA 1B0AA 5B12A 1GY8A 2O3SA 3VH1A 2R2GA 2Q99A 4DGSA 3S8MA 3HN2A 4XB2A 2EJWA 3H2ZA 3KEQA 4URFA 2VZ9A 1Q7GA 3RFVA 4OOFA 1DLJA 2X8LA 4BMSA 1DJQA 3NDRA 2VWHA 3GZ4A 4EUEA 3QY9A 1NAIA 1WDLA 3F46A 3AOEA 4ZICA 1RM0A 4WCFB 4NR0A 4PVDA 1O9BA 2G0TA 4BNGA 2ET6A 1N5DA 4D46A 1O94A 1U28A 2FPPA 4E13A 4LK3A 2WYVA 4NI5A 3K96A 2NVBA 3RKRA 3V5NA 3B70A 2E82A 3E6AA 3JQBC 3SXPA 4YAIA 2DQ4A 5EQDA 3NTQA 2AQKA 3ROQA 2EGHA 3QWHA 1VSVA 1U8FO 2NU6A 5IJZA 1BTOA 1P3DA 4XYEA 1OAAA 3PYLA 2VTEA 3GUCA 4PZDA 4HX5A 1NX6A 4I9UA 1LSUA 4A5OA 3DONA 5KOIA 1P1RA 4M89A 4QX6A 3IMFA 3AFMA 1V3TA 5T57A 2ZB8A 4FBGA 5JFOA 4WCFA 3NX4A 4P22A 3B6ZA 3D0OA 3LT0A 3ORFA 1QYXA 1KETA 3WGTA 1CWUA 3HDHA 2HMWA 2VHZA 1UXJA 2FP4A 3DOJA 3GY0A 3KYCB 4GQAA 4PZEA 2Z1NA 4ZHSA 4BUCA 4DIOA 4NJOA 1IZ9A 5H82A 4FOOA 4DRYA 3EYWA 1ZBQA 1HDCA 1LBEA 1PQPA 1YB1A 1GUYA 2EF1A 2YYYA 1B16A 4E3ZA 3F4BA 4ZJUA 1QP8A 2C2YA 4KZPA 5DN9A 4EITA 4II2A 5TJ9A 1TB4A 1ONPA 4OXKA 1VL8A 3OIFA 3QVXA 3RFXA 4BNWA 5CAEA 2Y0CA 3SC4A 3MWEB 4XJSA 3PWSA 4AJ1A 4BNNA 1QYWA 1YXMA 2VHXA 1A9YA 1E0DA 3RFTA 4AL4A 4OJNA 2UV8A 1WAMA 3VVCA 1KYQA 3A06A 4FC7A 5IN5A 4XEHA 1GD1O 1VPDA 2AEMA 2YZ7A 4TKMA 4N5LA 4D3DA 1GQYA 2Q1SA 3KYCA 4RL6A 3NTOA 5JY1A 1ULSA 4TMFA 5L7TA 4QXMA 4TVBA 1E7RA 3BMOB 4CQMB 4I5DA 4XDZA 1B8UA 2GGSA 3GGPA 1PEDA 1T25A 1ZSVA 2LDBA 2WYUA 4ILKA 3TOXA 3GH3A 3OICA 3JD0A 4DBZA 4R9SA 1U5AA 1E5QA 3LDHA 3LYLA 1P1HA 2CZCA 3PHJA 4IXTA 4LRSB 5B37A 3INTA 3JV7A 3AUTA 2PD4A 5IDWA 3BMQA 5A3VA 2AE1A 4ZQGA 3TFOA 4LMRA 3UVEA 1WZIA 3F5SA 4O6VA 4JBHA 4DWVA 2GN8A 1DXYA 4E5PA 5HRUA 3GEGA 4BNUA 1NYTA 1GFSA 3JQAB 4R01A 1H6BA 4HNHA 1YE3A 4MIOA 4QFDA 1HL3A 1E3IA 1N7HA 5DP2A 4J1NA 2Q3EA 3GNQA 3WGQA 4YAGA 5A4DA 4CQMA 3BMOA 2C07A 2Y05A 3G0OA 1J5PA 1OBFO 1T1RA 2VOJA 4ONEA 1HDXA 3GFGA 3UH1A 4GVXA 4JGBA 5JE8A 3DBLB 1I10A 3KYBA 3UUWA 2WM3A 4F3YA 3I6QA 2NNLD 4E5KA 2D2IA 1R0KA 5DBGA 3DOOA 1P1FA 3MJEA 3RBVA 1ZXBA 4YRAA 3JQFC 2AG5A 3L9XA 4BO1A 2RH8A 1YJQA 3SJ7A 3FPLA 2VZ0A 4NZ9A 1XLTA 5J23A 1ADBA 1Z73A 4A27A 4JK3A 4HP8A 2UVDA 4LSWA 4WJZA 1TI7A 5G2OA 4BKQA 3PPIA 5DCUA 5EERA 2AW5A 3JQAA 4XYBA 4NQZA 2DC1A 4QSMA 4GX5A 4BNXA 2D1YA 3UF0A 3UICA 3ITKA 3JD4A 4BGVA 1F06A 2BH9A 3ZV6A 1A7AA 5JMWA 3TZKA 2JCXA 5A9TA 3AU8A 4P38A 4A26A 1YO6A 1GUFA 2GRAA 1T4DA 2VWGA 2EW2A 3DBLA 2NADA 2Y1DA 3FHLA 3KTDA 3CSDA 2X9NA 1ONOA 1SAYA 1IZ0A 5JS6A 1WDMA 3ETGA 1YS4A 2X4GA 3S2FA 4MVJA 2D59A 4Y6SA 1EDZA 3FCOA 3D5QA 1SZJG 3GUYA 4D79A 2J8ZA 4EUHA 2D5AA 2VQ3A 2BFAA 4CMCA 4WGGA 1ZK4A 1UDCA 1EK6A 4NU5A 3JQBA 4DREA 4XQCA 1B14A 5FWNA 4ALMA 2PZLA 3D4OA 3N74A 4GMFA 1BRMA 1VM6A 4M86A 4NNJA 4TZKA 4GL4A 4TRJA 3CZMA 1E1NA 4XQ9A 2HCTA 4J91A 4EBFA 1DFGA 1XG5A 4RVHA 1SOWA 2OBYA 1PZEA 1EK5A 4I08A 4J3FA 4J1QA 5B1YA 3FPCA 1FDSA 1NVGA 1NHGA 3ROPA 3ZU3A 3Q9UA 4KMSA 2HRBA 3OEWA 3S2IA 3IAHA 4U5QA 2D3TA 5L4LA 1ZNQO 2BD0A 4ND5A 3VTZA 1E77A 2WYWA 4LN1A 5EJ2A 2Q46A 