4FJ1A

Crystal structure of the ternary complex between a fungal 17beta-hydroxysteroid dehydrogenase (holo form) and genistein
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
261
structure length
261
Chain Sequence
TYIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of 17 beta-hydroxysteroid dehydrogenases by phytoestrogens: The case of fungal 17 beta-HSDcl.
pubmed doi rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords 17beta-hydroxysteroid dehydrogenase
total genus 108
structure length 261
sequence length 261
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fj1A00
2GN6A 2DFDA 1LEHA 1HE4A 2F00A 3U4IA 4IZIA 5B37A 3V5NA 3VVCA 4CJXA 1IE3A 4E5PA 4AJ4A 4EJ6A 2ZTVA 4Z6KA 3GEGA 1GAEO 2PH5A 1HSZA 2C54A 4A5OA 1GUFA 1KEWA 3ICCA 3OIDA 1Q0LA 4B79A 1HDXA 2GZ2A 4E31A 1E3EA 4BO5A 3IJPA 4FIZA 2FMUA 4NBWA 2VWHA 5IXYA 1XEAA 4D44A 1E1KA 3PRJA 1U5AA 3MEQA 4XX0A 4TZKA 3DBHA 3ROKA 4A0SA 1CERA 1X7DA 1C1DA 1A4UA 2EKLA 2JFHA 3EW7A 3B6ZA 4AJHA 1ISFA 1VJ1A 3KTDA 1YB4A 3ENNA 5DZSA 1WWKA 3AY6A 1UAGA 3OICA 1MLDA 4CMIA 4U6QA 1J5PA 1NXQA 2Q46A 2BFMA 2HMWA 4KUHA 3EVTA 1O5IA 3D3WB 5DOZA 2B4RO 1GL3A 5AXAA 5EINA 4YRAA 1DFGA 1P74A 3C1AA 2DQ4A 3SLKA 5TRTA 3TFQA 1PJCA 4B8WA 1EBFA 3F3SA 1XCBA 1GZ4A 1PGNA 1LC3A 5K6AC 4ZQGA 3N74A 2CF5A 1ZJZA 1C0IA 3CEAA 2AEJA 1DAOA 3ZWXA 3ULKA 2X1HA 4Q39A 3LQFA 4D41A 4BO9A 3BMNA 2D2IA 1T4BA 1U3WA 4JQCA 3CE6A 5IZCC 2ZB4A 1BXGB 4E21A 3KV3O 3MJEA 1YQDA 1JA9A 4TVOA 4GX5A 3WWZA 4Q3AA 2EKQA 5JXWA 4DLAA 2DT5A 1RKXA 3KUXA 3FHLA 3GPDG 4F45A 1WNTA 5TLSA 2X8LA 4IY1A 3JD2A 5L4SA 1P31A 3CKYA 3JQAD 4HUJA 4FFMA 4MVJH 1FK8A 4WCFA 1A7AA 3GDFA 1TT5B 5A9SB 4Q3NA 2FR8A 4U5QA 3CXRA 5TGDA 2PZJA 4BUCA 1G0NA 2IXAA 3BMQB 4C7KA 1F0YA 4Y8VA 4ID9A 1EK5A 2AE2A 1ARZA 1HWYA 4IS2A 1QV6A 4IDCA 3WG9A 4D46A 2VT3A 1A4IA 2OFPA 3FBGA 1DJQA 1U2DA 4XR4A 2VWPA 4BO7A 5I7VA 3AFNA 3KB6A 1XIVA 4GQAA 4D0RA 3DBVO 1J4AA 3GDOA 2WTBA 3E9MA 4CMKA 1F17A 5JC8A 5JAMA 4JJFA 1XQ1A 4HNGA 2D5AA 3IUPA 2JD1A 2I67A 2BKAA 2B0JA 4YJDA 4BV8A 1CYDA 1B26A 2QX7A 4EUEA 1YONA 1OZAA 2X0RA 1LQUA 3OA0A 4TKLA 1LLCA 3D3EA 3P2OA 3OECA 1CRWG 2XAAA 1HE2A 4GPD1 3KYCB 1OMOA 3H9EO 1HYHA 4EDFA 2B36A 2DBRA 5T6BA 3DFUA 4CM4A 4QECA 3DAGA 3VZRA 4EUHA 1A71A 3PVZA 3ROQA 5JO9A 2IE0A 4MKZA 1PR3A 2IZZA 2NLOA 2Q45A 4XD2A 2Y1EA 2DTDA 3DZFA 2EERA 4OL9A 3NAQA 3W8EA 2BGMA 2OXIA 3H9JA 1LRKA 3ZHXA 1R12A 3VH1A 4DLLA 1EFLA 1LX6A 3B1JA 4Y6SA 5LCXA 3DL2A 3WBFA 3GZ4A 1GU7A 1YBAA 1EE9A 3R1IA 3G0OA 1PU2A 3KRTA 5KKAA 5T5QA 1P1IA 3NJ4A 2YV3A 4YT4A 1G6KA 3U4DA 4J3FA 5B12A 3DZHA 2HO5A 3V2UA 1NR1A 5HS4A 2NV6A 3NDJA 2EP5A 5JE8A 2CNBA 2FZWA 5FYDA 1SB8A 3GVHA 1U9JA 3ITKA 3W8FA 4NK4A 3AM5A 3O38A 2RHCA 4CM7A 1ISHA 1LRJA 3EDMA 3N7UA 4LSMA 4E3ZA 1E7WA 3ZV4A 2DUWA 4II2A 4Q3CA 5DP2A 1QRRA 2YDYA 2DUUA 1XR3A 4CUZA 5I9NA 3PWZA 2IYPA 5L51A 1Y8QA 3ITDA 4IIUA 2PR2A 3GR6A 1TLTA 2VTEA 1LSJA 4CV0A 1GQYA 4LN1A 3UICA 3Q9NA 2JKVA 3MCVA 3OJLA 1L7EA 4LW8A 3JCZA 4D45A 3R3SA 1NYTA 1D3AA 2YUTA 4HBGA 3TL2A 5IZCA 4WLEA 1WMAA 4BVAA 4ESOA 1K0UA 5COAA 3ZGYA 1P1RA 4JGBA 2GN8A 4J9UE 3JYOA 4HKTA 1TT7A 3GA0A 4D3FA 1QORA 1DIBA 1FF9A 4HFNA 5FF9A 5BSFA 1EVJA 1B8VA 2JFFA 3JQCA 3ONFA 3DDNA 1N1GA 2D3TA 3VZQA 3FTPA 4UUOA 3IL2A 5CEFA 4TMFA 4BQRA 4M1QA 2FN7A 4KTTE 1E1MA 4AG3A 3PHGA 1ENPA 4HWKA 4ZJUA 1HRDA 1NWCA 3AW9A 4J1SA 3TF5A 2HJRA 2J5RA 1ADGA 1LTHR 4J91A 2O4CA 3JYLA 4TKMA 3H5AA 5C5IA 1I32A 3U09A 4QT0A 3JQ7A 1O94A 1YO6A 5GZ3A 1ZZEA 4BGIA 5L9AA 4J6FA 5KNLA 3ZI0A 5C3MA 1I36A 2VUSA 5EMHA 1ZXLA 3A1NA 1BXKA 1EQUA 2CZCA 5CAEA 4CUKA 1C1XA 2DKNA 3IMFA 1XYGA 3GNQA 2ZJ0A 4RF4A 3WB9A 2JFGA 3FWNA 1H5QA 2GD1O 1PJQA 2P91A 2VYND 4NIMA 4YQYA 5HTOA 1Z6ZA 1YH3A 4WGGA 4OGWA 5JYEA 1ZEMA 3BMQA 4C7JA 1UP6A 4GMGA 4AJ2A 5L7TA 3Q9UA 1C1XB 4I5GA 4GLOA 5CDYA 2PY6A 5A9SA 2ZTMA 1IY8A 1I2BA 4LRSB 5BNFA 3E18A 1DC3A 3CINA 1GUZA 3ADOA 3GFGA 2UUPA 4WUVA 3OIGA 2G0TA 3UW3A 1HLDA 5F5LA 2B4QA 4A2CA 2QYSA 1Y9AA 3ON5A 4BQPA 1KVQA 3JTMA 5COBA 3S1LA 3AFMA 1WLYA 2UYYA 1Y9EA 1WDMA 2ZATA 4PG5A 5AXBA 4BO1A 4PCVA 4CPDA 3GEDA 3VH4A 1U28A 4TWRA 1XWFA 3PHHA 1NFQA 3QWIA 3UUWA 1I33A 3GGOA 5TIIA 2E49A 4JJGA 2A35A 3HN2A 3JQ8A 3VTFA 1F06A 4BO4A 5FI5A 4GX2A 2NVWA 5G0UA 4N5MA 2NTVA 2TMDA 4OJNA 4FD3A 3ZW9A 4ZQFA 2JHFA 4W6ZA 1IL0A 3M2PA 4H15A 4R41A 3U9LA 4MVJF 4R69A 2VHVA 2PKQP 3PHJA 1E7MA 1XA0A 3RUCA 4OXNA 1TVEA 3H65A 1ZSYA 3GK3A 1V3TA 4N7RA 1YBVA 3D5QA 2V7PA 1T26A 5DNAA 4GSLA 3M2TA 4BGEA 1O95A 3VPXA 2O3UA 3ORFA 4PG8A 3LC2O 5EERA 4TRJA 3OM9A 2Q1UA 3BXXA 5ICSA 3NT2A 1C14A 5H82A 3SX2A 4IM7A 1DIRA 3K96A 3EGOA 3GDGA 1CWUA 4NDNE 3AI2A 5B1YA 1W8DA 2VYVD 3LC1O 2OBNA 1X15A 2G82A 3L4BA 1VE9A 1ZSNA 4K6CA 4OM8A 3AU9A 5JLAA 3GN1A 2O4UX 2Y1OA 4B8ZA 2AQKA 1Y8RB 5K0ZA 1FDVA 3PI7A 5JYDA 2FSSA 9LDTA 3VH2A 4DBZA 2EW8A 3AI3A 4D0SA 3BTOA 4FSHA 3UKOA 2V6GA 3L6DA 5JAZA 4IGEA 3RC2A 3RASA 2X4GA 4D7AA 2G76A 3C85A 2VRBA 4INAA 4TQGA 3H2SA 5B4UA 2HDHA 2O3QA 3QVWA 1JVBA 4I9UA 3OEYA 5T67A 3PLNA 3I4FA 3BTSA 1Z7EA 3Q6IA 2WDZA 2VN8A 4YJFB 5GZ1A 2C7VA 1X0XA 4NR0A 3CSDA 4ALLA 4FOSA 2PLAA 3AI1A 1XDWA 3LT4A 2UDPA 5A3JA 3HJAA 3NT4A 1U1IA 5G2OA 2W2KB 4OMUA 1U7TA 