4FJ2A

Crystal structure of the ternary complex between a fungal 17beta-hydroxysteroid dehydrogenase (holo form) and biochanin a
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
260
structure length
260
Chain Sequence
YIPGRLDGKVALVTGSGRGIGAAVAVHLGRLGAKVVVNYANSTKDAEKVVSEIKALGSDAIAIKADIRQVPEIVKLFDQAVAHFGHLDIAVSNSGVVSFGHLKDVTEEEFDRVFSLNTRGQFFVAREAYRHLTEGGRIVLTSSNTSKDFSVPKHSLYSGSKGAVDSFVRIFSKDCGDKKITVNAVAPGGTVTDMFHEVSHHYIPNGTSYTAEQRQQMAAHASPLHRNGWPQDVANVVGFLVSKEGEWVNGKVLTLDGGAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of 17 beta-hydroxysteroid dehydrogenases by phytoestrogens: The case of fungal 17 beta-HSDcl.
pubmed doi rcsb
source organism Cochliobolus lunatus
molecule tags Oxidoreductase/oxidoreductase inhibitor
molecule keywords 17beta-hydroxysteroid dehydrogenase
total genus 108
structure length 260
sequence length 260
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.62: 17-beta-estradiol 17-dehydrogenase.
pdb deposition date 2012-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 4fj2A00
4LSMA 1GD1O 3MWDB 3OM9A 5T64A 4DRYA 5IZ4A 1V3TA 2Q1UA 3WGTA 3ZV5A 4RV9A 3EGOA 1LLCA 5KTKA 2PK3A 3P19A 2AG8A 3LZ6A 3A9WA 2FPPA 3BAZA 1X13A 2PGDA 3D3WB 1BDBA 1NQOA 5I8WA 2JCVA 3RC9A 2VYVA 4B3JA 3DOCA 1H9BA 3AK4A 3TZCA 3C3XA 3RI3A 1UDBA 4J4BA 1E7QA 1EFKA 1P0CA 3RJ9A 1GPJA 5IZCA 1GV0A 3DBLB 4B7UA 4XEHA 5F1KA 3N7UA 1W8DA 4RPLA 4TRJA 4IMRA 3JQEA 4DLBA 4W9NA 2BMAA 4XQGA 1AE1A 2P5YA 1CRWG 1AUPA 3LQFA 3BMQA 2UVDA 2ZYDA 1YE3A 3UHAA 1GYPA 5ICSA 2X86A 4AJIA 2Q50A 5IN4A 4DTIA 3B70A 3QWAA 3LLSA 2X5KO 5A04A 2UV8A 1TT5B 1HDOA 3UGKA 4D3DA 2O3RA 3WIEA 4R1TA 4OJNA 1AGNA 5G0WA 4I5EA 1KVSA 1PJCA 3JQFC 2CZCA 4EDFA 2PV7A 4Q3BA 1MGOA 4DBVO 2VYVD 5L3ZA 3CSDA 2FOIA 3PJGA 4HNHA 4ND1A 3JQ7B 1FDUA 1HE2A 3DDNA 3EDMA 