1K0UA 4DYVA 3R1IA 3VH2A 3OEYA 3MOGA 1E1KA 4H16A 2HK8A 2QW8A 3PZRA 3A14A 4IQ8A 5JYDA 3TOZA 1BSVA 3LZ6A 4WE3A 1ZSYA 2B5VA 3UAGA 3ZWYA 1XYGA 3WG9A 1F12A 5TGDA 1B26A 1CYDA 5CDUA 2NTJA 5THKA 2B69A 3GPDG 5TRTA 3ZGYA 4BNJA 4YJHB 1GU7A 9LDBA 2O50A 4J0FA 3UGKA 4PLGA 2BGLA 4BO0A 5H81A 3KLPX 2NWQA 3WGYA 1I8TA 1RPNA 3GC6A 4ZVVA 4W6ZA 2Q50A 4WASA 4WNIA 4FFPA 1X0XA 2A9FA 4Q3AA 3BTUA 4YT4A 1PJ3A 1LC0A 5DDIP 2IYOA 2WD8A 2I67A 1I3KA 1T2EA 4ALIA 3H7AA 1L7DA 3E5RA 5ER6A 2Z95A 2PGLA 3L0DA 4N7RA 3WBBA 2UAGA 2Q45A 1NFFA 3DZBA 3RU7A 1QG6A 3VDQA 1IPEA 5EMHA 1HT0A 1LXCA 1JWAB 1TEHA 3EDMA 4P4LA 3WOHA 3QVTA 4J90A 3H9GA 3VPHA 1JVBA 4IM7A 2FHSA 3DFZA 4IGEA 1E6UA 5EPOA 4TRMA 4FC6A 3NT2A 4WLOA 3ZWPA 2I3GA 4YJHA 1Z7BA 4DVJA 4XRRA 3F3SA 4B4OA
chains in the Genus database with same CATH superfamily
2C4KA 3DG9A 4YT5A 4HADA 5BN1A 1TX4B 1ZK3A 1YZVA 2ORWA 1I33A 2VDLB 3GP5A 3SOPA 2WZBA 2ORVA 3L0SA 4QDUA 3U81A 1SIUA 2BELA 1OFIA 2EOAA 1GG5A 2V6JA 4Q47A 1VYTA 3F4KA 1W2WB 3BULA 3P9YA 1RT9A 2OORC 1IXZA 1NMQA 1CTQA 1P18A 3A3NA 3OIYA 4JLMA 5CT4A 3U1BA 4FQ5A 2I7TA 2C3OA 1MT3A 2VK1A 3L4BC 2HCRA 4EPXA 3O2SB 1JLRA 1OWMA 3IP1A 2ZSDA 2B8WA 4ZEMA 2IL1A 3FIJA 2H57A 4XWKA 2EZ9A 3WAGA 4E08A 1BWQA 2GPWA 5K3SA 4AAYA 4TTVA 3DE5X 4E2WA 2Z04A 4A6PA 3K20A 4DEXA 4R8LA 1IN5A 4C3OB 3PA6A 4UU1A 3QWAA 2J0QA 4HSGA 1RQ2A 1DAMA 1T0PA 3FNEA 5DTMA 2YFYA 2LTAA 4QFMA 2IP4A 2V6BA 2XZDA 3OZWA 5CDSA 1DWOA 4Q1VA 1W5FA 1S7CA 3R7WA 1MJFA 1JA1A 1KP2A 1N34B 3N2LA 2CYBA 2IHJA 3E3OA 2B20A 1N2IA 1A8UA 4LSGA 1P7WA 2AI3A 4Q48A 5ICFA 5TJHA 2A94A 3ZHXA 1NSFA 4QDTA 1TW3A 1Y5IA 5B2EA 4RPCA 3GJQA 5FOQA 1EUZA 2XWBF 4RTJA 4BLPA 1I7QB 2EKQA 4UULA 2Z2JA 2E4AA 3VR4A 4KR9A 1LDGA 1OBOA 5KYTA 2B4RO 2NSJA 4BRSA 5CA0B 5CFRA 5IULC 2I3AA 5ECDA 1T24A 4L0CA 2DAPA 3I2JA 3K53A 3OQJA 4I4CA 5JCOC 5CD1A 4F12A 4RXUA 4WPGA 2O0HA 2SECE 4KNWA 4MIKA 3DZJA 2VH5R 3HPQA 4MQEB 4NARA 4WMLA 4B80A 3RSHA 3WSTA 1ISHA 1ISMA 3PU6A 3OZSA 1YTUA 3KXLA 4KGVA 2CJXA 3PCTA 1UJ5A 2JI6A 2CL6X 2JD0A 2XUFA 4JIGA 1MO2A 2PGJA 2XA1A 3U31A 1IXKA 2OP0A 1E2HA 1XAGA 2DPMA 4BFTA 2IK8A 1ZESA 3H1EA 1C7EA 1RP1A 3PRJA 4Z9BA 3GCGA 1XRQA 2G06A 5KREA 4Y1FA 3ZE9A 4X6YA 5KPJA 8AT1A 1E3LA 1LH0A 3IQWA 3VM6A 3AWDA 1L5YA 3G1UA 1I2BA 4KXLA 4LYEA 2A2ZA 3AERB 1HETA 1JMVA 4WUVA 3GRRA 1CNEA 2JVKA 1YRYE 1Z28A 3B6IA 3G0BA 3NU1A 3Q85A 1B3BA 2BCGY 4XA8A 1T2NA 1SN7A 2O2GA 3KJGA 3R5SA 3UMGA 4GHWA 3WLQA 4B6FA 5D5PA 2HLPA 4Q9KA 1QVZA 2EIHA 1GITA 2Z2KA 3UBTA 2XQIA 1E6WA 4BCBA 3A6KA 4TQ9A 3NBKA 2CJPA 2H48A 1U0FA 1KSGA 1Q3TA 3VX4A 2RHRA 5ECGC 1J1IA 3L0OA 2UZ1B 1S89A 3PQ4A 2ISQA 3PEYA 1I2ZA 5DBFA 3CLUD 1H69A 3HN7A 1E64A 1ZIDA 2GK3A 4YASA 5AVXA 3PEWA 1Q0HA 3VBCA 1ULTA 2WKQA 4TZ0A 4NBRA 4JBXA 4M7PA 2FPKA 2R7MA 4LDRA 2WAMA 3M6IA 1JRLA 1ZSNA 2PM8A 4EPRA 2PZEA 2CZGA 2DSTA 3WIBA 1RLIA 2OGSA 1FOEB 3QX7A 2D2VA 2W98A 2BW0A 1ZCAA 2QYOA 5ALLA 1JIJA 