2R00C 4PIVA 4DXHA 4YPOA 4CV1A 4FS3A 4AJPA 3PWSA 2BFAA 2X0IA 4QO8A 4A7PA 5IAAA 3H8VA 4U8GA 3ZWNA 3VPSA 1LDMA 4CM4B 5EIOA 2QW8A 3W6UA 4MVJP 5IXSA 4UULA 4RZIA 3WTBA 4D3DA 4MP8A 4QFCA 4UREA 3GAZA 2PGJA 3HB4X 3HN7A 4C4OA 3RUEA 4J1NA 2B83A 4D43A 8ADHA 1XELA 1GCOA 1RJWA 1K2WA 4ALKA 4CM8B 1F8FA 1WP4A 3RWBA 1DLIA 1HXHA 1WMBA 2A4KA 3ANNA 4XB1A 3R3JA 1H6AA 2I76A 3FSRA 1SNYA 2BGKA 3GHYA 4OOFA 4QFDA 4CMEA 4YYZA 1ISGA 2Q99A 1C0PA 3KO8A 1EEHA 4KZPA 3GT0A 1XU9A 4XQCA 1EVIA 2Y93A 3I5MA 4CODB 4X54A 3W4JA 1Z74A 3HB5X 4FFPA 2VYVA 3F9IA 5JBIA 3TJRA 2LDXA 2GCGA 3E6AA 2GLXA 4J4BA 3MOGA 3EYWA 1SO8A 1MA0A 3KYBA 2IZ0A 4RF3A 4ZQEA 1P1HA 2E37A 2YFHA 1PZGA 3CPSA 3O26A 5TC4A 1KVTA 1SOVA 4L0QA 4KQXA 4M55A 4JLWA 3P2YA 5JS6A 4LCEA 4NBRA 3AOEC 5IN4A 3PZBA 3I6QA 3KHUA 3WGQA 5A03A 1WXDA 4YWJA 5EJ2A 2BLLA 2O2YA 2C29D 3E5MA 5TF4A 1DRVA 3O4RA 3EVNA 2O3RA 3ADPA 3PQFA 1GUYA 4FQ8A 1JTVA 4CM8A 2C5EA 1KC1A 1D4FA 3OQ1A 3TPCA 3DOCA 2CFCA 4WLFA 1ENYA 1JLLA 3V8BA 3JQ9C 1M75A 3RKUA 4XYEA 3M1LA 5I9LA 3VPGA 4YACA 2ILTA 1I3MA 4CV3A 5KOIA 1X1EA 3DTTA 1KEPA 1E5QA 3JQDA 1E3LA 1NWHA 5A9TA 4BKRA 4R3WA 4XGKA 4DPLA 2VUTA 1PS9A 2PGDA 2EHDA 4R51A 5GZ6A 2YJZA 1FXSA 4IQ0A 4BGVA 4IMPA 4UUNA 3L6OO 3PDUA 2HRBA 3VPHA 4BMSA 4WEQA 1KVRA 1NVMB 2IODA 4DWVA 5IFLA 3E03A 3RUDA 2F1KA 1KY5A 3KETA 3AOGA 3OP4A 4FJ0A 3UCFA 4FGSA 1ENOA 1I24A 4BB6A 2PKQO 1QLJA 3SEFA 2VYNA 1SC6A 3BMCA 3L4SO 4NFYA 3WFIA 4IDFA 2LDBA 4PLFA 3C24A 4R5HA 4GSKA 3MJVA 2BH9A 3T4EA 3LU1A 4OSPA 4RLHA 1SMKA 2WE7A 1JKFA 3ZWBA 4GBJA 2QRLA 3AM3A 2OUIA 7MDHA 1Y7TA 4IINA 1F14A 4D79A 5AVOA 1BVRA 1Y81A 1HZJA 3JQFC 3RKRA 1PL7A 2RBEA 3ZWCA 2QG4A 2I3AA 1GEGA 1ID1A 1VJTA 4RDIA 1J6UA 1MP0A 3KEOA 2EKPA 3GRPA 5T8KC 4RVHA 4WK6A 2X0NA 3FN4A 4TZTA 5G0TA 2V65A 4B4WA 4TVBA 3W4IA 3EMKA 3VVBA 4DVJA 2WYWA 2YZ7A 1PTJA 4J2HA 4MVJD 1QYVA 1E3WA 3B1FA 4NQZA 2HK7A 2W4QA 4R5MA 2HMTA 2HMSA 3JYQA 4MINA 5ER9A 4XYLA 2J3HA 3ROPA 2OZPA 4CLRB 4CM5A 2C59A 3DBRA 3ABIA 1PJ2A 1LLDA 4IJKA 1J49A 4CLEA 2NADA 1RWBA 1I3NA 3UHAA 2OHXA 3TSCA 1BG6A 3PJDA 1M76A 4OKIA 2OBYA 2X0JA 1DRUA 1ZK3A 2I9PA 2J3JA 1IHYA 4PLTA 3QWFA 4M8SA 3QVTA 3L6EA 4TRMA 5EQDA 4CL3A 1MXHA 2AQHA 4O59O 4R1UA 4DGSA 4DYVA 1EK6A 1E1LA 3LF2A 4MJLA 1O0SA 4BV9A 2GUGA 3TQHA 3TZ6A 1PS0A 1WVGA 4O6VA 4Y6PA 3W8DA 3HQ4O 3M1AA 1S6YA 2GZ1A 6ADHA 1B15A 3RFVA 2GASA 5C7OO 4IQGA 1U3VA 3T7EA 2UV8A 4D42A 3HFGA 4II3A 3TL3A 2VZ0A 2HCTA 2VOJA 1YL6A 3BTVA 2X9GA 4K1LA 2NVUB 2Y1CA 3VZPA 3BHIA 4TRRA 1FDSA 3MZ0A 4R01A 2JJYA 2ZIZA 4RPGA 5B4VA 3OF2A 3SBOA 2G5CA 4HNHA 4NZ9A 4YAKA 2Q1SA 1K5HA 1GQQA 3PTZA 1ZJYA 4WCFC 3VKVA 3BHMA 4BGUA 1JWBB 1WDKA 4KDFA 1OI7A 1ZBQA 2VTDA 3PK0A 3TRIA 1H6DA 4DRYA 5KVSA 4OO3A 3CMMA 2DVMA 4YT8A 3NYWA 2EJWA 4A27A 2WSBA 4EGFA 4H16A 2FRDA 1IZ0A 2ZYAA 3RU7A 1QV7A 3ETDA 2O50A 3R0IA 3E8XA 3PYMA 2QRKA 1HF3A 4CMJA 5JDIA 3PWKA 3RUIA 1UDBA 4E4YA 4BNYA 3KSDO 4LMRA 2GZ3A 2AXQA 2WYVA 1PS8A 3M6IA 3L9WA 1MC4A 3ZV6A 1Z73A 4CLDA 1Z45A 1IB6A 4RQTA 3L0DA 1R4MB 3BAZA 3LT0A 2J5QA 2JCVA 3ZWYA 4ZRNA 2HUNA 3F6YA 2AG8A 4YXFA 5I9MA 3OQBA 3ROMA 1DSSG 3QY9A 2OORA 4HX5A 1HT0A 1M6WA 3RC9A 1L1FA 3UGKA 3UOGA 1NHGA 1VC2A 3GUYA 2Y1DA 1EUDA 1KEVA 1I8TA 3INTA 3OEWA 2PH3A 4G5HA 3WQSB 5BR7A 3I9LA 4CM9A 3PHLA 3VDRA 4GGOA 3WGTA 4CMGA 2D0IA 1N7HA 1B7GO 3RJ5A 3JQ9A 5L3ZA 2ZJ1A 3WYBA 2NU6A 3U0BA 4Q9NA 2H6EA 2WD8A 1KEUA 1DBVO 3F1LA 4N5NA 4BNVA 4JCOA 3JD3A 4I8XA 1VL6A 5EN4A 4DMMA 1UDAA 4N5LA 2DBVO 3LLVA 3P19A 1DB3A 4I9NA 5KWEA 2WEKA 1R4NB 4R4JA 1DIGA 3KSUA 1I3KA 2GGSA 4BNJA 2Y99A 2NU7A 4R3NA 4KDEA 2VHWA 4K9DA 4L8VA 4Y67A 5KVVA 4UVHA 3JQGA 5CEJA 4D3SA 4P38A 1ZNQO 3FNEA 4W99A 5I7SA 1Y8QB 3PGJA 3ETEA 2GYYA 4BO2A 3WGYA 2JHGA 1UP7A 4PZEA 5TJHA 4W7HA 3WS7A 2OMEA 4PRLA 1PQUA 5HA5A 2Y0DA 3TZQA 1K6XA 2XOXA 2V6FA 1PJBA 2RAFA 1ADCA 4PLGA 4OYRA 4RZHA 1NX6A 3JD0A 4UAGA 1EMDA 1QG6A 2EXXA 1K89A 3TFOA 2P9GA 3WR5A 1T2DA 5DBIA 1Q0QA 2UVDA 4P4NA 3NKLA 3HWRA 4ALIA 2CVQA 3L77A 1KC3A 4FC6A 3W6ZA 5HBRA 4AFNA 3S2GA 4CLHA 4RQUA 3JSAA 5JCXA 1UH5A 3V1TC 4BIIA 5A9RA 2ZQYA 5ILGA 3ZW8A 3I9MA 4RORA 1PX0A 2AG5A 3FBTA 2NTNA 2YY7A 5T8KA 4N54A 1PL8A 1QYDA 4IJUA 3S8MA 4DREA 1GYRA 4Q3BA 1DEHA 3WWYA 3OA2A 4NU6A 3STHA 5A3VA 4ZICA 3NTOA 4I5EA 1I10A 4DPMA 3DBLB 3LZ6A 5G4KB 5CDTA 4JJIA 4RPKA 1LSSA 3ASVA 3FCOA 1QLHA 3GNSA 3WTCA 1N9GB 3KYCA 1U7HA 4NK5A 4R9SA 4HV4A 1GPJA 5MGBA 3HADA 3QV1A 2O23A 5JY6A 5JY1A 3GMDA 4JBIA 3X2EA 2EEZA 3H5RA 1PZEA 3DEYX 2BRUA 1P1JA 1XHLA 4J0FA 4B3IA 4IXWA 4NJMA 3P7MA 5DDIP 4LVUA 5DULA 1ZMOA 3GGPA 5JCJA 4MDHA 2A92A 1HDOA 2ZB7A 1TB4A 4KTVE 2FPGA 3UN1A 1DAPA 3RBVA 5BSEA 3CZRA 4L74A 3T7CA 3OFSA 3WIDA 3RUFA 5F3RA 3C7AA 3TDKA 4RO0A 3SC6A 3DB2A 1E1NA 1PJLA 1Q1NA 1UP4A 1YB1A 2GO1A 3KZVA 4OXYA 4PFJA 5U1PA 3RAJA 2RH8A 5TX7A 5JNLA 1E0DA 1N9GA 3VPFA 4AICA 3GZNB 4IPTA 7ADHA 2ZYDA 4RDHA 4LMPA 5BSHA 4M89A 1KYQA 1LBEA 1U4SA 3QLJA 4YJGA 5TS3A 4FR5A 4JP2A 3BMNB 3WSWA 4I08A 5JDCC 4WLNA 3DWFA 4ONEA 3PGXA 4PG7A 3D5TA 2YV2A 2P5YA 5LC1A 4B7UA 2VZ8A 1MXFA 4FFRA 2NWQA 2P4QA 4YAEA 4YB8A 3AY7A 2QHXA 4BNIA 2NVBA 1LDEA 3E1KA 4XGNA 3ETGA 3FRJA 2Q50A 5C7LO 2C82A 1BXZA 3GG9A 4R1SA 3D4PA 2AEMA 1ISJA 4WOJA 1M2WA 