4XRGA 2GRAA 4YBZA 4YAKA 1H93A 1W4ZA 1Z75A 2O2SA 3F5QA 3NT2A 3PHHA 1E3IA 3H5NA 4FQ8A 4MVJH 4ND4A 4YDRA 1KC3A 3WNQA 1ZK3A 1C1DA 1X14A 2YFQA 4RZIA 4E6PA 1LRJA 1K3TA 4AJ1A 4GMGA 4PRKA 3JQ7A 4LCEA 3ICPA 2V6BA 3OECA 4R3WA 1YJQA 3FPLA 3DXFA 4UVGA 2CVQA 4IMPA 3FTNA 2Y1DA 3F46A 3JQAD 5L51A 2VHWA 1C0LA 3D7LA 3GR6A 3OQ6A 2X4GA 2ZQYA 1N92A 1XSEA 3DEYX 3Q2KA 4GKVA 2ZTMA 5FYDA 1MC5A 3L9WA 8LDHA 3D3WA 1JU9A 3CMMA 3ZWXA 4O1MA 3WIDA 3K30A 2EWMA 1DLJA 5A02A 3ZWWA 4MIEA 5KKCA 1VI2A 4UREA 4CM9A 2OORA 7ADHA 4R54A 1EUDA 2WYUA 3TQHA 4K6FA 2I76A 4BUCA 1QV7A 3OSUA 2VHYA 2HDHA 1PSDA 2Y05A 3WWYA 2RBEA 3OMLA 2E6UX 2A94A 4LN1A 3FWZA 4IDFA 2AMFA 3DFZA 2I66A 2J8ZA 4A26A 5FF9A 3WTCA 5L4NA 3GVPA 2Y1CA 4AJEA 2DFDA 1UH5A 3LT1A 4L75A 4QECA 3H2SA 1BTOA 1XEAA 2E48A 2VUSA 4KWIA 4GAEA 4XQ9A 5EQDA 1QSGA 2B5VA 2D4AA 2AQKA 1QXSA 2W4QA 2FP4A 2GGSA 2IODA 2VT2A 5KNLA 2Y1FA 3DOOA 4NDNE 5TLSA 2D5CA 3ON5A 3ZI0A 3Q11A 1PJSA 5IG2A 3Q9NA 3KEQA 3G49A 4WLUA 4YYZA 1QG6A 1KEUA 2VWPA 1JW9B 3TZQA 3F5SA 4OQYA 4UEJA 2IZZA 1TI7A 4M86A 4GI2A 4P38A 5CEJA 1HKUA 3H6KA 5F1PA 2NU6A 4EI2A 2EJVA 4BGUA 4J4TA 5CFZA 5DP1A 4UAGA 1RPNA 1NAHA 2Q2VA 3JQ9A 4YJDA 4BO5A 2YY7A 5I9MA 1NVGA 1F06A 2W2KB 5L4SA 3ZWOA 3R3JA 1U2DA 5IFLA 3AW9A 5IAAA 2O3JA 4IXTA 5A9SB 4B79A 1CERA 2H5LA 3BMQB 1Q7GA 2NTNA 3I52A 1NXQA 1LSOA 4UEOA 2QRKA 1EUCA 4BNJA 5A9TA 2IDZA 3PGJA 1GYQA 4K6CA 3VKVA 3JYQA 3QWBA 1JA9A 3JQAA 3TWOA 1UXGA 5G0UA 2D8AA 1SB9A 3UUWA 4A27A 2BI8A 3T7CA 4CMEA 4YJGB 1Z6ZA 2NU9A 3MZ0A 4TZKA 1MLDA 1X7DA 3M6IA 2I99A 3WGGA 4CV2A 2HCTA 4O59O 1R4MB 2C2YA 3V5NA 4DVJA 4E13A 4D43A 3WGOA 1ZNQO 3QW2A 2CNBA 4IDGA 3C7AA 1A4IA 4YT4A 1ZKMA 4ZQBA 4F46A 1OI7A 1ADCA 4XYEA 1T2FA 3FD8A 1BXZA 2NVWA 4D3FA 2Z1NA 2X0NA 4PLHA 1YH3A 1U9JA 3ZHYA 3F4LA 1NPDA 3PHJA 5JCXA 4Q3NA 4Y6SA 3AM5A 1D1SA 4WE3A 5FWNA 2RH8A 