2E4UA 1U3VA 4C4SA 2E18A 3V97A 3EB9A 4IJMA 3BD9A 2JI9A 4E0BA 2O06A 4C9BA 3GLTA 3G5AA 4DJDC 2P9CA 1ACMA 2I2CA 1BWSA 1SD1A 4PS0A 2JZCA 4ZARA 4AN0A 4BZWA 3QQPA 5LD2B 4BRZA 1CY6A 2FG6C 1WXDA 1D4AA 3I32A 1Q7EA 1WUKS 1QK3A 3C87A 2UZ1A 2RD2A 4FWIB 4F3NA 1X1AA 1G66A 5DW0A 4R5HA 3B7PA 4ZCQA 4EPTA 4L76A 3E3AA 2R7AA 3JCZA 1QS0B 1XZLA 1RLTA 1TRKA 2RKOA 4Q02A 4KEAA 4WN3A 3UAWA 1QSGA 1EVZA 1GG2A 1RJWA 1IVNA 1XZCA 3EULA 3QVMA 5FPPA 2XE8A 3EEBA 3EFEA 3SFVA 1JHAA 5IBQA 5K51A 1LDYA 4WLUA 3ZG6A 4F4CA 3IJEB 2FRDA 2G1UA 1J0AA 3UAXA 5LIPA 1YJ8A 3OU6A 1T0BA 3QEAZ 4N5HX 4LY0A 2J48A 2EDCA 2J9RA 1QIFA 4N9QA 4G25A 3EAQA 1DC8A 3P9XA 4AC9A 2WT8A 3K9BA 5DVZA 4RD2A 5T3UA 4QU9A 1ZG3A 3GJ5A 2VL7A 5ALKA 1UAGA 1VLZA 1QE0A 1T9BA 3E9RA 3IP6A 3IVAA 2H4ZA 4IRMA 1YR1A 1P17A 4EB8A 4EFNA 2F00A 4RIIA 3SYLA 3HV0A 2ZS8A 3KUUA 4FYIA 2AJBA 4G1MB 3GARA 2HMUA 1P45A 4A0SA 1BA3A 3CR7A 3TQQA 4L75A 1WZNA 2ZRHA 4OMFG 2ZKIA 5AVSA 4AG5A 3PLRA 5L4NA 1OREA 1A4RA 1UKBA 5H83A 4R71A 1IMJA 4NWIA 1H6CA 3SEFA 1QS0A 4BKPA 5L51A 1S9DA 5L6LB 4B6PA 3IT1A 3QE3A 2AC7A 1JS1X 1I9CA 3DJYA 4IDDA 4X6XA 5LDDC 1MZPA 3AF1A 2YH2A 3DO5A 2JRLA 4IJKA 1VA4A 4M0LA 3UJBA 1NNLA 4NPHA 4Z7NB 3DAOA 1N1GA 1F2VA 1SWWA 2R87A 1S2OA 1OILA 3L4SO 4W4TA 5EVJA 3TTYA 1VL0A 2DYKA 5EYPB 2C4WA 3GJSA 1SUSA 2BGNA 4DMGA 1DCMA 1GLGA 2XB9A 2GJ4A 3JD3A 1KZGB 2DUMA 4KDFA 2E3JA 3ZR4B 1FVOA 1WO8A 3RS2A 3GPLA 1NVFA 2E48A 3K30A 3OVMA 3H5OA 3OSUA 4RHCA 1NBME 4NBTA 2VDKB 4MH0R 3VR5H 5FIUA 1UFQA 3IA2A 3ZQJA 1TCCA 5JI2E 4KREA 1NXPA 1OLXB 3BIOA 1FSFA 2MSKA 5HKKA 1V7CA 2Q7XA 3TB6A 3QKSA 1YOVB 2RHWA 1SKYE 3HBJA 3P9IA 4R7GA 1LPAB 4F04A 1N8TA 2CLCX 2DWQA 3LGXA 1EPUA 5AHOA 4YQYA 3GZNB 1CRZA 5KJEA 4J2TA 4E5YA 4D4HA 1ORTA 1U7ZA 3ME5A 2Q2WA 3D4LA 1T5TA 3MT8A 2ZWPA 1G8MA 2A33A 3NW9A 4X45A 1XKXA 5TB5A 2I03A 3EAGA 5TPZD 2K7ZA 4G85A 2H29A 5KVCA 2HJSA 3ZW8A 2JLCA 5F78A 4WXHA 3WKEA 2FPWA 2FWMX 3ER6A 3F5FA 4N8SA 4EP1A 4QT4A 3VPBA 5EYPA 2GBIA 4KI7A 5T4HA 3LDGA 1AH2A 3FR8A 1M6YA 2YXEA 1B43A 4QBIA 4TUYF 5DBOA 3ASZA 4KRYA 5E2BA 1WXIA 1RC8A 3IAS6 4JAVC 3T9CA 5FFFA 2ZROA 3AHDA 2JI8A 3L0YA 5IC5A 2J87A 1GSOA 1JQJC 2F1IA 4DN6A 1OH8A 3ACBA 2V7EA 1TK2A 4TMKA 3KSZO 1R12A 1OPRA 3I9NA 3IOMA 1XJ0A 1VIMA 5TV2A 3DF9A 1OLXA 2I6FA 4GXTA 2BRUC 3ZQ6A 5JARA 1EX7A 1WLYA 2P5UA 1DDGA 1YOVA 3W5VA 4CDMA 1YR6A 2IP1A 4F60A 2QD3A 5KYUB 3NHAA 3UH0A 1AMNA 4CVNA 4D97A 1H8HD 1PR3A 1RYMA 3A2LA 4G5OA 4LZNA 2PCLA 1T2VA 2ZUVA 5B1IA 1QB7A 2X76A 1PWHA 1C9EA 4MWSA 3GLGB 2CCGA 3D64A 3I39X 1ID1A 1NATA 4TL8A 2BR5A 2VPWA 1PT6A 3JSXA 3NHRA 4J76A 4IIEA 3CJQA 2BAGA 1TZMA 3NCTA 1CZOA 4XQGA 3ZEAA 1JPUA 3D1LA 4PG6A 4WH0A 2YY6A 3ILSA 4HQLA 1WCWA 2VHQA 3C5CA 1RWVA 3C3BA 4BNYA 2OY0A 2AFHE 5LB4A 2XD4A 3S44A 4C29A 2WAXA 4KZKA 4BS9A 4DWOA 4YH1A 2VDPB 1YQDA 4P08A 1VTKA 1ANKA 1VLVA 2GUWA 2R65A 2RAVA 1P3Y1 1A1VA 5EHNA 4QPJC 5I4CA 3N9IA 1GYQA 1RMYA 3RF6A 1XELA 5LWHA 