1TXGA 4FJ2A 1GTMA 3U4CA 1X7HA 2E82A 3FNFA 1WZIA 4O5OA 5IN5A 1A9ZA 4BO8A 5DT9A 3UH1A 4XIYA 3SC4A 3COSA 3VH3A 1T2AA 3H7AA 1YVEI 4J43A 3BHJA 1Y6JA 1E3SA 1LJ8A 4LK3A 5CPFA 2C07A 3F47A 2H5LA 2GF2A 4PZCA 4K28A 3PFWO 4L76A 4MP3A 1D8AA 3PEFA 1ZKMA 1H94A 2NTJA 4YJHA 1GEEA 3KYDA 3LK7A 4RPHA 2QZ9A 3IIEA 4F46A 1UXHA 1B2LA 5THQA 1OC4A 1ZO8A 4PLVA 3DMTA 3KM0A 4P22A 1QYXA 4QTZA 3UFXA 1E6UA 3WLEA 3AWDA 4LGVA 4S1VA 4J1TA 3I23A 5DN9A 2FP4A 4J4HA 3ZN2A 3OETA 4E6PA 4F3YA 1HE3A 1LU9A 1AN9A 1GR0A 4I5FA 4JROA 5CG2A 1T1SA 1KERA 4NHEA 1EDOA 2YDXA 5I8WA 1H9BA 3H6KA 4MVJI 5F5NA 2XXJA 2FWMX 4BO3A 1G1AA 1V35A 1YJ8A 3QVSA 4RJTA 3K8ZA 5KCZA 1V9LA 5C7IO 5IZ4A 4N18A 3FNHA 5KKCA 4YQZA 3JQBA 3RJ9A 2IEBA 5CDUA 5CDGA 3GG2A 4XGIA 1P9LA 4BMVA 4UVEA 3PIDA 2E6UX 3UAGA 1R37A 1K6IA 2ZTLA 2C0CA 1YBMA 3LT2A 2D1YA 3WGHA 1MFPA 1X7GA 3G17A 3FPLA 2Q2VA 3OHSX 3QHAA 3WYCA 1H9AA 4IDAA 5IG2A 1P45A 3O8QB 4OOEA 1NQOA 2PZLA 4EEZA 3JQFA 1V8BA 3O8QA 4FFOA 4ALJA 2I99A 2HSDA 2JD0A 2YQ5A 4GL4A 1A5ZA 3KVOA 4NPCA 3PYXA 1ZSVA 2PV7A 4JBHA 4RV9A 3GUCA 1NFRA 2NUAA 2PFGA 2PZKA 4J49A 1UAYA 3K73O 4M87A 4XDZA 3V2GA 4LRTB 4BNXA 2EGGA 3TNLA 4QSMA 3JQGB 4CV2A 4BNTA 3GNTA 4XCVA 4A10A 4IBOA 2EJVA 2FPIA 3S2FA 3C3XA 1C1DB 3WJAA 4BNZA 4NG5A 4CM3A 4OKNA 4ZQHA 2G1UA 4Z3DA 2CVOA 3FNGA 4BNHA 3ZWPA 1H93A 2NSDA 4E5YA 5KJ1A 2PZMA 1YGYA 3OJFA 1VRWA 4R1NA 5TSDA 3IKTA 3BA1A 1MC5A 3ZHBA 1LXCA 4XDYA 4LVCA 1YRLA 3PQDA 1PJSA 3F5SA 4BL5A 5A5EA 3UXYA 5F1PA 6LDHA 1HDYA 2PA3A 2WE8A 5JDCA 3G79A 1BVUA 2AQIA 2JCYA 2PD3A 1UUFA 3DZKA 3MWDB 3OH8A 1AHIA 2Y1GA 5HRUA 4G2NA 1PGJA 1D1SA 4MVJE 3IAHA 4Z0TA 3ICPA 4GWGA 4RVUA 1XG5A 3VZSA 3H9QA 5DBFA 3QA9A 3A14A 5L4LA 4GX1A 4XKJA 4OAQA 2VCYA 2O7QA 4CR7A 3NV9A 1NAHA 4YEDA 2W8ZA 2FHSA 3QWHA 3UCXA 3PQEA 2C5AA 1Q2XA 4R16A 4B3HA 2XXBA 4ND3A 1HEUA 1JW9B 1K3TA 3OJOA 5ENVA 3DZIA 2NQTA 1CQIA 2O48X 2ZCVA 1X0VA 1LC0A 1I3LA 1DO8A 2NQ8A 3WLFA 1BTOA 3CZMA 3ONDA 3BYZA 3GLQA 2E48A 2AW5A 1H2BA 3G1TA 2Q3EA 2P68A 3H3JA 3AOEA 2WYUA 5COQA 2Q4BA 1PL6A 2D59A 2Q1WA 3IJRA 1MUUA 2I6TA 3KOUA 1UR5A 2BFPA 4TROA 4RL6A 3EHEA 4E2YA 3TZCA 5KJCA 4E5NA 1JAXA 2PD6A 1E7RA 2YV1A 2VRCA 3WXBA 4J9VA 1A72A 2X5JO 1LDBA 4IZHA 3I52A 1N8KA 1TA4A 3LF1A 5ADHA 3K92A 1PGQA 4RPJA 1R0SA 2YHIB 3Q1LA 2AEFA 1P33A 3WICA 5JC1A 1GZ3A 1GYPA 3FPCA 5CHEA 2ZCUA 4E30A 3PYLA 5JMWA 4MIEA 1V6AA 3IKVA 4J4TA 3W4KA 1B8PA 3U3XA 2Q2WA 4MIOA 4XJSA 1BWSA 4ND5A 3K2BA 5F1OA 4B4VA 4DTIA 5A1TA 5FFFA 1SZJG 5I7EA 4KMSA 1Y1PA 3PLRA 4NJMB 2BMAA 3NJ8A 3O03A 3HDYA 4ZVVA 2NVUA 3BMCB 4HP8A 4RPLA 5FEUA 4IJVA 2W98A 2JAPA 4J7UA 3TZHA 4DQVA 4EBFA 1T4DA 2CDBA 1E3IA 3R6DA 1P44A 4MIYA 1X1TA 4YCAA 5I8ZA 4KOAA 5ICMA 4CQLA 5A05A 1E92A 1N2SA 5FI3A 1U3UA 1VPDA 9LDBA 3DMTC 4OQYA 4CUJA 4G81A 1IUKA 4E2ZA 5LDGA 4WNCA 1O9BA 3G1UA 4DA9A 1U8FO 4CLRA 3HZZA 2X23A 3QRWA 5G4KA 3DBLA 3GVPA 1BHSA 2Y66A 3RBZA 5B4TA 1AHHA 1O8CA 2O3SA 2GNAA 4PN3A 3N58A 3OJ0A 2JAHA 4L4XA 3PDJA 1K6JA 1P3DA 4FB5A 2W2LD 5JMPA 2H9IA 1YS4A 4BNKA 1XLTA 2DTEA 4BNLA 4YJFA 1RM4A 2SCUA 4Y6RA 1KVUA 2OOSA 5BT9A 1GV0A 4XB2A 5L4NA 1ZEJA 2PWZA 2I66A 4HADA 4JP3A 1N7GA 2X9NA 2OO5A 2X7HA 3JQ8B 2D8AA 3K31A 3NX4A 1JVSA 1ULSA 2UUOA 4BKOA 4PRKA 1WDLA 5IJZA 3INGA 1PQWA 4PGFA 1C0KA 4EJMA 3K30A 1OAAA 1P1KA 3ZNNA 2VT2A 3MJSA 3ANMA 4QX6A 1W4ZA 3FF4A 1DJNA 1VJ0A 4ILKA 4PLCA 3V1UA 3U62A 3GVIA 4XEHA 2OGUA 4Z0HO 2X6TA 2YYYA 1QR6A 1WZEA 3HDHA 4MKXA 1P1FA 3FTNA 4YAGA 1V3VA 2PNFA 3ZV3A 2X58A 2HJSA 4YR9A 4DMLA 3GAFA 4UEJA 3WNQA 1IZ9A 3GQVA 3IOYA 3VOSA 1LDYA 1VI2A 1DC4A 4GAEA 5KIAA 4L4RA 2HAEA 4I1IA 5EPOA 1ZK2A 1A7KA 1V0JA 2EW2A 2BI8A 3LT1A 1BSVA 2QRJA 4E5MA 1VLLA 1ONOA 3ZU3A 1T2FA 3OQ6A 1ZUD1 4YAJA 1XGKA 1P0CA 3B70A 2DTXA 4O63O 5U9CA 3F1KA 1OOEA 1JKJA 1LQTA 3JD1A 3U49A 4PZDA 3NGLA 4CMHA 4XIJA 4CLOA 1ADBA 4WLUA 5I7FA 4AJ1A 5KJFA 3LLSA 2Z5LA 4FBGA 1E7YA 5EESA 5J23A 5A5FA 1UXIA 4Z9YA 1JKIA 4O1MA 3NT5A 4DC1A 4DPKA 2W2LA 1WAMA 3WGGA 2VUUA 3C7DB 3GOHA 4H3VA 4YVFA 4BMNA 4PLHA 4PVDA 4LISA 3I1JA 4AJOA 2ZB8A 1VKNA 1R4MA 3PZRA 2RHRA 3PFFA 1N92A 4FFLA 2H1SA 5BNTA 1EQ2A 4YTEA 2VWQA 3SJ7A 2OP1A 5U4QA 4ALNA 1QMGA 3GY0A 1ONNA 1Q0HA 4E12A 4XQEA 2RH4A 3EC7A 3DZBA 1DC6A 1LDNA 4B4UA 3K9QO 1ZFNA 3ASUA 4NBUA 4Z0PA 3S2EA 5ER6A 1JN0A 4IDEA 4OSOA 4UUPA 4DQXA 1DFHA 3GN2A 4AJNA 5GMOA 1NPTO 1TI7A 2O3TA 8LDHA 1MGOA 1NAIA 1C0LA 1NHWA 2B4TO 3PIIA 1BMDA 1PJ4A 1ORRA 1H0KA 5K9ZA 2EWMA 3V1YA 3JQAB 5EQFA 4P4LA 2DM6A 3V2HA 5LDHA 1PGPA 5TT1A 2B5VA 3VHRA 3WBBA 3GVXA 3DHYA 3DQPA 4L73A 3L9XA 4AJJA 1S7CA 4A73A 2BD0A 3H5NA 2Z95A 3ZCXA 4CR6A 1EBUA 4BNMA 5CDSA 1F8GA 3ONEA 4FN4A 3ZWMA 3KXDA 3DZGA 3DONA 1CDOA 1YDWA 2Y0EA 3NDRA 4BNWA 3ZH2A 4JXKA 3DO5A 1U3TA 5A06A 4NU5A 3AJRA 1NNUA 3MJ4A 4G65A 4HFRA 1YL5A 3Q2KA 2XF8A 3VAZA 3WGIA 1UZLA 2DPGA 3FR7A 3I6IA 4F6CA 3G49A 1MX3A 4CM9D 1PSDA 4UEOA 1NBOA 1QSGA 4GVXA 1HDRA 1YQGA 4XYBA 2BI7A 4J2OA 2VRCD 4MVJG 3JQ7B 4NNJA 2GPTA 3RBXA 1GYQA 2X5KO 3WNVA 1RYEA 5GY7A 2BHLA 1T2EA 2D4AA 4CQMD 1VKOA 1AXGA 2EIHA 3E5RA 3QW2A 3SXPA 1E6EA 2ZQZA 3I9KA 4EEXA 2WMDA 1XKQA 4WJZA 1GQ2A 4Z9FA 1A9YA 2BGLA 2P5UA 4ND1A 2O3JA 4GKBA 4AJKA 5L7YA 3BIOA 4HY3A 2Z1NA 2G17A 3TOZA 1AXEA 3JQBC 1O6ZA 