3G1TA 4BQPA 1IPFA 4ESOA 3ZU5A 3BHMA 2B69A 3WYEA 4XIYA 2PFGA 1PQUA 1EFLA 3NKLA 4IBOA 2QYSA 1Q0LA 1IOLA 1MXHA 1O94A 3AUAA 1YB5A 3NDIA 1P1IA 1TXGA 1OBFO 1U4OA 1PEDA 3VZRA 4BNNA 4BNMA 2EW8A 2P91A 4DXHA 1DFGA 1YVEI 1Y8RB 3CMCO 3N74A 1N9GA 1HXHA 4PG7A 3DL2A 4HUJA 4B8WA 1NVMB 3QSGA 4IQ0A 3HG7A 5EIOA 1PZGA 4R16A 4CMKA 2EIHA 3NEPX 2D5AA 2ZYAA 2BRUA 1DC5A 1ZJZA 3AM4A 4ILKA 2BH9A 2V6GA 4N5NA 6LDHA 3U4DA 1C0KA 3OEWA 1PU2A 1UXHA 1B8UA 5TRTA 3QWFA 1KEVA 5IJZA 2TMGA 4QEDA 1BXKA 1Y7TA 4P4LA 1HZJA 3U62A 3ZNQA 4DLAA 1UP6A 1V8BA 1GV1A 4PLYA 3IUPA 2Z5LA 1EVYA 3PPIA 2FY8A 1XHLA 3RC1A 5GMOA 4MJLA 2WYVA 4PZDA 4CV0A 2C20A 1XU9A 3KYDA 4CM8B 4EZBA 3PXXA 4YJHB 3OJEA 2I3AA 2GPTA 4HFNA 3W6UA 3GDGA 3MJSA 4AL4A 4EITA 5JDCC 2GCGA 3GH3A 1VL6A 3CZMA 1HYGA 1W6UA 2G5CA 4OYRA 4JP3A 1SO8A 3JQBC 2JJYA 2O2YA 3L0DA 1U7HA 4MINA 1H6CA 2WYWA 4YVFA 1I36A 4B4WA 4CQLB 3GY0A 2DPGA 5A3VA 2AQHA 2Q1WA 3AWDA 4C7JA 3LU1A 5EESA 4DC0A 5IDQA 3AY3A 4KQWA 4II3A 3DAPA 3M2TA 4DGSA 4Y67A 2NM0A 2W2LA 5EMHA 5JAZA 1PZHA 3RAJA 3LT2A 4IUYA 1N5DA 4NU6A 1HTBA 3ZHXA 3EVTA 4QFCA 3P2OA 3AOGA 1YGYA 4IIUA 1MC4A 5LDHA 1GL3A 1VE9A 4JP2A 4J2OA 2QRLA 2WD7A 4F3YA 2D0IA 1LDNA 2VWQA 5BQFA 5CPBA 1NFRA 3BHJA 3O26A 5CAEA 1A7KA 2CSUA 2OO5A 3GZNB 3W4KA 3ZW9A 5B37A 3ZW8A 4XYGA 2ZATA 4KTTE 3SLGA 4CR6A 3VPSA 3C85A 5CDGA 2VRBA 1B2LA 3C8MA 1LX6A 1PGQA 1S6YA 3NAQA 3GG9A 5EPOA 1IL0A 3DZIA 1LRLA 4FSHA 5AVOA 2LDXA 5G0TA 4OKIA 1I2ZA 5JLAA 5DBGA 4NBRA 3A28A 3KBOA 4AJKA 5JC1A 3E18A 5A5EA 2DBVO 4Y8VA 3PK0A 3F4BA 4RF5A 3ICCA 3HNPA 1PIWA 4G2NA 4L73A 3RQSA 1I8TA 3OF2A 4CLDA 4Z3KA 2JHFA 2V7PA 3MEQA 3CXRA 3MOGA 2DBQA 1LI4A 4NI5A 4MIYA 3EW7A 2BFOA 3OJOA 1ZK4A 5TT0A 3HN7A 4TRMA 3RC2A 4U5QA 4NIMA 4R9SA 2JAHA 1ENYA 2OBNA 5C7LO 1Y6JA 1SEVA 1H6AA 5A1TA 4EUFA 3KB6A 4NPCA 1H2HA 3UVEA 3GNQA 4YR9A 2VQ3A 