3RI3A 4MV5A 1OROA 5FBLB 4AZ0B 5JJCA 3L8EA 2XYVA 5F2OA 2XLCA 2OK7A 1Q1EA 4I4LA 1DBSA 4ETMA 5KYUA 2PWAA 2WZCA 3EPPA 1Z68A 4OHRA 3ZOKA 2CXNA 2QAGC 4YT2A 3WLAA 2RGAA 5HOQA 1N7JA 3I92A 4OH1A 1KIFA 3R7LA 2QD2A 3A1TA 1LTHR 1X0VA 1O0SA 3ICVA 1YZGA 1ZD5A 4AZTA 2QU8A 2GPNA 4DC9A 2ODPA 3DR3A 1VJRA 3QLEA 4GRAA 2C8JA 2Z6UA 3PHBE 4AUEA 1GCAA 4XPIB 3L8DA 1X87A 3P2YA 4CKCB 2NMVA 1NBOA 4B4VA 4B17A 3K8ZA 1R8JA 4JELA 5HE8A 1IB6A 1K7FB 3D2CA 4QASA 1ZD2P 2YVLA 1MORA 4I1OA 4LV6A 5G0UA 4ZVOA 3TE7A 3ETCA 3K71B 2QOEA 5G1PA 2IPMA 1BZYA 2G88A 1Y5LA 3RVBA 3IULA 4CMHA 2ZTUA 4Y2SA 3I5YA 3EY9A 2L42A 1YQWA 4X92A 1XPRA 1OE0A 2IHTA 1JJVA 3IUBA 1C14A 3NORA 4QEKA 2RAPA 3F90A 1JZQA 4AZ0A 1PGOA 3W5CA 2FLKA 4ITVA 4UHCA 1G38A 3OLYA 3SEZA 1FFGA 4FCCA 3TJMA 3W5HA 3ZWXA 1AK2A 2CVHA 1Z4MA 2PFKA 4TTPA 4M83A 1O6BA 3ISVA 2FN7A 4FYXA 4IZHA 5EE9A 2PMEA 4MCIA 3AIOA 5EE3A 5C7IO 2TMYA 2HU2A 4CF7A 1YL7A 3WMEA 3KJNA 1XLWA 4KH1A 4XWGA 3OPQA 1SHKA 5H3CA 4I5FA 1RAIA 2ZDGA 3O73A 4Q00A 4XPIA 2FOIA 4CKCA 3QUQA 1RYYA 5CVDA 3OQMA 1TM2A 4QDOA 4F97A 2J1LA 1J2EA 4WJLA 2I4IA 1OSNA 4A23A 3ONVA 4RGVA 4ZI5A 3ONFA 2BF7A 1PBTA 3A1EA 1MT0A 3L7DA 1AGRA 1GYPA 4IO0A 5JVDB 5H9WA 1Q3KA 4D8TA 4HVCA 2F4VB 1OVGA 3WKBA 1XCJA 5IAJA 1LWNA 2BGKA 1L5FA 2AN4A 2YVUA 3ROMA 2H0AA 3NB0A 3SYNA 4AG6A 4UDNA 2D2FA 5EWMB 4QUJA 4ZQBA 4X1IB 3V42A 4BO6A 5IF9A 2L19A 2VJQA 1UJ2A 5I7VA 5IK2D 4AW9A 4L4SA 1T2FA 3FHJA 4PEVA 2IEIA 2NUAA 3LPCA 3A32A 3O1LA 5AICA 4RC9A 1N7IA 3A6ZA 1D1TA 3C5WP 3PZBA 1F8GA 3WJ2A 2ZYVX 3GNTA 4D9HA 3KHTA 4Y9UA 3AKDA 5G0SA 4N03A 4FD3A 4GI2A 1F0YA 3BRCA 4Y8VA 1RKBA 5CFZA 3W6UA 5D1NA 2EGUA 1HKUA 4JZYA 4M3NA 4E2YA 2RKBA 2VQDA 4Q39A 1TQ8A 4RPLA 1X1TA 2YW9A 1QGOA 3WLOA 1T0JB 5HF6A 4ND3A 3TRJA 4ARVA 1KOGA 5CMLA 1SQ6A 1YZQA 1ZEMA 5FI1B 4F4DA 5JVDA 4GZ6A 3P71T 4M4SA 3ZLUA 5TT0A 1UQRA 1CZKA 3FKSD 1DCTA 2UUAB 5BSMA 3GOQA 2IYAA 3ZVLA 3UY4A 2VH2A 4BV3A 2JIOA 3A9RA 4PQFA 1FNDA 3E1GA 5EWMA 4BO4A 1UXOA 3THWA 1W30A 1UBKS 4RO0A 3ICWA 1JI0A 3O82A 4X1IA 3EGCA 1N2EA 4C88A 3B6MA 4G5YA 1T34A 2CF6A 2R4QA 4LXGA 4RF3A 2OKCA 4F5YA 1HT1E 3BSWA 1NXOA 2GF9A 1G21B 2P65A 1ODIA 4J7CA 3NAGA 1LY1A 3IB3A 2IUUA 2KMLA 1Q16A 1G2IA 1RAAA 2AQHA 5A03A 4DUGA 7GPBA 1MEOA 2BMFA 2X9QA 3ESQA 4HDOB 3ZW7A 1H66A 4YJ3F 1JWBB 4BB6A 2BFOA 2R7LA 1NQVA 4D82A 3H2IA 3DKKA 3ANSA 3EIEA 1E6CA 1P61B 4PG4A 1J7KA 1BU5A 3CNBA 2C4VA 4HN9A 3DGEC 3ND7A 3TEFA 5JS1A 1WW3A 4LSMA 1B1AA 5IG2A 4PBRA 4ZO6A 1C3XA 4MKXA 4L4ZA 3DPSA 1SBNE 1H2EA 4YCCA 5HM8A 4WOJA 2GXUA 1KL7A 1XA4A 4FMDF 3ML1A 4QGAA 3VR3D 3X43A 4A3SA 4EG7A 3MYRA 3H04A 1W5EA 4YAOA 2PLAA 4G0YA 1JEDA 3PD1A 4NU6A 2GHIA 3GEMA 3L6DA 5KTSA 3MERA 4M38A 4MQ5A 2CKMA 4GC5A 3P9NA 1F8UA 1WY7A 1JU9A 3BKXA 2W6ZA 4D56A 1G21A 1W29A 2YCLA 1OV6A 3G23A 5AVRA 3QPAA 1MJ5A 1V7QA 4C4RA 3NBMA 1A50B 5FB3A 3GB9A 1L7RA 2YCBA 3MWLA 4RW0A 2DJ5A 1FMLA 1UWKA 1NG1A 3FTEA 2VWQA 2C82A 2EL7A 