1B16A 5DCYA 1LDGA 2HMVA 4ITUA 4AL4A 5T57A 1HE5A 2A94A 2NM0A 3CH6A 3TWOA 4L9RA 1VL0A 1L7DA 1E7SA 2V6MA 3WDSA 5L7WA 1ONPA 5CEEA 1Y8RA 1PJTA 1HDGO 1MG5A 3K6JA 2WM3A 5JFOA 4QXMA 4URFA 4YRDA 3E9NA 5EL0A 1T24A 3RFTA 1T1RA 4J16A 3NGXA 1B3BA 2UAGA 2HKIA 4WKGA 2CSUA 4CR8A 4U6SA 3WOHA 1DIAA 2Z1MA 3D0OA 3ZU2A 4DQUA 1NTOA 4UVIA 1P77A 4FC7A 4DIFA 3OJEA 4RVGA 3RU9A 4RLSA 3KYDB 1WW8A 4FPXA 4YJHB 4FOOA 1GDHA 4DBVO 3LYLA 4PLWA 1RM0A 1R6DA 2RIRA 4OH1A 3QWBA 3JD4A 3ZDFA 3TOXA 1LLQA 2GR9A 3E48A 2VZ9A 4KWIA 1HETA 2FSVA 2POQX 5F1KA 2GSDA 4BB5A 4XQ9A 2AQ8A 3C1TA 2IZ1A 4GVLA 4UEKA 1N5DA 4DIBA 1H6BA 2BF7A 4XYGA 1TEHA 1EUCA 1G0OA 3RFXA 1HDCA 1LNQA 3HE3A 3MTGA 4RCVA 1Q7GA 3CIFA 1DRWA 3KBOA 4GH5A 4JN6B 3ZWWA 1NPYA 4CQMA 5JSFA 3RVDA 4CM6A 4WPGA 4ZN6A 1VM6A 4J90A 4AJIA 4HFMA 1BXGA 2EF1A 3CUKA 3RD5A 1EZ4A 3W1VA 4H7PA 1DLJA 2Q2QA 1B3RA 3JQ6A 4CQMB 3LC7O 2X9VA 1DOHA 1VSVA 1I5RA 4YAIA 4E32A 3H3FA 1QKIA 5BNIA 3RI3A 1SEPA 2XPCA 3C1OA 2X5OA 1N1EA 2QQ5A 2DU8A 1VSUA 3BZUA 4Q3EA 4W7IA 4PG6A 1MFZA 3F4BA 2CY0A 1ZW1A 3ZHYA 1BDMA 4KP7A 2J3KA 1GD1O 2RCYA 2PD4A 5HS6A 1W0CA 4KUGA 3GZNA 4Z3KA 3PXXA 3MWEB 4WOKA 4ROSA 4OHUA 3WSVA 1H2HA 3WIEA 1GV1A 2J6IA 3AUTA 2JCXA 2OL4A 3QVXA 4RF5A 3RC7A 1GCUA 1F12A 4B7CA 1ZK0A 4LSWA 2ZYGA 3QQPA 5CG1A 4DUPA 1OFGA 1EDZA 4A26A 4A03A 4AJLA 2HQ1A 3IS3A 1ISMA 4MO2A 4M49A 4EYEA 4UUMA 2R6JA 2VWGA 2GN4A 5KVQA 4EW6A 4R54A 4BO6A 5G4LA 3WGOA 2B69A 3ZHZA 1SB9A 3A4VA 1HLPA 1LRLA 3G3EA 2VNAA 1NQ5A 2C2YA 4YDRA 1LSUA 3D4NA 4WCDA 5CPBA 1TT5A 1NM5A 4CLXA 1HDZA 1DPGA 1GY8A 3Q2IA 4KUEA 4U0JA 1RPNA 1U2GA 5F21A 5L40A 3GF4A 2X22A 4EUFA 3S2IA 4BO0A 3QE3A 3JV7A 3I9NA 4E2WA 2J8ZA 3TN7A 4PG4A 1UXGA 4K26A 5DBGA 2NACA 4J0EA 1ML3A 5DCWA 2NNLD 2AHRA 4FJ1A 1P0FA 2JD2A 4YRBA 3DOJA 3PJGA 2YFQA 4PLZA 3MTJA 3ENKA 3ZU5A 1NVTA 2OP0A 1ZK1A 2EGHA 4WECA 3Q0EA 5G0SA 3RCBA 4ZQBA 4CMAA 1ADFA 4NBVA 2NU9A 1Y5RA 2IRWA 2PKRA 1I0ZA 1JU9A 3ZWVA 1M66A 2IEDA 4GX0A 1KOLA 1NR7A 4AVYA 3E9QA 3F4LA 3FWZA 1NVGA 2R00A 4DC0A 1DDOA 1I2ZA 4W82A 3OBBA 3LVFO 2Y67A 4AJEA 2QYTA 2EG9A 5THKA 3VDQA 2H63A 4IDBA 1PQPA 4IJWA 1KETA 4GGPA 3BTUA 4FCCA 4Z9XA 3UF0A 4IUYA 5CP8A 4OIMA 2EP7A 4HXYA 1HZZA 1YL7A 3KEQA 5JCJD 4XJTA 1JWAB 1YQXA 4MPDA 4XA8A 3GC6A 4FDAA 3HHPA 2ZKLA 1YE3A 1ISIA 2CD9A 5A4DA 2DBQA 3EZYA 3AUUA 1B0AA 2Y05A 2Q1TA 3H4VA 4CMCA 1RYDA 1VL8A 1RM5A 1SCUA 3D64A 4OXKA 3RROA 3KLMX 3AK4A 3WFJA 3AUAA 5IF3A 4PLPA 3VC7A 2DC1A 2QIOA 3GEMA 4M54A 3DMYA 4NI5A 3IC5A 1DHRA 3GMSA 1PR9A 3I9OA 4CMEC 3IDSA 3ZZNA 3PJEA 4NMHA 5TT0A 1KS9A 3D4OA 3AU8A 2I65A 1UZMA 3C7CB 5KJ6A 1Z82A 3LSYA 2HRZA 3SLGA 5JO0A 1EFKA 4DLBA 3JQAA 1DC5A 3I3OA 4NH4A 2WWRA 3NTQA 3NTRA 1NQTA 3B20A 1B8UA 1EE2A 4ND2A 1FDUA 2DBZA 4RVFA 4Y98A 4ZRMA 4MOWA 3OIFA 3INRA 4L4SA 3DAPA 2O7SA 4GI2A 1M67A 4WNIA 2ZTUA 1LUAA 1ENZA 1BW9A 3A9WA 5AQ1A 3OSUA 3DHNA 3O9ZA 3I4CA 4P8RA 4BS9A 1ULUA 1U5CA 1E6WA 4WLOA 4QO7A 3NDIA 4DL9A 1UXJA 4KWHA 2DLDA 3UCEA 2E4AA 3CTMA 1B14A 4FFNA 2DAPA 4YJGB 5KVCA 1Z75A 1E7QA 1NASA 1T25A 1IOLA 3QIVA 2W90A 1AUPA 3DR3A 2VHXA 3JQEA 4FGWA 4K6FA 3SJUA 4OQZA 2AMFA 5BQFA 2ET6A 3DAFA 3HG7A 4ZA2A 4PLYA 3AUSA 3D7LA 2B5WA 3ZNOA 4CMIB 1ZXBA 4XR9A 2HMUA 3C8MA 2P4HX 4ZGWA 5AYVA 1NPDA 4I9HA 5KTKA 4XWYA 4EI2A 5A04A 1GFSA 3H9GA 2PK3A 2CDAA 1X14A 2CF6A 4M86A 1HSOA 1YB5A 3QSGA 3U4HA 3KLPX 1LA2A 3I83A 3GH3A 2R2GA 4GLLA 5AOVA 4E2XA 3BMOA 3DBHB 3HDJA 3NUGA 2HK9A 5H83A 4P4GA 1HYEA 1YWGO 4BNGA 1EUZA 1I30A 3EUWA 4RGBA 5TQVA 2V6BA 1W6UA 2NU8A 4R68A 3WJ7A 4BNNA 4YT2A 4L75A 4W4TA 1WPQA 2WD7A 1GPDG 1XQ6A 3HNPA 1MB4A 5A02A 1R0KA 1BRMA 1FMCA 1V3UA 4GWKA 1PEDA 3PP8A 1KVSA 3OMLA 1YOVA 3FI9A 2HLPA 3QVOA 5HWSA 3D1LA 1XSEA 2P9CA 1UZNA 3T4XA 1R66A 3A06A 4WE3A 3FD8A 3ZWAA 5CFZA 2FZEA 4J7XA 3ST7A 4BKQA 3JYPA 1CIVA 2CDCA 1ZVMA 1SPXA 3DZJA 1Q7BA 2AE1A 3HUDA 5G0VA 1PGOA 3X2FA 2C7GA 2YW9A 4XRRA 1W73A 4E13A 5FWNA 4EZBA 3DHEA 3P5SA 4ALMA 3ZNPA 4QEDA 5L45A 2PTGA 3QJ5A 1D1TA 4JBGA 3WMWA 2AA3A 3VKUA 3EK2A 4CM1A 1M6HA 4BHTA 3L07A 1UXKA 1KBZA 2Y0CA 1E3WB 2EV9A 4B3JA 1GADO 2FPPA 4BKUA 4PVCA 1LSOA 5IDQA 4CLOB 3DTYA 3RC1A 1U8XX 4F6LA 4I5DA 1CJCA 3ZV5A 4IDGA 3DC2A 4ZD6A 1NP3A 3D3WA 2IYOA 4IMRA 1FDTA 3F46A 4CQLB 2JL1A 4WLVA 4QUKA 5AXCA 4MP6A 3IP1A 5BSGA 4YBZA 4W9NC 4R9RA 2CVZA 3ANLA 2PGLA 4TRNA 3PHIA 1AE1A 3K2EA 3I9JA 3RQSA 4J7CA 1NFFA 1ZCJA 5L53A 1DHTA 1YKFA 1ZIDA 1R4NA 3GPIA 1IULA 4GMFA 1I01A 2J3IA 3JYNA 4NFHA 1HTBA 4JK3A 4MVJM 5ITVA 4NBTA 3IP3A 5JAQA 2VHZA 1HYGA 3Q11A 3GFBA 4XZ3A 3MJTA 2Q4EA 1A27A 2Q49A 4E33A 1CETA 5H81A 3RUAA 1YXMA 3EAGA 1OC2A 1HL3A 5L95A 5T64A 4WEOA 1QXSA 1Z7BA 3MJCA 5K6AA 1EVYA 2YHIA 1PZHA 1JDJA 1PWZA 2Y68A 2BELA 4S3MA 4KQWA 4E5KA 3IUSA 4EJ0A 3WQRA 2FR0A 2IXBA 1H6CA 4BKPA 1IYZA 3GVCA 3Q3CA 3A28A 4E0BA 4ZHSA 2HU2A 1JAYA 1FDWA 5DP1A 1DIHA 5AXDA 3AY3A 3H2ZA 1R0LA 5ENDA 5ES3A 3CMCO 3LDHA 2P2SA 1MV8A 4CMBA 2CUKA 4WASA 4YT5A 4IDDA 1U4OA 3B1KA 1PJ3A 5KJEA 2TMGA 3GHHA 4IQ8A 2Y1FA 3DFZA 3H9UA 5IDWA 4YA6A 2I5PO 4MVJA 1MG0A 3ZU4A 3HFSA 3WQQA 3GGGA 3K5PA 4UVDA 1QP8A 1HKUA 3RUHA 1Y5MA 1R16A 1ZH8A 1ZMTA 1XU7A 2ZB3A 3F5QA 4RVDA 4XRGA 5ITWA 1LLUA 4Q3DA 2VOEA 1YJQA 3UVEA 2FY8A 4U7WA 3NEPX 1Q7CA 1SOWA 