5HA5A 4E4YA 2B37A 4ZQHA 3JQBA 4E12A 5I9NA 1P31A 3QVOA 1E6UA 5T5QA 3FBGA 4JXKA 1XWFA 4EUHA 2VUTA 1KVUA 4NFHA 5CDUA 1MFZA 5EL0A 2IEBA 1DDOA 3FN4A 4CMAA 1XDWA 4DA9A 1CQJA 4BKRA 4P4NA 1I3LA 1XU7A 4FFRA 1NPTO 2XXJA 4NK4A 1IB6A 1T2AA 3INTA 1GAEO 3ETGA 4L4SA 5HS4A 1KC1A 2Q45A 1HYHA 4J7XA 5MDHA 4YAJA 4AG3A 3D64A 1HL3A 3KLPX 2FHSA 4RLHA 1UZLA 2A35A 1H94A 1UXIA 1SBYA 1R16A 1DHTA 3L6DA 4PLGA 4OAQA 1XYGA 4RPHA 3QQPA 2EKQA 1NWCA 4J49A 3QVWA 4BO9A 3OHSX 2PKQP 1R0SA 1I2CA 1M75A 1NQ5A 2X7HA 4IPTA 2CY0A 2Z1MA 4RO0A 1NM5A 3NT4A 2FZEA 1YB1A 2ZB4A 5BNIA 3OH8A 2X0IA 4I08A 4B3HA 3RWBA 2RHCA 4WLOA 4GSLA 3DZGA 1N7GA 3GRPA 4IIVA 3TJRA 5IXYA 2DVMA 5T57A 1H2BA 4CMEC 1K6IA 2FZWA 4A03A 5A4DA 2DC1A 4BHTA 3SC6A 2XF8A 2JKVA 3C1TA 2ZKLA 3DBRA 3MWEB 4GQAA 5JAQA 3AY7A 5G2OA 3KSUA 1Y9AA 3U9LA 2CD9A 3UN1A 5BT9A 2JD2A 2ZB7A 3TRIA 5JMPA 2EHDA 2VWHA 2I5PO 4AJJA 4W9NC 1ENOA 1T1RA 5AOVA 1I30A 3W1VA 3ONDA 1ISJA 3MJEA 4UULA 4BNUA 5JDIA 4C7KA 2PWZA 2PLAA 4MVJD 4DIFA 1PJ4A 3OP4A 2J3IA 4JROA 3PLRA 7MDHA 4DQVA 3V2UA 2NNLD 1NPYA 5A5FA 4YEDA 1NTOA 4CL3A 5TNXA 3BA1A 3H5AA 3U49A 1Q2XA 3ST7A 1GEEA 1NR1A 1LQUA 3GGPA 1SAYA 2H1SA 1C1XA 3JD4A 4OOEA 4PIVA 2ZQZA 1PR3A 2PA3A 3PWSA 4IDCA 3RUHA 4L4RA 4OO3A 1WZEA 1BWSA 2GD1O 4PCVA 1L7EA 3MJTA 2YZ7A 4QT0A 3VPHA 5TGDA 4NBUA 3V2GA 1T2EA 5AXCA 4CV1A 4DMLA 5A9RA 1JN0A 4BKOA 5A9SA 3GLQA 4BO1A 2PZJA 4ITUA 4RF2A 1HSZA 4XGNA 5F5NA 4AVYA 1E3WA 3CH6A 2HK7A 4GSKA 4HP8A 4N5MA 4YRAA 3RKUA 2GUGA 3SLKA 3OEYA 5IXSA 4FOOA 3L07A 4IM7A 1BDMA 2J3HA 3LK7A 3GPIA 2CFCA 3EZLA 3PFFA 1XKQA 2YV1A 1U2GA 2NU8A 4O0LA 1EUZA 2BLLA 4YJFB 2X0JA 1P77A 3CZRA 4MVJA 5HBRA 3UFXA 1EDZA 1HDGO 2VHVA 4NJOA 4R5HA 5COQA 3X2FA 1W73A 1XIVA 3PI7A 4MIOA 4QFDA 1UJMA 3WDSA 2BFMA 1QORA 3K96A 3PZRA 3QV1A 4BMVA 4E21A 4CM6A 2NWQA 2X6TA 4TMFA 1QYCA 3VH2A 3TF5A 