3ER8A 2OTCA 1DPFA 2VF5X 1XLVA 1DOAA 1N9KA 4MV4A 4YIHA 4GI3A 4B3GA 1RKXA 4EDFA 3K0BA 3JZDA 4BFYA 3KOOA 1H42A 3TYXA 1UOQA 2PPVA 4A2WA 1OFUX 3GWGA 2J6HA 2IOFA 4UVHA 2IY7A 1KP3A 2WVJA 1YJCA 4FHCA 1KJJA 5AUNB 2WDZA 1ECJA 5B7PA 2JGEA 1ZCFA 3AG5A 3T0FA 1YR2A 4WJKB 5F5XA 4YY3B 1BGWA 1ZN9A 2O05A 4IX9A 1SKMA 1QH0A 1NSYA 1VFNA 1G5HA 1L9KA 1G7RA 2DTEA 3G8CA 1GPWB 3HCEA 3I52A 1KJ9A 4L8WB 2HX1A 4HATA 4L5AA 3GU3A 4ZAVA 3SE0A 4DWWA 5GZ3A 4M1OA 4FI3C 5AP9A 5JY6A 2V6MA 1UMKA 1XK7A 1LRJA 1TJ3A 4HO1X 3AFIA 4IEIA 4JBWA 4Y1EA 3RUEA 1PS9A 1YCGA 5LYJF 3NDJA 1XVTA 3M4XA 3DEYX 2VT3A 1F4LA 1C1XB 3KEMA 4FK8A 4P3XA 5JLAA 1L8LA 2QMOA 3DQQA 1A2QA 3ND9A 2DCMA 2JIPA 4Q6BA 5EXTA 4HH0A 3PDCA 3AHJA 2HH9A 3IQHX 4PGGA 5EIOA 3W78A 1PD0A 1THMA 3AH8A 2JAPA 3U48A 2ZAIA 3LSYA 3BXFA 2BIFA 4LOHA 2VT7A 1SU6A 4L6AA 1KDTA 2ONJA 3CO5A 2XCOA 5IVPA 1LC3A 1M1YE 3LDFA 4QYMA 1DU4A 3I9FA 4O1IA 3E8SA 3IUNA 5C0OE 5LU9A 4N6OA 2ZIEA 4PAQA 4QBHA 2IHKA 4UASA 4TKUB 5EVCA 1E0SA 3OMWA 5LQDA 3KD3A 3IQIX 1K9VF 3LT5A 5I4KA 2RARA 4C0QC 3E3NA 1GKUB 1QHEA 1R0LA 4GSYA 1O6ZA 3OUUA 4BJ5A 5EP2A 1UP6A 2NSLA 3VYSB 5MGBA 4NEHB 1SXHA 3T7DA 4BO9A 3VHRA 2HNAA 2JIZD 3M3PA 1RWOA 3OIVA 4QUAA 2RI0A 3GQBB 1C1XA 1G9XA 1SPBS 1YDWA 3UXYA 4LHXA 1JHXA 2IVZA 4NCAA 1BKDR 1OR8A 1KY5A 4FGZA 2JD1A 4DUPA 4KLAA 2VCEA 3IOYA 1H3NA 4U7TB 3T5BA 1O94D 1Q0QA 1F0KA 2ECKA 1XIVA 1YZ3A 3AL2A 4KIUA 5IUJC 3HXMA 2C4TA 1VMKA 1MQSA 5EUBA 1Z6AA 4UARA 1PO7A 4ZVTA 1FMCA 4DWJA 4Q12A 4XDGA 1R7RA 4B3TB 1EFRD 1PQWA 2ZJ3A 3DXFA 4R4JA 2H2IA 3B2EA 1PQUA 1CF9A 3V33A 2PYZA 1NUPA 4TKUA 4U7DA 2YV1A 1U3CA 1KY3A 3WQHA 4AROA 3HP4A 4ZYUA 3B3GA 4NBWA 1J56A 2FYTA 4JXKA 1JIQA 2R1VB 3GRKA 3HFGA 1AZTA 4DR7B 2VA8A 4NY1A 2JFQA 1HE5A 1F48A 4OGWA 1OFUA 5KI6A 2G80A 2ADFA 1SXJC 1NV9A 1FSGA 1UDAA 2XF8A 2Z2XA 3GQBA 3JYNA 4JCCA 4PZYA 3I42A 3TCKA 1QKIA 1N4DA 1ZQ9A 3DMYA 2AB0A 1PYOA 5BSKA 4GOND 3GZTB 4DJTA 2NO5A 1ZD8A 1EI9A 4IFEA 2LXNA 2WRZA 2JJ8A 3FVQA 4UXHA 2ZZKA 4Y2GA 3FMGA 5C1IA 2EWMA 2DKNA 3RTAA 3Q7QA 5J1TB 4L7VA 3L07A 3QGMA 2YYAA 4BZZA 4KQKA 2HGSA 3TG2A 1ECPA 4M1MA 3VAZA 2PKQP 3D4NA 5IT9A 1RPTA 5CG1A 2SBTA 4LYJA 2YVAA 1IPFA 5F5NA 1FJXA 4FZ3A 1KS9A 4R2XA 1HNZB 3H8VA 1NUSA 3Q3IA 3DEFA 4EIWA 4IFIA 1FFWA 4QL3A 5FCDA 3DVAB 3A9TA 1U3FA 4DCOA 4ZOQI 2JIQA 3CF4A 3QWFA 1QK5A 4NDAA 2R60A 2R1VA 3WNVA 1AU9A 1LTKA 2WTNA 2WTXA 4HDRB 4IYJA 2ECOA 4MAMA 2HD4A 5ER9A 4BDTA 2A84A 4QQRA 3KHKA 1T9AA 1O5TA 3KDAA 5C9ZA 3B3AA 2G9UA 5A5VA 3CW8X 3CG0A 4KBFA 5LUBA 2IBTA 2CJYA 2JHAA 1P4HA 2Z3ZA 2J32A 3MTAA 4KV7A 5J2TF 4EK9A 3C4JA 4XSHA 3TSCA 4EKYA 4RH0A 3GLSA 3QVWA 4GVLA 1G20B 3KE8A 2SNIE 1NP7A 2IXAA 1Z74A 3EW7A 1HOTA 4MWCA 5F9MA 2VUTA 4JROA 2QNBA 1OFHA 1Y6RA 2PL3A 2VDRB 3CH4B 3DKIA 4WTOA 1TO1E 2XWSA 4HV4A 1JFFB 1PFVA 3HJBA 1E1DA 3LGAA 3O38A 3U7GA 5FTWA 4W9MC 2PUAA 4XWAA 4I19A 2X42A 1E4VA 1U1DA 4R2LA 4BBJA 5K01A 1WB5A 1R0SA 1FDUA 1JV2B 