2B35A 3QWAA 4JIGA 3PJFA 1QYCA 1YDEA 5HM8A 4R1TA 1CF2O 5DCUA 2A9FA 1IPEA 3DXFA 4HFJA 1E77A 4XYMA 3E82A 3MOIA 1FJHA 3WMXA 3RSHA 4FW8A 4BNUA 3HSKA 1I2CA 4ND4A 5DF1A 3DOOA 1PZFA 2GDZA 3AM4A 5ILOA 3ZWOA 1JQBA 1EVZA 1YOVB 4LCJA 1D7OA 4DYDA 3FR8A 3HDQA 4TSKA 5G0WA 1LI4A 2HK8A 1IPFA 1BGVA 2WD7B 1CEQA 2YHUA 3VTZA 3GRKA 2VNSA 2QZZA 2IDZA 4U0KA 4B4OA 1SEVA 3U5TA 5JDIC 5C37A 4XQGA 2WJPA 2J5KA 3KSZO 4Y9DA 4ZU3A 1PIWA 2GRAA 3BMOB 3EY4A 2I3GA 1O89A 1QYWA 1X13A 2GERA 4B7XA 4CL8A 4IS3A 2FOIA 4NJOA 2BFOA 1PWXA 4O0LA 4UVGA 1NQAO 1DFIA 1UDCA 1ZK4A 4WCFB 4IXTA 4IIVA 3S55A 3RIHA 1KIFA 5DOVA 4JX8A 1J0XO 1OBFO 5MDHA 1SAYA 5JPIA 3WYEA 1DXYA 1BW9B 3DBRB 3WGZA 3TZKA 1AGNA 3NRCA 4DIOA 1UJMA 2ZK7A 3IQDB 4W9NA 1SBYA 3WX0A 1RM3A 2YQ4A 5IDYA 1KY4A 2D5CA 2VQ3A 1E5LA 5JAIA 1IHXA 2P9EA 3QP9A 4QQRA 1R15A 3ZNQA 3SVTA 5TJ9A 3L4BC 2W2KA 2CMDA 3PPIA 1CQJA 1C3VA 1E3JA 2VHYA 4EITA 4BNFA 5JW6A 2O2SA 4BOYA 3EZLA 2C2XA 1BDBA 4RVSA 1T2CA 2C20A 4MKRA 4GKVA 2DPHA 5TNXA 2B37A 2FR1A 4NFSA 5IDXA 2DFVA 4JNKA 4J1QA 4RF2A 1GZ6A 2GN9A 4IGFA 2X86A
chains in the Genus database with same CATH superfamily
2VSOA 1WBJB 3BL5A 3F7TA 5A3RA 2F55A 2D6FA 2GN6A 5KC9A 3SBDA 3FRHA 3U4IA 4YROA 5B37A 1G8KA 1OBVA 3V5NA 5FWNA 5IYZB 4EJ6A 3WLJA 1DWUA 1QC5A 2VSFA 2BFFA 2ZTVA 1GNSA 3GEGA 4WD3A 5DTMA 4HWOA 3TQFA 4MYRA 2HMYB 5TV2A 2PH5A 5FTJA 4J0KA 4RTKA 4W5OA 4ITRC 4IDNA 3UOAB 1TX4B 2ZANA 2H0AA 1YF3A 3OIDA 5KCMA 1HDXA 4OA8A 1E6CA 5EZSA 5LZ8A 3RADC 1E3EA 2YS7A 4D8TA 4R8RA 2R4UA 1CUAA 1LPNA 3NUQA 4R8KA 3RABA 3L1UA 4TZKA 2H2GA 2FZKA 3DBHA 4LPKA 4DS3A 1IQ0A 2I29A 4JITA 1O0BA 3ASYA 3UJNA 3UUEA 4F5WA 1EYZA 3CUVA 1X7YB 3NXKA 3P2MA 4DJTA 1JECA 1WHTB 1C1DA 1A4UA 2C84A 2EKLA 2WI8A 3NHYA 3P0IA 5FXMA 2IC5A 1HT1E 3B6ZA 3LX6A 3ZK7A 2RGUA 1DS6A 4AKIA 1Y89A 3IEPA 3W2TA 1YB4A 2JFXA 1U0TA 5DZSA 3MD0A 3S1AA 3AM1A 1UAGA 3OICA 5KEIA 2BL4A 2CB0A 4RTOA 2B20A 4R1PA 5IAOA 4CNBA 5FOSA 2AUMA 2JGAA 1J5PA 1NXQA 2Q46A 1QX3A 1CDZA 4LWQA 1TO6A 2BFMA 4U6QA 3TM4A 1G98A 5IAJA 1COZA 2OCBA 4OI2A 1C0EA 1IEWA 1OGIA 2EYQA 1EI9A 2OWEA 1C3LA 2XBLA 3CF4A 3PC2A 3PUZA 4RZXA 5DOZA 5EINA 4YRAA 2DQ4A 3SLKA 5HE9A 3TFQA 2GBLC 2GUWA 4M9CA 3TSWA 1MN6A 2QMZA 1F60A 4LJAA 4OHYA 1L7NA 3M6UA 1NNLA 5AKZA 2MSEB 2CF5A 4GXNA 1TJNA 3CEAA 1DAOA 1ESEA 3NH6A 4BLVA 4Q39A 4ADSG 4D41A 1WCIA 5CX1A 2Z4TA 4OJYA 4BO9A 1EWQA 4KJZA 2GEUA 4P9NA 3RAGA 1RI2A 4D1YA 1YR8A 4H6PA 3LPLA 1NXWA 1UCFA 2Q9UA 2HLDD 4C2AA 3MJEA 3W1WA 5B3JC 1YQDA 3ZGVA 2BAGA 2FI1A 1A9QA 4Q3AA 1TAHA 4INOA 4AYXA 5JXWA 5FA6A 1VLZA 1JFTA 4KXXA 4BY9E 1RKXA 3KUXA 3FHLA 3R3XA 4OAPA 5TLSA 1SY7A 3GWGA 4G23A 5BYAA 4RJLA 4CWAA 2GM5A 2RK6A 4BP8A 4IY1A 4ZXPA 3OLWA 3ND8A 1NW6A 3SXUA 1OF1A 1Z88A 3OBIA 3SOPA 1P31A 3W3ZB 4HUJA 2I2WA 1TLFA 4FFMA 3SZOA 3UHPA 1A7AA 3GDFA 3V4SA 1TT5B 4G0VA 5M34A 1PLJA 1SIBE 2AOTB 3PX7A 3DYVA 1JJAA 1FQOA 2SNIE 4GNKA 4LOLA 4PRYA 3HY3A 4UBOA 5ALXA 5ED0A 1G0NA 3AEKB 2OAP1 3PNSA 3OF5A 2QX4A 1QNFA 5KSYA 2VHJA 1EE1A 4IF4A 2OFFA 1ARZA 1DQYA 1UZAA 1XALA 2W83A 1B0ZA 3DV0A 3OLXA 5E6UA 1EWVA 1QV6A 2EDCA 1QRUA 3LWNA 3NALA 4AAYA 2FRDC 1U2DA 3PG5A 3HKCA 1V7QA 4BO7A 6GPBA 5I7VA 2XCSB 2AZXA 4X90A 2V7WA 3PBKA 1EP9A 1QH8A 1BOOA 2XTMA 3MWEA 4NECA 4D0RA 3JZIA 5ARDA 3ZQKA 3E9MA 2P6NA 5JAMA 4F9GA 2JJQA 1XQ1A 3GJXC 1OBOA 2WYHA 2G5PA 1Z6XA 4LOJA 4YJDA 5FI1B 1J9ZA 3B3FA 2QX7A 3AF2A 4G5QA 3LNTA 1YONA 3ABZA 3R6TA 4JLOA 1L5YA 4BASA 5BUCA 5LP6F 4D8YA 3PNBA 3TKAA 3W77A 3D3EA 2A5GA 3OECA 5DGDA 2PM8A 3QOYA 2B61A 3GRRA 3V7FA 1OMOA 2HNBA 4MS1A 2DBRA 1QS0A 4U00A 4AP5A 4E5SA 3BXOA 4L0MA 4XDGA 2QV7A 5BSMA 2IE0A 4MKZA 1XKXA 4Z7OB 1ZM4A 3IAUA 2MSLA 5E2AA 3W5HA 8MHTA 4XD2A 1CIPA 1W1IA 2Y1EA 1TVCA 2O1EA 3OCWA 3QA3E 1SVUA 3W3AD 1Z08A 2XLCA 4LZNA 1QTQA 1IBSA 2W6JA 4F4CA 1AF7A 2XNDA 4EG8A 4UARA 2WSIA 1R12A 3VH1A 3ESXA 4CIYA 2R751 4L3OA 1U1DA 3E7XA 4OHZA 1CUSA 3B1JA 1A2OA 1RJ9B 3KYIB 4Y6SA 5EE5B 2ODBA 3FPKA 1AS2A 3KD2A 3WBFA 5FWXB 1B23P 2HSJA 4YI5A 2MU1A 4BN5A 1JJVA 1NC3A 1EDDA 2VUIB 1VPLA 1E60A 1P1IA 1VJRA 2D5BA 3NJ4A 2YV3A 1BRTA 4RTLA 1G6KA 2H9YA 3ZIUA 3PTLA 5B12A 2PJRA 3DZHA 1B0UA 4G4SP 3SM9A 3A3NA 1NF3A 2PMEA 4JGIA 2NV6A 2EJBA 3ED5A 1JF8A 2VDUE 4PTZA 2JAQA 3O9MA 3JAWB 1AQLA 3F7NA 2FZWA 3L8CA 2F3SA 1CJMA 3GVHA 3RF7A 3ITKA 5HIAA 5IU6A 1TUIA 5B3KA 1S1CA 4NK4A 5TQ0B 1EVLA 2O54A 2RHCA 4JQZA 5KNBD 3N8HA 4LSMA 2B7LA 4CZ2A 3J80A 5AKHA 1IBCA 2OG1A 4G97A 4F96A 1SRRA 1DU4A 1UPBA 3B38A 4KXVA 2X1VA 2YDYA 4CUZA 5I9NA 3CURA 3NU1A 1P0IA 3OM0A 4IIUA 3OOHA 3OZUA 5CLGA 1BS1A 4BEJA 2QG6A 4UTNA 1QANA 2BJVA 1C4WA 4CV0A 3EVGA 2FW9A 4C08A 3UHOA 4DMUB 3HSSA 1Z5PA 1L7EA 4D45A 2WJ6A 2WWHA 5FO0A 1WQ3A 1Y5IA 1ZGCA 4N1AA 4BFSA 4MV9A 4BECA 2ZU0C 1DC7A 4KQ6A 4YREA 4EYQA 2TMYA 3RHTA 1YGPA 3H2KA 2L82A 4OHXA 1D3AA 1OGYA 1XJ0A 4NMLA 4L2IA 2YJ6A 1ZM9A 2DPLA 4KR2A 2GA9A 1SQSA 2BE9A 3RRZA 3EULA 4X8LA 3HP4A 1T0HB 4F3CA 1FFXA 2JLZA 4JGBA 2HMAA 3SCZA 2IHBA 3NC4A 5IAEA 2IIQA 1ZGAA 3A1CA 3JYOA 5BMVF 4AMZA 4D3FA 2BV3A 4JENA 1CQXA 5HM6A 1FF9A 5TR9A 5UKDA 4HFNA 5GVSA 4BTEA 2NPIA 3K0FA 2R6AA 4AZSA 4GLFA 5LKRA 3DF9A 1EHYA 3JQCA 3MM4A 3DDNA 1G5HA 4HNAB 2W6NA 3BK1A 5HMLA 3RRYA 2PUVA 2D3TA 