1LDYA 3DZKA 4I5FA 3QY9A 4BV8A 4UUMA 3WFJA 4IY1A 1FK8A 1PR9A 3H3JA 1C14A 2JCXA 3JQ8B 4CODB 1E5LA 1MB4A 4AJ4A 2DBRA 4RQTA 1X1EA 1GPDG 4M1QA 2VRCD 1WDKA 2J5QA 1XQ6A 4W99A 1KBZA 4IJKA 1J49A 3DHNA 5BSGA 4MDHA 4ZU3A 4HBGA 1ARZA 4F6CA 3UOGA 5AYVA 2D59A 5MGBA 1GZ3A 3G1UA 2XOXA 3SJ7A 1QYVA 2ZB3A 4BMSA 2X9NA 3PWZA 1D4FA 3TL3A 4BVAA 2GN9A 1JWAB 1NNUA 1O89A 3KYDB 2X23A 5LDGA 2I67A 1UUFA 2ZJ0A 2X0RA 1N8KA 3Q6IA 2RHRA 4PVCA 4ZVVA 4CLXA 5KJFA 3NGXA 3WGIA 3SVTA 3KZVA 4YB8A 3AY6A 3KXDA 3O8QB 2ZYGA 3E82A 1WWKA 3R6DA 3WICA 2QW8A 2FSSA 5KVQA 4WEOA 4ID9A 4LK3A 4Q3AA 4HY3A 1FDSA 1YS4A 1ZZEA 1MG5A 3D5QA 4BMNA 4TKLA 4TROA 3QHAA 2JL1A 4WNIA 2PD6A 2G17A 4DMMA 4ND5A 1X1TA 5JYEA 2IEDA 3FCOA 2DUUA 3NDRA 1Y8RA 1HDYA 3OICA 4QTZA 2DKNA 3BTOA 1ZCJA 2W2LD 4H15A 1LQTA 4DIOA 5T6BA 1PX0A 4E3ZA 3TFQA 3C1OA 3D4NA 2O7SA 5FI5A 4YACA 1ZMTA 3JYLA 3I9LA 4FPXA 1OFGA 2Y67A 4FGWA 3AU9A 1VJ1A 3FF4A 4PG5A 1W0CA 4RVGA 2PZLA 1PQPA 4A2CA 3LDHA 5L7TA 4XQCA 3UKOA 5DF1A 3AUTA 2VOEA 1NWHA 3SEFA 1I2BA 2NTJA 3JQGB 4IJVA 1K89A 3BTUA 1FDVA 4ALJA 4E30A 4KMSA 2YUTA 3LVFO 1GDHA 4E0BA 4GVLA 2O3QA 4NBTA 2VOJA 1CQIA 1SMKA 1GYRA 3WSVA 1J5PA 4Z0HO 4YJHA 4W7HA 4J7UA 3RU9A 2VZ8A 4RVDA 1LXCA 1XG5A 3HUDA 1UAYA 1DB3A 1JKFA 4B4OA 4K1LA 2FSVA 1P33A 2I65A 5G4KA 2V6MA 4NMHA 4I5DA 3E48A 4FBGA 4J3FA 3ZN2A 5JXWA 4NHEA 3NTQA 5FFFA 4FJ0A 2O3SA 2PKRA 3WYBA 1HLPA 1H6DA 1DHRA 4BKQA 4INAA 2J3KA 3HQ4O 1IZ0A 1U3WA 4TQGA 4YA6A 2FR8A 3OJLA 2UUPA 1NFFA 3H8VA 1B7GO 2H63A 2JFHA 3B20A 3FSRA 1ZSYA 5BNFA 4AJHA 4CLRA 5L7WA 5A05A 2HMUA 5THQA 5CG2A 1WMBA 3BMCB 5DULA 3CPSA 4BNTA 1N9GB 1EVJA 3DBRB 1I5RA 1EQ2A 2CVZA 5ITWA 4H3VA 4Q39A 1T25A 1QRRA 4J1QA 3JQDA 4E31A 4QQRA 3OBBA 4XGIA 1WP4A 1N7HA 1DLIA 1YQGA 3V2HA 2FR1A 4W6ZA 3OQBA 1M6HA 1PTJA 3QJ5A 1CJCA 1RYDA 5TC4A 2FPIA 3GZNA 1ONPA 3I4FA 2VUUA 4RL6A 