3WWYA 1V11B 1IY9A 3K4HA 1IN8A 1XQ9A 5K0JA 1KEUA 1KRXA 3JQ7B 3BJZA 3DVAA 1AN9A 1Z7YA 1DZIA 3DXXA 2XMCA 3FTFA 1PD1A 3HABA 1Q20A 1KMQA 2HPVA 4JFAA 5SZJA 1P0CA 1DVRA 4HDRA 1Y33E 1AQNA 1KMHB 3W5UA 3TGWA 1Y82A 2J9YB 2OP1A 5JCZA 3MIZA 1GZ3A 1MXHA 4JOQA 5BYAA 4OQNA 3A4MA 1YZNA 3OTGA 4BNVA 1OHHD 2ACKA 1OUMA 4LVNA 3AVTA 3M8KA 4J3JA 1PR6A 2ZQYA 3EDOA 4DANA 4HEHA 4H4DA 1YUMA 2GO7A 1JHUA 1BHO1 3FGPA 1DGQA 1XHLA 1CUEA 3U4CA 1JR2A 4UD2A 3GNSA 1SU4A 1JNYA 1E2DA 2D0OB 2PH5A 4FOSA 5DV9A 4ZTUB 1DAPA 4IJVA 1JLSA 3SOZA 1H0SA 1JFFA 1HI9A 2PKYX 5TSDA 4ENVA 1H2YA 3WYFA 1QMPA 2PZFA 4WOKA 1SMKA 4BUZA 2PN1A 3L6CA 621PA 3RHSA 3AQ4A 3TL2A 4F4IA 2FUG6 4LJ7A 4F9FA 5JZVA 1VHJA 5GTDA 1YRLA 3OQBA 1V11A 2GFIA 2E1PA 1XX6A 3L0PA 4UNNA 3JQ7A 4NONA 2XGGA 4JA2A 2WINI 2QRGA 5DJ5A 4L73A 5HCNA 3RIGA 3T06B 6Q21A 1P9RA 2R5WA 1DIGA 1JNXX 1ZUD1 5K4HA 3STWA 5BR4A 1KMHA 2LKCA 3B1JA 2JFYA 3DEAA 5EL0A 3UMSA 3K2QA 3TGPA 3IPAA 3KU1A 2VJBA 4BKOA 1HRDA 1YHZA 2JHGA 3C2QA 1LLCA 2FP3A 1U9JA 2VP3A 2XOXA 3FFXA 4B6RA 1OJ7A 4N5MA 1M76A 2AYYA 3GGDA 4NOJA 4U9UA 5C2JB 3AOGA 3LBAA 2TRSB 1HG0A 1R8YA 1K7EB 3FSJX 4IDQA 3SIRA 4F4HA 1E79A 1TF2A 4KJZA 1HYEA 3W2EA 1IATA 4MX8A 4N0EA 4OJMX 2PRIA 2HYDA 4RA6B 2AIRA 2ST1A 1GTSA 3GROA 1IFXA 4UUBA 4K6FA 3PEEA 3CX3A 1IAQA 1OCEA 2AFIE 2GARA 1P6UA 2YNMD 4O2BF 5F3RA 4CKEB 4W5QA 2QTZA 4M0UA 2R1UA 4JGGA 4R5MA 4ATNA 1C30B 3BSSA 1J2JA 3BCUA 3UYKA 1V47A 1Z36A 4WK4B 4MW4A 5CLIA 1QU3A 3BWDD 2GN9A 4FYKA 3WAJA 4M53A 4LC0A 5G4KB 1X3SA 3H1PA 4MUMA 4CM9D 2VDMB 1PR9A 2G82A 4LX0A 3GRZA 2BE9A 4ESHA 1RLOA 1Z12A 4BE4A 3E9EA 3TECE 4DLTA 4ER6A 4YI3A 2J3IA 2VJMB 3MRVA 1OBCA 1Q44A 4QFBA 5AKYA 2ZR7A 1PDWA 5BMVB 4Q9HA 1DX4A 4GGMX 3UPTA 4KXWA 3GMSA 3M1YA 1WD7A 2PT7A 4GXNA 1NUQA 5WRFA 4OKIA 5KYNA 3HK2A 1LU9A 3GXBA 3LHIA 2C2HA 1ZR2A 2B37A 3IVXA 3L92A 1C4KA 2Q5HA 2PSFA 5A3SA 1V1MB 4B0PA 5LDGA 2VDVE 1VJCA 4IIUA 4AS2A 4NNOA 4AKEA 1P44A 4RA6A 2P75A 5DMHA 1KH2A 4N7JA 4YCDA 1XZNA 2QJRA 4CKEA 4ARUA 1FRNA 1WUTA 2H1IA 2H4XA 4UMEA 2NQ2C 3U49A 3WQRA 1C30A 2GI4A 1MHPA 1BDIA 1NXXA 3BE5A 3UBMA 2WHPB 5AKXA 2Q6VA 3QOXA 3VZQA 5ESWA 1WOYA 5G4KA 2ISCA 5KAPA 1IY1A 4OI4A 1B6SA 3DLTA 2IUSA 3AI2A 4GNKA 5K0NA 3HO1A 5T4BA 5HVNA 5KJ1A 1L4BA 1ML3A 2RCYA 2G9ZA 2HU8A 3LDAA 1R0XA 2VJMA 3Q40A 2FJPA 4RVGA 2FQWA 5BMVA 2Q2VA 1C4XA 4BYMA 2ORIA 2DPGA 3AC0A 1CVIA 1P3JA 4YDHB 2X41A 3C8UA 3PFFA 1NAHA 2JLSA 5DASA 5J40A 1F20A 3IHKA 2QIPA 1WXHA 3E27A 2HIGA 5G1OA 1IY0A 4M7OA 3W7VA 5ELXA 2Z6QA 2HLNA 3NBZC 1V1MA 3GNLA 1G8AA 5DCWA 3D8SA 2CF5A 4MVWA 1M7GA 3ZY6A 5AIBA 3L7MA 3ELUA 5KZMB 4LYFA 1BGXT 2V6FA 1MOZA 2IDJA 1JQKA 2OORA 2QUJA 4WLVA 3SX2A 3GEIA 5A5DA 1P2SA 5CU7A 1U9CA 1T15A 3C3PA 3L4BA 3ACCA 1GRCA 4QOFA 3E9MA 4UUMA 1U2DC 2XADA 4IKPA 3OEED 3TZ6A 1K63A 2H07A 4PZUA 4O33A 3GDWA 4D4IA 3T9EA 2YR0A 3A2MA 5SYNA 4LZWA 2JAWA 3LVQE 5I7SA 2P5YA 4DLZA 5LIRA 3BXXA 1D5CA 1BYIA 5DLDA 