1UKYA 4R0VA 1GNLA 2R2AA 2XYQA 2Q21A 4TWIA 2FLVA 4TMFA 4U2EA 3BXEA 1CVLA 4ZEXA 3T34A 4ED9A 2FN7A 2Q62A 3L7IA 1V45E 4B2PA 4EUNA 4QUHA 3VVMA 3PF9A 4AC9A 4W63A 5C8YB 5CLIA 2JGEA 1SXJC 1TMGE 3EOAI 3QE2A 2HJRA 2J5RA 2PRJA 4OMFG 2GETA 1X86B 2ROQA 4F9FA 2O4CA 1XNRB 4Q48A 3DO8A 4A2QA 3U09A 4YN3A 1L7AA 1YO6A 3TLKA 3C6QA 5LXTA 3ASZA 3RJZA 4KFCA 3MTEA 3ZI0A 1NVFA 5C3MA 3KTAA 1JG3A 2ZBQA 3Q9LA 5EMHA 3U13A 1ZXLA 3DE0X 3ZJYA 2C77A 3A1NA 4H6XA 3SEZA 3KXKA 3ZHCA 4TMXA 3QEBZ 3K0EA 1C1XA 1FNSA 3X1WA 1U0JA 4CIVA 3K53A 3NKVA 3V4RA 3FFWA 5DBEX 4FEAA 2QL7A 2QWXA 4XIGS 1JZSA 4CIXA 4ZZ0A 2BZSA 2H5IA 4PIMA 2XMDA 3SK0A 3COZA 1UBNA 2AR9A 3T7AA 3BB4A 1LF5A 1UFRA 4NIMA 5HTOA 1YZYA 2O06A 1YH3A 3ZLTA 1OWLA 4BVFA 2OZLA 2J0UA 4D0NA 1C1XB 3VV3A 3MUFA 2C3PA 4AB1A 3A1WA 1R9NA 5A9SA 2WHPB 2RH9B 3D8HA 4JI4B 1KP9A 1GUZA 1N6OA 1VI5A 1YNOA 5K3FB 3CLSD 3HB9A 5BPFA 4MDFA 3CE9A 2OCLA 4NABA 1QGDA 2FN4A 2G0TA 3KNZA 3QX7A 4IKPA 4TXLA 2IDKA 2B4QA 4A2CA 3RAEC 1Y9AA 1VGVA 4BQPA 3EA0A 2ZRKA 1N5IA 1W5BA 1JR3D 3SXJA 1WLYA 1G55A 2A8YA 4TQAA 4R9NA 4I36A 4ZEVA 3LUCA 4UTOA 3BPSA 2UYHA 4BMPB 4P0QB 2QA5A 1XVIA 4NZOA 1W6RA 5AVQA 1U28A 3PHHA 4G1CA 2C2ZA 3CXUA 3NHMA 4JH0A 3T9AA 3GGOA 4ER3A 4PZAA 4KVFA 2ECPA 1NRXA 2CXPA 1UKEA 3NB0A 4GP9A 2QL9A 4TTQA 4FX2A 4CFYA 4D3YA 1UPCA 3L2OB 1MBZA 4JLVA 5G0UA 2HEGA 1RSZA 2GPYA 1HK7A 1C7ZA 4B6OA 1OXUA 5D3KA 1B2RA 1N8TA 3F7OA 4X1YA 1AM4D 2QF7A 3H5VA 4B76A 5JEDA 2P7HA 2QOEA 3M2PA 5L3VA 4TLMB 1BJKA 1GCIA 1C3JA 1DMRA 5ALLA 4ZKDA 4WQMA 1KOFA 3ER9A 3ZCTA 1E7MA 1CJKC 3QVGA 4OXNA 3G2NA 3FSGA 2F64A 1ZSYA 2ZUBA 2H00A 3LZDA 1YBVA 1D4ZA 3Q15C 4XFKA 2V7PA 1ZOOA 5DI3A 1RRPA 1Y98A 2P2LA 1QQBA 2ZUEA 2PDAA 2JS7A 4GSLA 1RWOA 3KZ1E 3M2TA 3SDZA 5CVDA 4CEIB 5EKDA 2O3UA 4XGRA 3ORFA 1JIVA 2C1XA 1KK2A 3L7NA 4KRYA 1V25A 1WUHS 2NO0A 5EERA 1ZUHA 3BXXA 2QVXX 3OMXA 1A97A 1XLTC 1NE7A 3NT2A 2QMUA 3QU5A 4OA5A 4R2LA 4IM7A 1TYAE 4MGKR 3K96A 2F90A 1TU4A 3P52A 1SC3A 1CWUA 3B9BA 5AJVB 3N2YA 1DBQA 5FTNA 4WFJA 3UYKA 1W8DA 5CXUA 5BN1A 3BGVA 3K70D 2L19A 2GILA 3KB2A 1JJ7A 1QRAA 1KYYA 3KQQA 3IE1A 1S3GA 4HPJB 3BXFA 4OM8A 3RC8A 2AJDA 2J3MA 4DLYA 3KVRA 3OPYI 3OVMA 5CYGA 5JYDA 2FSSA 2DECA 3AIKA 2Q3JA 3KOOA 4B7AA 5KWJA 4C1NA 3H11B 4DBZA 4JR1A 2EW8A 3AI3A 4AROA 3I1YA 1O03A 3BTOA 3STVA 3BSFA 2EATA 3N0XA 4Q9KA 1L7MA 3L6DA 3DS8A 2W42A 1E9VA 3RASA 3Q40A 2X4GA 5HIKA 1V71A 4DLTA 4V39A 5DHPA 1XHEA 1UANA 5D3MA 4ROTA 4ZTZB 4X6XA 1EM6A 4XDHA 2R5WA 2RHMA 3V8NA 4ZTUB 3L3BA 3RYTC 1RWNA 2DERA 1YZUA 3VHLB 3VKFA 2EZTA 4M98A 4DMGA 1OXSC 1SBZA 4I5IA 2ZSDA 3I4FA 1EFTA 4CF3A 3IIIA 1YQ9A 2CYCA 5LA6F 3OIVA 5KPDA 2Q6OA 4X44A 2H85A 1GKYA 1Z4LA 4Q6WA 4RYDA 4ALLA 4FOSA 4CG0A 1NU6A 3AI1A 1ZD5A 2ZKIA 3CEJA 3N53A 4HDSB 3KZOA 2UDPA 4OLHA 4UATA 3EGCA 5A5GA 4UZFA 2G25A 3HH8A 2QL6A 4O0MA 1BCRA 2PFSA 5G2OA 3KIPA 1RTTA 4MGYR 5DHQA 2FZGA 1LW6E 2E18A 1BE1A 4LZAA 1QO0A 2BMEA 3G59A 1T1EA 4S35A 4DXHA 4F5EA 1B73A 1ZJJA 4GXTA 1MO2A 4RELA 3MUOA 2EU8A 4CV1A 4DNFA 4AJPA 2BFAA 2FZ4A 3DXYA 3H8VA 3PHBE 3FDFA 1LDMA 1H1LA 2VRNA 3C48A 5EIOA 1SKYB 5J4VA 2PUFA 1J7JA 1O77A 2O2DA 1FFDA 2BOVA 1U8CB 3IO5A 3WTBA 1R0YA 1DAIA 5AR1A 4IVQA 3PXAA 1JLLB 3GDHA 2BSAA 4CI0B 1NZDA 2BM8A 3EG9A 1OU4A 2EFGA 3QFTA 1P4HA 4NJEB 4PE5B 5I51A 2XUGA 3S7TA 3GJ0A 1AVTA 2W6IA 1GCOA 1T4CB 3IAM6 3MINB 4HXFB 4HAZA 1G7CA 4WADA 4M0CA 1WP4A 2F3RA 2Q07A 3D1VA 3ZY4A 1TKCA 3REQA 3VBCA 1DLIA 1J8QA 5HIJA 1XRNA 2EF0A 4PC7A 1YB2A 2VTKA 1K9VF 2HCRA 3ESYA 1B93A 2EX1A 3ANNA 3K1JA 1M72A 2Y2VA 2IA5A 1N0VC 1H6AA 3FSRA 1Z22A 2JBWA 1AKEA 2BFEA 3SZLA 4CMEA 5A4IS 3CBQA 3MXOA 4YYZA 1QVRA 4F9TA 3FLAA 3ESRA 3QE4A 3GT0A 1AXRA 4XQCA 4WUTA 4CODB 1QHIA 1XNHA 1XROA 3TZHA 3K3PA 2ASVA 4C4XA 3OUUA 3DVLA 1XPRA 1CR4A 4FFPA 3K6KA 1JIQA 1DQNA 4OHVA 5EJGA 5GP1A 3ZE1B 4J4BA 2J08A 5E6RB 3BKXA 1SOUA 1F8XA 1Q2UA 2GF9A 3ZIAA 3K4QA 5K3EA 2GD6A 3FH0A 2AN9A 4OXIA 4QPPA 1P1HA 1Z4KA 2E5WA 4H0FA 3K0HA 5BSTA 3R8CA 1KEEB 1LWOA 3W2IA 1TCVA 1M7HA 4HL6A 4FILA 5DVZA 3E05A 3V48A 3AZOA 2G8NA 1SOVA 1JHDA 2A9VA 2D2FA 3HA2A 4P93A 4QE3A 1UKBA 5F4ZA 3OIYA 4FX5A 4D81A 3U3JA 3FLEA 5BOVA 3AOEC 1EZ1A 5F73A 2ZAMA 3WGQA 1ZU5A 4LHYA 3GUVA 3HPRA 2YRXA 5KMGA 5I7UA 2BLLA 3BS4A 2X8BA 3GLHE 1Q11A 2O2YA 4PAOA 3FDZA 2TRSB 3O31A 3TCNA 5KYXA 3QHPA 3EF1A 1NM5C 2PZGA 2A0YA 3NBXX 3U4QB 2F8SA 3ODGA 1ESZA 1YJ5A 3ADPA 2FEAA 1JTVA 1QRDA 1PT9A 3AEUA 1J0EA 2XMBA 4HGRA 1D4FA 3C41J 3G89A 3OQ1A 3I92A 4JMLA 3TPCA 3LY7A 3N8IA 3NOQA 3EFHA 2PS1A 2BEKA 2CFCA 3H0CA 2GX6A 5IC4A 1ENYA 5K6TA 5I9LA 3REOA 4BX2A 2EW1A 1ZX1A 2DX7A 3IHLA 3M1LA 2IUEA 3RLFA 2FF5A 1W35A 1GA4A 1CUEA 1JXAA 1L1EA 2ILTA 3CUUA 2QVLA 3MUNA 4YACA 2DQYA 2GMWA 1X1EA 5IYZF 4R0MA 4RTQA 1GRVA 2CXNA 2XWPA 3JQDA 5KDDA 2D1SA 2DWUA 2VJMB 4RY2A 5A9TA 1ULHA 1SC1A 5JVDA 2VP3A 4C4TA 1XCJA 3IIMA 2WIBA 2VUTA 3BOSA 4UCXA 3RIGA 4DPLA 3G68A 4RD2A 4R05A 1UMCB 2PX2A 4O1IA 1ZMXA 3LAWA 3PDIB 5GZ6A 2E1PA 3PC7A 3ZDEA 2JHPA 2XNJA 1FXSA 2Q0HA 3HXTA 2J1LA 3TNYA 4M7PA 2G36A 1KVRA 1NVMB 2QPLA 4IDOA 5HYVA 2W2VA 5HFAA 1I94B 4FU0A 2IODA 4AMVA 3RUDA 1KY5A 4B47A 1OU0A 1F6WA 2PV0A 3A0UA 2X4LA 3Q7IA 5BMOA 1I24A 1XZAA 4HAIA 1BD3A 2OAGA 3SEFA 4EM6A 4B3SB 