8ADHA 3ZHBA 3AFMA 1UDAA 5ENDA 1Q7BA 3HDYA 1DC6A 3ULKA 1SEPA 5JCJA 1TVEA 3GA0A 1DC3A 3B1KA 3DBHA 3UF0A 1HT0A 1RWBA 3KYCB 3TNLA 2IXBA 2V6FA 3WG9A 1KVRA 1A72A 3VC7A 1A27A 3VPGA 1IYZA 1GFSA 1VC2A 3SJUA 3ANLA 1LLQA 4PZEA 2GZ3A 2Y99A 1HE3A 4BQRA 5HTOA 1P74A 2QYTA 3JD2A 4GWGA 4E5PA 5I7EA 3I9JA 3DZHA 2O23A 3EZYA 3ZU3A 1DIGA 1BG6A 4OXNA 3ADOA 3ZWMA 3STHA 3WMWA 5JYDA 1U5AA 1VKNA 3W8EA 4JIGA 1EEHA 4D0RA 2G0TA 3ITKA 3IDSA 4J16A 4KOAA 5L53A 5DCUA 1T4BA 2ZK7A 5HWSA 4O63O 4U0KA 3AI2A 4D41A 2C07A 2Q4EA 1UAGA 2CDAA 3WMXA 4Z0TA 3QE3A 1LC0A 4O5OA 1PJBA 5DBIA 3DAFA 3ETDA 2IE0A 4IXWA 4BS9A 2SCUA 2JD0A 1EQUA 3JSAA 1CETA 4BNWA 2R00A 3H2ZA 1O0SA 1YL5A 4GX0A 4RDIA 1LDMA 2WSBA 3GDOA 1E3LA 1DRUA 2ZTVA 5K6AC 3ASUA 1E77A 3GFBA 3EMKA 4P4GA 3JD1A 2JD1A 1DSSG 3CIFA 3ABIA 5TQVA 2H9IA 2ZIZA 3GT0A 3TZKA 4HFJA 2E4AA 1AHIA 1C1DB 3WJAA 3E9QA 1QLJA 3INGA 3GNSA 1YKFA 3FPCA 1Z7EA 2AXQA 1LLDA 2Q46A 1HLDA 1P1HA 2LDBA 4QUKA 3S2EA 1B14A 1U3VA 4WOJA 3MCVA 2DUWA 3E03A 3GPDG 4RVSA 5DNAA 4XDZA 5TF4A 4FDAA 4OM8A 1DIBA 1F17A 2BHLA 1RKXA 3ZNNA 1UZMA 2WDZA 1YBMA 1IHYA 2WJPA 3MJ4A 5K0ZA 3H9QA 4D3SA 1VPDA 1ENZA 3G17A 4CLOA 4FB5A 1WXDA 4KZPA 1B15A 4JBHA 4PLVA 4L4XA 3GNTA 4OQZA 1JKIA 4EUEA 4KTVE 4NR0A 2DPHA 1ISHA 3ZDFA 1T4DA 1M67A 2GZ2A 3Q1LA 5FI3A 1ZVMA 3RUDA 4UEKA 4MVJF 3G0OA 3GQVA 2CF5A 1HE4A 2G82A 4B8ZA 1Z73A 4FS3A 5CG1A 3GEMA 6ADHA 3OJ0A 4J9UE 1LUAA 4FJ1A 2D3TA 3PRJA 3QVXA 4CJXA 4MOWA 1TA4A 1LDBA 1E1MA 3SX2A 4ZA2A 1KETA 3JV7A 5EINA 1YOVB 1GR0A 1HSOA 2HKIA 3UCXA 4E2ZA 1BMDA 1X0VA 2CF6A 3O38A 2C82A 4BV9A 5L4LA 1O5IA 3W8DA 4M8SA 3V8BA 5KJ6A 2P2SA 2G1UA 1A4UA 3RBVA 1N1EA 1DFHA 3WQRA 2HMWA 3FNFA 1H0KA 4E32A 4JJIA 4CM4B 5IDWA 2HRZA 5DT9A 2WTBA 3VTZA 2I6TA 1GQ2A 1H6BA 2QZ9A 4DWVA 3R0IA 3ORFA 3NJ8A 3VZSA 5KVVA 3I9KA 1H5QA 2AA3A 1QYXA 4N18A 1BHSA 1DXYA 