3PNVA 1FBTA 3PUJA 4MV3A 1S8AA 2R8EA 5HHTA 1BW9A 1GPLA 1E20A 1IZ7A 5DIFA 3KCNA 1QZ3A 2O7VA 2RH4A 5C5DA 1H4QA 1GARA 3WP1B 4RCVA 3JVVA 3OQIA 3SQDA 2XCSB 5IAKA 3TBHA 1NURA 3ZNQA 2FUKA 1KI2A 3RUHA 4UMFA 1E7WA 2G4VA 5ENDA 3T9AA 1JR3E 1VSQA 4B45A 5F51A 3AHHA 1QYDA 2CLDX 1CB7A 3GUHA 3UIEA 3G0HA 4ZQEA 3GLHE 1WDKA 1L5KA 1JFRA 1O5OA 3SKXA 5LKRA 2VJCA 2VG8A 4FIDA 3B9PA 1ICIA 3SP1A 4KN9S 4A5SA 1U3UA 3QJYA 4HS9A 4XLZA 4XM0A 2FAXA 1L4FA 3TDMA 2GILA 3EDCA 3K5IA 5KPDA 1ILEA 1T6XA 2QR3A 2RIRA 2G4CA 4DA0A 4GEKA 4D0SA 1LRLA 2EYQA 4RKFA 1GFWA 3A4LA 1DOHA 1P62B 3BXZA 2O8DB 1EWKA 1E1CB 5CM8B 4DMUB 1VJ0A 1V8BA 3JQCA 1ZCJA 5HFAA 5C46F 1HYHA 1USIA 1RQPA 5HCIA 3U16A 5AM4A 2Y1EA 1J6UA 4YN3A 2ZBEA 4Z3KA 3GPCA 2O1SA 1U7HA 5J59A 4KOEC 3IUPA 2MHCA 2PUVA 3UB3A 3G1WA 1JQ3A 2C5SA 2XVYA 2V74B 3CNQS 3WGUA 3PUWA 1U6JA 4IICA 3ZTTA 2UZ3A 3NEAA 2QS9A 4BRUA 3S3TA 3D3NA 2LP4Y 1SC9A 2JGNA 4G2NA 4FINA 5K09A 5JS8A 4DB2A 3GRFA 1OZAA 4QJBA 4D8VA 2Q62A 4YPVA 5HS6A 3L6BA 5CT8A 1FDRA 1G291 4NCXA 2H5LA 2DWOA 2YJNA 3NALA 1VI5A 3MS7A 1QO9A 1HTTA 3F6SA 2E55A 4ZVLA 2RGRA 3HDTA 3TLXA 2CBXA 4Z4HA 1V71A 2XOKA 3N7TA 3JQQA 2VNAA 3OKPA 3CXRA 4M1ZA 5TS2A 1FQOA 3VYWA 4B5LA 1VCNA 2XV1A 5A62A 4J94A 2ZYUX 3KT8A 5H70A 3PNSA 3ONEA 2X6TA 1M2VB 3GRUA 4QEZA 3R8XA 1DBPA 5AW3A 1E1CA 3P9CA 4DLAA 1KJQA 4MZDA 4AZ3B 4EA9A 3TBFA 1XQVA 2IBMA 3K94A 1XMXA 3H5AA 4AJHA 5C1DA 2IHZA 3BWYA 3H9UA 3GFFA 4H0CA 3CQ9A 1QP4A 4NESA 2CLFB 3PF8A 3JALB 1QF6A 4WXMA 5KWVA 2JJYA 2WJIA 3FTDA 1AMUA 2PMBA 2WU0A 4URXR 1GL9B 1KDZA 3LC7O 3BB4A 4NYJR 2ZK7A 3GA0A 3HB4X 1KSJA 1S2LA 5EZYB 4BZXA 1FRFS 3MA0A 3NDPA 4B3IA 3HCWA 4F6CA 3TNDA 2QD4A 4MP6A 2QL6A 3FGZA 3WL5A 2Y93A 3L8HA 3NPAA 3AMVA 4JUAA 3D5EA 3RE1A 5K6TA 3GGCA 4KOAA 1VMEA 4OVKA 2WTEA 2XWPA 2QQGA 4QUGA 4U00A 2WHXA 5TE9A 2OECA 5I9LA 1W34A 5BQFA 1BGVA 2C59A 1KKUA 1SHJA 2FI1A 2XRFA 4ZCMA 3WJAA 4F92B 3AQIA 3S28A 3K1ZA 2CMFA 2EFDB 4FN5A 4EZIA 2VBIA 1EDEA 3BFVA 4JT2A 1M54A 4ALLA 1MAVA 1W1IA 2YV4A 2PEZA 1QWOA 1M2VA 3DHWC 3KJZA 5TMDA 4DMFA 4RTKA 1ODCA 1SFRA 4AZ3A 3OU2A 1Z6YA 2QYHA 3AYXB 3HB7A 3K9NA 3O8BA 2FFAA 5KKAA 2YTZA 5JYBA 4FP9A 1QU2A 1YI8A 3CMCO 1MKYA 4G81A 4YRZA 1RM4A 1TO6A 2ACEA 2EU8A 3JALA 3GP8A 4J0CA 3PC3A 3MJCA 3OE7D 2PIDA 1FYFA 2GRUA 4X8HA 4AVYA 4FEYA 3PHHA 1N3YA 4G0MA 1WWKA 5EZYA 5BSHA 3BA1A 2JGJA 4PO1A 2QL7A 4M1QA 4Z1OA 4IILA 3FETA 1MX3A 2R2AA 4O4HF 3ZH2A 3QFFA 5HMMA 3G89A 3ENWA 3NDIA 2C54A 2GO1A 1KAQA 3A1WA 3DCNA 5CCDA 4Z4QA 2OBXA 2BM9A 4W6QA 5ALZA 5EE5B 4M9CA 4BP8A 2YJTD 3TVYA 2X14A 1QP0A 3LQRA 1C9MA 2B25A 2YJGA 3DOEA 5BUSA 5C5EA 4BQOA 3GH1A 1G55A 3S8YA 2D1SA 1ULUA 2VHVA 2CXPA 4TXMA 4ZYWA 3K70D 3UMCA 4ZCIA 1M1UA 3IDAA 1OU0A 1NN3A 5DGCA 1ZMXA 1K7SN 3ZLVA 4BLSA 4D42A 2WKSA 3HCCA 4ZQHA 3L6OO 2DTDA 1RWBA 1YS1X 1GPJA 1ZJ6A 2NAPA 1EHIA 2WV9A 3WGHA 5COAA 3MGCA 2E89A 3LQ1A 1NVDA 3KL2A 4N4AA 4JX9A 3TNFA 3Q98A 421PA 4BJ6A 