4M9XA 5FLXA 3PGLA 4IDFA 5B3LA 3U9TA 1GJRA 4NSNA 3MJVA 4ZODA 5AVXA 3T4EA 4WH0A 1GTG1 1KMHA 3W8RA 1RNLA 4I50B 4OSPA 4TL7A 1GG5A 2YNMA 5J2TF 4R7GA 3IJ5A 5K8UA 2JFBA 5IBQA 3HEMA 1ZAYA 1TTQB 2QRLA 1G4AE 1G5FA 1M10A 2OUIA 1QGAA 3K8OE 4CI9A 4DYHA 2DFNA 4BXOA 2V4ZA 3BA6A 1BVRA 5C8ZA 3WOVA 2YFYA 5DRYA 3MAJA 1GTSA 1KBOA 3KUKA 2QG4A 1UMBA 2I3AA 4LGMA 1P1CA 1GEGA 1ID1A 4JA2A 1LNZA 3UJ3X 2KLBA 1JILA 1KZ9A 5KI6A 2XA9A 3TOSA 2V7TA 5FOVA 5K4AA 4WBNB 2YVQA 1T15A 1U8YA 2BTQA 3HY4A 4LFAB 3D3KA 4MV8A 4EB8A 1AZTA 4OPMA 2RBKA 3KS9A 4EW3A 2Z2ZA 3FN4A 2XNHA 1TYDE 1SBTA 1ZRHA 3TXAA 1KMNA 2IYRA 1VIYA 4FK8A 3PR2B 2OQVA 4TVBA 1J22A 1O5OA 3EMKA 3LCRA 3Q3JB 4IGIA 1OWNA 1XXHB 1H1LB 2C3MA 3AP2A 5CH8A 3UG7A 4WK4B 3ZZTA 1QAQA 2XMCA 4J2HA 4KN5A 4JC8A 3NTLA 4MVJD 2F1IA 3DEKA 4O4IA 2UUBB 2HK7A 3ETHA 2FSVC 2HMTA 3NOVA 2J9XB 4XYLA 1WEKA 3C4VA 4RETA 5JD3A 3DFIA 1H0RA 2GN1A 4DWJA 1W5AA 2GLUA 3ACBA 3BK7A 1HM5A 1IN7A 2DF8A 2GEVA 2H3EA 3DL0A 3K72B 2GQ0A 2Q6KA 4I9GA 2JFQA 3ABIA 1XRLA 3LRPA 1LLDA 2BEVB 4IJKA 4MR7A 5F2EA 5K8VA 3U6KA 3O7WA 3J7AC 4EKNB 2VDJA 1QVAA 4FFDA 3PJDA 1M76A 1JDPA 2REXB 2X0JA 1KE2A 1DRUA 4FW9A 3RFUA 5ALWA 2J3JA 3JVUA 4M8SA 1RWVA 3AR9A 1C9MA 1V1MA 3BIJA 3GFVA 5DJ5A 1FQKA 4AMYA 1K27A 4YBRA 5DLQC 5DWDA 4HCJA 1B6SA 4IFBA 4R1UA 3A27A 2E7ZA 4B46A 4BV9A 4DEVA 5KQLA 2W48A 2WSYB 1XFAA 3CNNA 3TMAA 5LU8A 4X62B 4KNYA 2WHYA 4UM9B 2E6KA 4OXXA 1GUAA 1D0SA 2IPOA 3W8DA 2QE7D 4NCBA 1JDTA 2HHJA 1YJBA 5FNVB 2I6SA 2GASA 2WUWE 4R1OA 1U3VA 4P4TA 2ZS7A 2ACEA 4IIHA 4LVNA 4Q16A 3HFGA 1JMVA 2ENUA 1OASA 2C9MA 3M6AA 1KYWA 3ORHA 5KNBA 5DNYB 2VNIA 1FDIA 2Y1CA 4TRRA 1FDSA 1P2UA 3MN1A 3MZ0A 3SKYA 4TV8F 2ZIZA 4RPGA 3C6BA 3OZRA 3OF2A 3NPAA 4NZ9A 2Q1SA 3SG0A 4IO0A 2AGVA 3PTZA 1ZJYA 2QROA 2GXQA 3ZH9B 1RCFA 3AVPA 3BHMA 5F3WB 4RSMA 3FE2A 3KKQA 1TAGA 3AETA 2CXQA 1NRWA 1OI7A 1VG0B 2M2IA 2QM0A 3KDAA 4P80A 3TRIA 3TTSA 5KQPA 1H6DA 4DRYA 4O2BB 3KT8A 1PR1A 2G4VA 3IHWA 3MJFA 4V0OA 4O25A 4MYSA 3BSYA 4R8MA 2PUJA 1E1CA 1N4AA 1NN5A 2QR2A 5AM0A 3LP5A 2EJWA 4GZ5A 1N77A 4C29A 1RIIA 1IN5A 4LUCA 2G28A 2JA1A 4QOIA 4QDJA 2B78A 3ETDA 3GU3A 2G9QA 2QRKA 1HF3A 4P53A 3SM3A 3UPDA 5JDIA 5L8VA 2MJLA 2E55A 4P0TA 1IUNA 1JSCA 4X84A 4IIDA 3RUIA 2B82A 1JFLA 1Y1KE 1UDBA 3TPFA 4E4YA 3ZJVA 1N33B 4P35A 2IUYA 2PLWA 2GZ3A 4LMRA 1RVDA 3SYKA 3U40A 4D0LB 2WYVA 3NASA 1YZVA 3M6IA 3WYGA 4A8JC 5ESDA 4D9NA 3ZV6A 4D9EA 1LTQA 1OLXA 4EKIA 2NUBA 4RQTA 5DHTA 1BEUB 2VG8A 3FB4A 1VKRA 3LT0A 3NHUA 4L16A 2IUTA 1CUWA 3UXHA 4LF9B 4N12A 3RC3A 2AG8A 4KAFA 3RVSA 5CVTA 5FDFA 3BH7A 3OQBA 4UHJA 1DSSG 1ZS9A 3QY9A 4CF7A 1QGUA 2KQUA 4EO4A 1ZOPA 5DGIA 3S81A 2J9ZB 3RC9A 1EHCA 1Q3HA 1XA3A 1SH7A 2OQIA 2VT6A 2QLMA 3DV9A 3IDOA 1RWXA 5FOWA 1M6VA 1JLKA 1YI1A 1CUFA 1BCSB 1VC2A 2Y1DA 3OEWA 5KTSA 1I8TA 1VBMA 2PH3A 4UHDA 2P3LA 1PBNA 1E2KA 5HFJA 5EG5A 3V97A 3VDRA 1RLTA 4GGOA 3V9PA 2D0IA 1DTEA 5FL3A 2ZJ1A 3DZCA 2NU6A 2QIPA 3L93A 3ONVA 1WUIS 3RHSA 2W2OA 3KDPA 3F1LA 3VYVA 1KEUA 3DV2A 1IY9A 4PQGA 5J3JA 2WA1A 3JD3A 3I28A 1PFVA 4REMA 5FFNA 4Z99A 4DMMA 1EFDN 3R8FA 4DQKA 3WIVA 1UDAA 2H08A 3UKJA 4N5LA 1BZYA 2GB4A 1ABFA 4G4GA 5KWEA 2OM6A 2OFOA 4R4JA 4ACAA 4BNJA 1FYDA 2GGSA 3LOUA 2NU7A 2DCUA 3L7MA 4OQPA 3VDNB 1H05A 3QLUA 4FZ5A 4K9DA 4L8VA 1B1CA 1E9CA 2IHZA 3JQGA 4IICA 4Y67A 5I7SA 1L7BA 2JRCA 3FNEA 4W99A 5C35A 4F3KA 5IJWA 2QMOA 2GYYA 4MEBA 5IBPA 3ZY5A 1TE2A 4BO2A 6Q21A 4L1KA 4L72A 2IOQA 2WAAA 5EXXA 3BCSA 2XECA 3HJRA 4AWXA 1NQVA 5IEBA 4IW3B 3WS7A 1Q57A 1XMIA 3HZHA 5CLJA 5AFSA 5D00A 1PQUA 5HA5A 1T36A 2Y0DA 2Y0PA 3NBAA 3PFHA 3E5HA 2XOXA 4V0RA 4R2XA 3UAOA 1SBQA 1J8FA 4CT0A 3KJEA 3LLUA 4ZYUA 3JD0A 1B43A 2J4DA 4QUEA 4UAUA 1G20E 1YUBA 2IEGA 1V11B 2WIGA 3WR5A 2UUAB 1GPLA 4QBFA 2UVDA 4QYTA 4KE6A 2ZIXA 3G2MA 1DE0A 1KSJA 3IXMA 4ALIA 4RZ3A 3N7AA 1I3CA 2F59A 4Q01A 3IYLW 4YJ3A 5HBRA 2VHEA 3DDWA 1AA6A 3NHZA 4RQUA 3MMNA 2Q5CA 3VYUB 2GOYA 3JATB 3VO2A 5JFGA 1FP4A 3A8TA 3V80A 4ETIA 5DNCA 3AKZA 1V1RB 4HQRA 3E3OA 4RORA 5EQTA 1RHUA 2HLNA 1P7VA 2AG5A 3DYBA 4LBWA 4A8HA 1NJFA 4HUQB 1FYFA 2X3YA 4UM5A 3GCWA 3GJ3A 5E3IA 3RYFA 5BW5A 2ETVA 4IJUA 1DBSA 2Q4TA 1GSHA 5CH3A 2ZRDA 1UEXC 4Q3BA 1DEHA 3OA2A 1AD2A 5A3VA 3BRSA 3NTOA 4ZKEA 4I5EA 3TW6A 2BMWA 3W5UA 4ERXA 3FI0A 2ZUTA 4KPGA 4DPMA 2CLEB 2WB4A 5A3SA 4A6PA 1V11A 3SSOA 2XRFA 2VF7A 4D6YA 4XEUA 3FCOA 1YTLA 4K9PA 3B13B 4CXMA 4JZYA 1JQLB 3WTCA 3RSQA 3IXQA 1YHNA 5I45A 5JG7A 2QTBA 1FFGA 1T6BY 2ZSFA 5KUTA 4DCVA 1U1FA 2PS0A 4YHBA 5MGBA 1Y3AA 1JQ3A 2REOA 4H35A 1I6MA 2OEPA 3ZBTA 4G1VA 2ZPAA 4JBIA 3NIBA 1HX7A 5BSGA 2EEZA 3H5RA 5FJJA 3FLBA 2BBWA 5DASA 1ZW6A 1NT2A 5EJMA 3TDNA 1C2TA 2BRUA 3DXZA 1JJBA 5WRFA 5IH7A 2VJKA 4IXWA 4RNDB 3RIEA 3X0DA 2VF5X 1WL8A 4LVUA 1M2KA 3NBYC 4XPIB 1UPFA 1ZMOA 3GGPA 1FP7A 4MDHA 2B2NA 3Q87B 3WDKA 2JB9A 2VCEA 2ZB7A 4HSEA 4KTVE 4PBSA 3RBVA 3UN1A 5BSEA 1GNRA 4BWGA 3THYA 1N2OA 3DMDA 4KYIB 4BX0A 2H7CA 2JASA 4UBJA 3KQKA 1IY1A 3MGGA 4DV1B 3COJA 1EAMA 3HSYA 3LFHA 2G09A 3VC1A 3TDKA 4EO7A 5EIFA 5EXTA 2YWRA 3DB2A 3QVLA 1H42A 1TM2A 2AMJA 3J81A 1E0DA 1N9GA 1YJAA 1YBHA 2PRKA 3GZNB 3VDXA 3LGXA 4IPTA 1W88B 1XP5A 4C07A 4KQJA 2ZYDA 4QU9A 3RR2A 2R6DA 4QKQA 1ULZA 2Q5IA 