3IUSA 4OOFA 1GTMA 1EDOA 1F8FA 1ZJYA 2DU8A 3H7AA 1NHWA 3PYLA 3QVSA 4CQMD 4BO7A 4RGBA 4HADA 1DRVA 3QVTA 3E5MA 3VTFA 1EMDA 1PS8A 1ZUD1 4I9HA 3BMNB 4BNLA 4BIIA 3BMCA 3ZWPA 1BRMA 4CPDA 2GNAA 2YQ4A 3U4HA 1HETA 3RVDA 4HXYA 1ADGA 1MX3A 2PD4A 1QKIA 2Q2WA 4HNGA 4PLTA 1P1FA 2PR2A 2AEJA 2ZB8A 2EP5A 4RVHA 2HLPA 4XKJA 3ZWVA 3FR7A 4ZQFA 4UUPA 1NASA 4FW8A 3DONA 3PTZA 4OMUA 4P8RA 3FNGA 4WLFA 5EQFA 5JNLA 3L6OO 3C7CB 1F14A 4LCJA 3WTBA 5H81A 3K2BA 4GGOA 3DMTA 3PWKA 2C2XA 3F6YA 3KLMX 5I8ZA 1DEHA 5DCYA 2W98A 3E9NA 4FC6A 4X54A 3ANMA 3CE6A 5AXBA 3HHPA 4JJFA 2X9VA 2PH3A 3ZU4A 3PVZA 2PTGA 5JY6A 1I32A 3WGZA 5KJ1A 3JD0A 4GKBA 4GBJA 3VVBA 1ONNA 3MJVA 4XB1A 1GUFA 3ZWBA 2P9CA 1K6JA 4J43A 1T24A 1R66A 4HKTA 4UVDA 3N58A 2POQX 3ROMA 4CM7A 4JGBA 2NVUB 4FJ2A 3VPXA 1Y81A 2DTDA 2I3GA 4AJNA 3EUWA 2EG9A 3JYOA 3L4SO 1KEWA 3GVCA 4LMRA 4BNHA 1ZEJA 1E7YA 4E5KA 5GY7A 4CLEA 2PH5A 1ZMOA 1EK6A 4QXMA 2C5AA 4JBIA 3DZBA 4ZD6A 5CEFA 3IIEA 5ILGA 3WB9A 1QR6A 5CEEA 2C7GA 4IINA 1YOVA 4PFJA 3JCZA 3ZGYA 4A5OA 4CUJA 3AI3A 4XR9A 3KETA 4YQZA 1LU9A 2QHXA 3EK2A 4J1TA 4YXFA 3QP9A 4DL9A 2VHXA 4BOYA 2UUOA 5B4TA 3VZPA 2W90A 4MVJP 5EJ2A 3DR3A 1O9BA 1VL0A 3ANNA 5HS6A 3S2FA 1Z7BA 3PJEA 2AE1A 5A03A 4E33A 2RH4A 2W2KA 5KKAA 1VRWA 4J1NA 4N54A 3TL2A 3BMOA 4R3NA 3PHGA 3GZ4A 4QO8A 1E7MA 1ZK0A 5TX7A 1Y9EA 3I4CA 1V9LA 4WCFA 5JPIA 5B4VA 1T1SA 2GN8A 5JS6A 2A9FA 4FFMA 3RUEA 1SPXA 3PJFA 3T4EA 1DAPA 1WLYA 4WCFC 4ZHSA 3S8MA 3RD5A 4PRLA 2VHZA 3HZZA 2X8LA 3HB4X 2YJZA 3AU8A 3HSKA 2WE8A 4M87A 5LCXA 3GHHA 1P9LA 2NACA 3FBTA 1D7OA 1QYWA 2QIOA 3Q2IA 1ADBA 1NP3A 5CDSA 1ML3A 1A7AA 5TJ9A 2AQIA 2JAPA 4E5YA 3WYCA 2EGGA 3IJRA 4EEXA 3I23A 4DYVA 4KDEA 1XGKA 4U6QA 2GASA 4CM1A 3PYMA 5BSEA 4GX1A 3E5RA 1JWBB 3NTRA 4WCDA 2GDZA 4HV4A 2B36A 2RCYA 1EVZA 3PEFA 4JBGA 3C1AA 3NDJA 4YAEA 1HYEA 2RAFA 4II2A 1Q7CA 