3T34A 1KQ3A 3C45A 3LIIA 2J9GA 3W7AA 4DAOA 3M6AA 3QLJA 3UAOA 4LMPA 1P2BA 4LRUA 1JILA 1CUZA 2ASVA 3LVRE 4Y0VA 5CHYA 3NXSA 2LW7A 3D4BA 4B3XA 5KTYA 4GO1A 1UBOS 2PT9A 3G1TA 3VMFA 3VHQA 1RMQA 3M4JA 4TKLA 3WHKA 1JG4A 2OD9A 1OOEA 1XV5A 2ZR0A 5BOSB 4JUIA 2PKWA 4LPSA 3UHOA 4BX8A 4DIKA 5BNZA 2GA8A 5HF9A 4BOYA 1YFJA 4R16A 3WLJA 1N2GA 1JQAA 4EI2A 2VK4A 4U2CA 1Q0SA 2R5FA 3CY6A 1RYFA 3DGFC 4HFNA 3BGWA 1RAFA 3I6BA 3WLTA 4P4UA 4D9IA 2O8VA 2NTNA 4KYVA 4BAGA 5DNUA 5D01A 4V2IA 3W6PA 3JVUA 3GVHA 4EHDA 1AKWA 4RZQA 3RS8A 4UCQA 3W1VA 3IEUA 4ED9A 5CYGA 1R16A 5IM4F 2GD6A 1XAJA 2EFYA 3AUUA 4MZXA 4NFLA 1THZA 5FBRB 3T61A 1SVWA 2HW8A 2ZJOA 3OA0A 1NVVR 1PYDA 1VZ3A 1P7VA 2O57A 3CWZA 2C4HA 3DFUA 1EHYA 4MI1A 5CLGA 5FFMA 1O95C 4C2BA 3AHCA 1J4AA 1QH8A 5KJFA 5LZ9A 2N46A 4FMCF 3WYBA 3FLBA 3RYIB 2P2DA 3HY4A 4CG2A 1LDMA 7AT1A 1KKLA 2F67A 4ZGBA 1RD4A 2R6HA 2A59A 3WBJA 1AN0A 5ALMA 3LWDA 4MR8B 5KYYB 5I5EA 4OHUA 3HZZA 1YBVA 3O7WA 2CLHB 2GN4A 5BOSA 3KKZA 3DMFA 3EVGA 1CK4A 1VPEA 4UJ3A 2BRUA 3N7UA 1NW3A 5CT5A 2ZUCA 4MUNA 5LLSA 4RV4A 1XRRA 3V4LA 1GGHA 1XEWX 2QAGB 3H1TA 5M2QA 2ZYGA 4JHLA 3WGNA 1Z4PX 3ESXA 4G97A 1SRRA 2VSXA 2JHCA 4GKKB 4H08A 2AK3A 2EKLA 1Y8CA 2NOAA 2ZB2A 4EKGA 3TG8A 3UC5A 4B5KA 4GI5A 3SC6A 1Z7WA 2AJCA 4AWAA 1P91A 4BU1A 1L5WA 4UE2A 5EIHA 3B1KA 1K4MA 2AV6A 2VDOB 3A05A 4OBEA 5JWOA 1TJNA 1RYDA 2HAEA 2VYCA 4WAUA 3W4IA 5GP1A 1OT5A 2FFQA 2IIPA 1Z6ZA 3THOA 1NQUA 3RYIA 1HDYA 1L5MA 5HA5A 1T9CA 1Q2XA 1RC0A 1FTQA 4ME6A 2ZE6A 3NYWA 3NHMA 1HLPA 4R9UC 4RHFA 1Z2EA 2GPBA 3EODA 3QP9A 5HIKA 3MBOA 4EITA 4MR8A 5KYYA 3QSGA 4BRWA 3QF7A 3W9YA 3BXOA 5TDHA 5EG5A 2FZGA 1B73A 5E7JA 4BPBA 2VDUE 5GJBA 1Z4OA 1EGVB 3M4YA 4PSUA 1DELA 2PQMA 2G9QA 1T13A 3I1JA 2FR8C 4NAHA 4BKUA 4HB4A 2QAGA 4Z0PA 4BEJA 4DSZA 1BKYA 1APBA 3N5KA 1V6SA 1TMYA 1E3DA 3DCIA 2RI1A 5CH5A 3SJBA 4DE5A 3KPWA 2KPOA 3GF4A 3OZ7A 4A15A 1QTIA 2EFEB 5EHZA 3F97A 1QCCA 1ZC3A 6ADHA 2RGDA 1YONA 4ISCA 2Y77A 3EWAA 4JENA 4YRSA 1IUOA 1A5ZA 1KAHA 4EO9A 4XSGA 2GM4A 3BJEA 4MPJA 4ZYLA 2XCRB 4UDYX 1MIOA 4LIPD 2AXPA 4HX2A 4TXJA 4EJMA 1BJTA 2UVQA 4ASUD 4X8LA 3UYLA 4M1EA 1DSSG 1H0KA 1QYIA 5JCJD 3LXXA 2JAXA 3FVTA 4Y67A 1CD5A 3GJ6A 2XZTA 3AJAA 4YJ2F 4EMTA 1DO2A 1I4OA 1LK0A 1ABBA 4J0QA 3MHTA 3SKVA 4HZGA 4PQRA 1P7YA 1ONNA 2ZJ7A 4XD2A 2WF8A 2AA3A 1W9HA 3LYHA 2ZANA 4B43A 1VLQA 3TXXA 4I4TB 5J5AA 5FI0B 2I1QA 5C51B 2GB4A 2WIDA 4HNQA 4FE4A 4DNOA 1BIFA 4P3PA 3KRTA 4S1VA 5JAPA 1KBZA 2DERA 4DDVA 4C6RA 1W49A 3KPUA 3KXDA 4M7WA 4HJXA 3U7EB 4C7KA 2ODQA 1EFTA 2O5RA 4RM2A 4QGHA 4X93A 5DXFA 2PY6A 4X54A 3NO4A 4KQWA 2R6JA 5AI8A 2Y6UA 1T9GR 3HB5X 4ESOA 1QQBA 1JT9A 1LLQA 2WUGA 1AB6A 1QYRA 3EG9B 1OYVA 4QYWA 4ZEXA 4KE8A 3CPHA 3WMXA 4BVFA 1X7HA 4MUKA 5D7BA 1DJOA 1ISJA 2FSFA 2P2CA 2WPNA 2I6QA 2ONKA 2Z6VA 2H51A 3TIVA 3WP0A 5K0CA 5KNCH 4MRAA 2R5NA 2CLMB 1I6LA 2P1RA 2IS4A 4OB6A 2EERA 4XIYA 3VR2A 3AZPA 4Y9SA 1JHRA 1KC3A