5C52B 1F3OA 4JVMA 1XZIA 3DP7A 3QLJA 5DTRA 5TS3A 3IR5A 1V39A 1KMCA 5H59A 1MF7A 3WSWA 2PWBA 2YC4C 3BMNB 4I08A 3M6LA 4HDCA 2CW5A 4JJEA 5CT6A 4CFZA 4EKDA 4MS4B 4ONEA 3PGXA 2EJUA 2OENG 3D5TA 3IHKA 5LC1A 4B7UA 5KNBH 4U7JA 3T99A 5K8TA 5CNJA 1QG2A 1RXCA 1U2TA 3OJWA 2GN0A 2XVXA 1G41A 2P4QA 3A3PA 3C3JA 5GONA 1DKPA 1CZRA 1U3FA 1E6LA 2JEOA 4YAEA 4YB8A 5F12A 2FJPA 4R98A 3BXGA 3NVDA 4M6WB 4TV8A 3AJDA 4QM7A 2H57A 5HNKA 1PT7A 4C6SA 3AG5A 1M1NB 2JI4A 4FOLA 4R1SA 2FE1A 4H4EA 1KP2A 5FADA 3DGFC 1ISJA 1XQYA 1GNQA 3ETLA 1M2WA 1PUXA 4WOJA 1YULA 4FJ2A 2O0MA 2P9QA 2NN3C 2PU5A 1EH5A 4JUIA 1XDBA 1TEXA 1A9ZA 4BO8A 5DT9A 3UH1A 1L4NA 2Q4DA 4XIYA 2ZBPA 3P9PA 1L5VA 4P3NA 4QG7A 1GWNA 1BYIA 3BWXA 3HLKA 4J43A 3TOVA 3VH3A 3CVXA 4N0PA 4S12A 5DISB 2I7VA 1U5BB 4Y6LA 4UM9D 4X92A 5KNDD 2N42A 4DDMA 1CY7A 1KMMA 2HQBA 4K28A 3I73A 2P6RA 4XWKA 1CLEA 4RMIA 3QXHA 3RS0A 4HAOA 1JFRA 1H94A 2YN0A 4G0XA 4DG8A 1ACLA 3EZFA 3DAYA 4DG9A 4HOYA 4XX0B 4TQ9A 3OFND 2ZWOA 3HYLA 2QZ9A 3IIEA 5CLHA 2BFBB 1PNRA 2VXOA 1QHFA 2JJ1D 3IBCA 1ZO8A 3OAAA 1F4LA 4PLVA 4L8YA 4QL3A 4RKFA 3AR5A 4TGLA 4EF6A 3GGSA 2R1UA 4S1VA 2REQB 4FBMA 3I23A 1ZKDA 4JLJA 1SKBA 3ICOA 4ARSA 4LWOA 3JPYA 2E85A 1EP3B 1BWRA 4PYMA 4ENWA 1IQRA 1HE3A 5BVHA 1AN9A 2YWEA 2NT4A 2GHQA 3E9YA 4FR2A 4RESA 3LTNC 3TRFA 2YDXA 4XWWA 1H9BA 1Z5UA 1YZTA 3H6KA 4RH1A 2IV2X 4BO3A 4WERA 5J4YA 1EFCA 1V35A 3MBIA 4IWNA 5KCZA 3SE0A 2NZ8A 5IZ4A 3WMGA 1PSZA 3B7WA 1PLKA 2R8EA 2B34A 4W5WA 1U7UA 3TTXA 1O87A 5JARA 5CDGA 2JLAA 4HVCA 2F6RA 2H52A 4XGIA 2RH5A 5B1DA 4BMVA 1WDWB 1T43A 2ZWMA 3PIDA 4JP8A 3L0PA 3UJPA 4RDXA 4HNTA 5ENZA 1TPYA 2AOVA 4M83A 4WFIA 3UJ7A 1MFPA 1LFDB 4U7TB 3NAMA 2AJCA 4PZLA 4QDZA 5DM4A 1F6DA 3STXA 4UU8A 4JEIA 2RGBA 1F4PA 4IDAA 1CY0A 1O54A 2P1DA 2ADOA 5IG2A 1YZFA 4ZCQA 2WQ7A 1GVNB 3KSAC 1NQOA 3SX0A 4C0SA 3WRYC 3AF6A 5H68A 4MUIA 3O8QA 4P0PB 1DVRA 1FP4B 1PTKA 2H16A 2I99A 4C7MA 2AB0A 3R5FA 5DHUA 2Z6VA 3VR5D 2AVNA 1ZVJA 4UMFA 5DXJA 4ARVA 4DUZB 1TM5E 3KVOA 1W4RA 1UOPA 2EP8A 4RHEA 5EE3A 1N36B 1XNJA 1Y34E 4JBHA 2NUAA 3KEMA 1KAMA 2FWPA 3OKFA 1RQ2A 1UAYA 2XCOA 3AF1A 2WSSD 3E27A 1A8PA 4Q4HA 3ZK8A 5HP4A 3PC6A 4FYJA 1QMPA 4ZRDA 5AW8A 3DULA 4A10A 1H4VB 2IHNA 3HPQA 4WKOA 4IBOA 4O3FA 1A8UA 2YIDA 3H5LA 1C1DB 2QMYA 3P2IA 3LE8A 5HDBB 4OKNA 4ZQHA 2G1UA 4J0HA 4MRAA 3FNGA 1H93A 4Q02A 4E5YA 5CU7A 4ND8B 1VRWA 4NX2A 4TWBA 3UMGA 3ELBA 1MC5A 4WKCA 1Y6RA 1F6BA 4QUAA 3PQDA 4BL5A 4YJ3F 3FJ1A 4QRIA 3VMMA 1M8PA 2OY0A 3DE1X 3U9SA 5F1PA 2BUAA 1CNMA 4NOMA 4O8ZA 5F98A 1BVUA 2IX9A 4DV2B 1UUFA 1RMQA 2O0HA 4I55F 5HRUA 1HLGA 1RWKA 2A1UA 3O93A 4COOA 4JC5A 2VTBB 2IS1A 3CW8X 1TTPB 3ICPA 4GWGA 1BFKA 2OCYC 3WA6A 4JJZA 4G84A 3QA9A 3A14A 4YJ2A 1R00A 1QB7A 2I87A 3K1TA 1WF3A 2O7QA 3U39A 3KJZA 3SMQA 1NAHA 2PLFA 2UYGA 1COWA 3IVAA 4WXHA 2W8ZA 5E8JA 2FHSA 2GKOA 5CDFA 3PQEA 5AESA 2WK1A 1UBLS 2WVAA 2C5AA 1ZIXA 4N8SA 2O8EA 1Q2XA 1KJIA 4R16A 2C7OA 1A9SA 2XXBA 2OV2A 1O7JA 3G2PA 2O0JA 3GV0A 1ZM7A 3OJOA 5ENVA 1F2TB 2B3TA 5BV7A 1CQIA 2INGX 2ZYSA 4WL0A 3WK4A 2RK3A 5IMBA 4DA0A 1YJXA 2PUCA 1KF0A 2B1QA 3BM5A 2JKYA 3H1AA 1U9ZA 2QRMA 5FUXA 2G1JA 3ONDA 5I6DA 1XL0A 5LD2C 3AR8A 3GYBA 3GLQA 1NGSA 3K9NA 4EYSA 2BEJA 2QTRA 2V3VA 3G1TA 1RYMA 4AIRA 1Z5OA 2IVZA 3AOEA 2H4JA 2WYUA 3MWGA 2EL7A 3TLYA 2O52A 1AUOA 3PDHA 2Q1WA 4DXDA 1JEYB 1PEAA 4LX0A 4E2YA 2BFPA 1JJFA 5F51A 2W37A 3TZCA 2V9CA 1A5BB 2KB0A 2ABWA 2FSFA 4GSYA 2WAXA 4Y1EA 4BE7B 5LQKA 2RG1A 3HLYA 3MT7A 2XQFA 1PR0A 4O4IB 2QTHA 4URYR 3OZFA 4WMLA 4E5NA 1OZGA 2C04A 3WXBA 3IUEA 4J9VA 2X5JO 1U28C 4JL5A 3NUZA 2HWXA 5ALFA 3RLIA 3EOZA 5HKBA 3EVCA 1TA4A 1R8SA 2HU7A 2RG7A 1RC8A 3CGGA 1R0SA 1IPHA 2H8GA 1HDEA 2R8YA 3Q1LA 1P33A 3DPSA 4LNHA 2W5UA 3DE5X 1UMKA 2YVLA 1GYPA 2PYIA 5FULA 3ZCPA 3UB3A 1Y82A 2FUG6 3PYLA 1I7NA 2HB6A 4B32A 2P0EA 4HWPA 3F90A 4IIJA 1N5RA 2DKOA 1IVYA 3VO1A 4C0WA 3FPEA 4G41A 4K87A 4Q4AA 4UDXX 1PG5A 5AK6A 4K9SA 5KNCD 4WZAE 4XJSA 2CJWB 2QM8A 2OTCA 4KLCA 3AETB 4ND5A 4MUGA 5IHXA 3BXZA 2O8CB 5BN4A 2PVSA 1V47A 5F1OA 4UDNA 4HVLA 4AKEA 4DTIA 3Q3IA 4CDNA 5JZBA 3GLFE 3AFHA 1YMQA 1QPZA 2OORC 5A0TA 4UMEA 3VR4A 4NJMB 4E07A 3O03A 3EZ2A 4E09A 5D5PA 1DBWA 3Q85A 1G21E 3OHMA 4EMBA 1MQ9A 3LWBA 2JAPA 1A82A 2XWJI 1C4OA 1W9MA 1WUYA 1FB5A 1T4DA 3VYRB 3EPKA 4FNGA 2K5UA 4QUIA 4XE5A 3VZCA 2SICE 4B3BA 1X1TA 2H2HA 4KWTA 3HJGA 1I1OA 3RK1A 4WSOA 4TYYA 4BUJA 2ORWA 4LY0A 1HNNA 3EEIA 3G5AA 4BUCA 4EJ2A 3QPWA 3T5TA 1N2SA 1MW9X 3SQDA 4P4SB 1WCV1 3GFQA 2K7FA 3T5MA 4G81A 1SU8A 4NMMA 3GP5A 2UXDB 5AVYA 3ORYA 2YTZA 1RI4A 1Z6TA 2IHYA 5KREA 1CUZA 2HV8A 3DBLA 3DLBA 2RGGA 2IYSA 3NYRA 1RLUA 3ZLJA 1BHSA 5FWYA 2RONA 4DSOA 5CNKA 3ROEA 3G9XA 1AHHA 5IMSA 4AECA 3ADKA 5F4BA 1C8KA 1O8CA 2O3SA 2WPDD 2Q0QA 2HPZA 3FOWA 2JH8A 2CNNA 1CU1A 4J3NA 4PN3A 1XZ8A 2P2DA 3OJ0A 5FCDA 4L4XA 5TGZA 1K6JA 4OQFA 5JYCA 4FB5A 2J9YB 2GPJA 2H9IA 3HRHA 5JMPA 4D5GA 4ENUA 5BQ3A 4CL2A 5ICCA 2GJKA 4BNLA 4YJFA 1VLMA 1RM4A 2OBXA 2SCUA 4KQGA 1CUYA 2CZQA 1M2OB 4Y6RA 1KVUA 3L84A 4MR8B 1C81A 4XB2A 2X13A 2ADFA 5JAUA 1Z36A 4RKQA 3TMKA 1W2WB 2FEKA 1N7GA 2OO5A 4DUGD 1SUDA 3JQ8B 2BKLA 4W7SA 3DLHA 1E9SA 3Q3GE 2PJUA 3OX4A 3NX4A 5CYFA 3GX1A 2FJ0A 3HCOA 4G9EA 3WNCA