3LT4A 1E3WB 1LNQA 3GOHA 2X58A 3E6AA 4FIZA 3PYXA 5ADHA 2OGUA 4DIBA 3RBZA 1YO6A 4RPGA 2GZ1A 4G81A 3KV3O 3RFTA 1GU7A 1VJ0A 1KS9A 1BSVA 1DC4A 1GZ6A 1ZIDA 3HFSA 4QX6A 1Y1PA 3IKTA 4ALNA 3V1UA 5KCZA 2B5WA 1U5CA 2HMTA 5JCJD 2O50A 3F9IA 5JMWA 1AXGA 4XYMA 5JC8A 4PLFA 2GN6A 5ES3A 1GADO 4IS3A 1XELA 4J9VA 5I7SA 5L95A 1ULSA 3AUSA 4BNXA 1N2SA 3EVNA 3X2EA 1E92A 2HAEA 2NQTA 4HX5A 2IRWA 1NYTA 2TMDA 4AJPA 3RFXA 3DMTC 4M54A 4OL9A 3NV9A 5L45A 3JQ8A 3D0OA 4XWYA 4BO3A 1VL8A 4LW8A 3S2GA 3BMOB 2I9PA 4WNCA 3FWNA 3QA9A 4QSMA 3ASVA 1B26A 4HFRA 4IDDA 1M2WA 3Q3CA 4ZRMA 1FDTA 4IDBA 1ZH8A 2HO5A 3JQ6A 3KYCA 2GR9A 2CMDA 1DOHA 1GUZA 4BB6A 2O4UX 2JFGA 5GZ3A 3BTSA 3DBVO 3HJAA 5BR7A 1MA0A 4E2YA 4OKNA 4OXKA 1ZW1A 3PLNA 1KVQA 1KY5A 1O95A 5COBA 4WLVA 2HU2A 4LSWA 1U8FO 1E1NA 4OSPA 1R4NA 4Z9FA 4XB2A 3EC7A 1I24A 3VHRA 1LBEA 1HDXA 3AFNA 3K8ZA 2QRJA 5JSFA 3F3SA 5KOIA 4TVOA 2YFHA 4W7IA 4I9UA 4WCFB 1ZXLA 1PWXA 5CDYA 3GVHA 4L74A 1AXEA 1CDOA 1XQ1A 2PZKA 4PN3A 5TS3A 1LRKA 3KEOA 3WQSB 4XJTA 3ZU2A 2AHRA 3HWRA 1MXFA 3IMFA 5BSFA 1CEQA 1U7TA 4CLRB 4ZQEA 1IZ9A 4KUGA 5A3JA 1PJ3A 2WE7A 2GN4A 4YT8A 2AW5A 4BO2A 4IDAA 3PIDA 4YCAA 4FGSA 1YL6A 2EV9A 3ROKA 2O4CA 2Y1EA 4RVFA 2IZ0A 1FXSA 2HJSA 2X9GA 1GQYA 3KRTA 4XYBA 2GERA 1LSJA 3AUUA 1Q1NA 5EERA 3H9UA 4EJMA 4PLWA 4D7AA 3R3SA 5TT1A 3PP8A 3ZWAA 4NQZA 3H5RA 1PJTA 4PG6A 5K9ZA 5G4KB 2X5JO 4UVEA 2GLXA 2EJWA 3WX0A 4R1NA 3I9OA 3FNEA 3JQGA 3LT0A 4GGPA 2YQ5A 3IP3A 4RLSA 1PZEA 2J3JA 2PKQO 3ETEA 3W4JA 4MVJG 4H16A 5BNTA 2R6JA 1NVTA 1MFPA 2Y0DA 3NT5A 3U4CA 2Z95A 5U9CA 4FC7A 4LMPA 9LDBA 1C3VA 2B4RO 3MTJA 5JBIA 3RJ5A 4N5LA 1I3NA 3BZUA 3IL2A 3KSDO 3L4BA 2W8ZA 4PGFA 3L9XA 4MO2A 5JAMA 3WXBA 1QMGA 1PGOA 2GSDA 1KY4A 2VCYA 4TZTA 4D42A 2OZPA 3NRCA 1LLUA 2C54A 2ZJ1A 1FJHA 1ENPA 2HQ1A 2YDXA 4U7WA 1SOVA 4ZRNA 5B4UA 2DAPA 4PVDA 3H3FA 1LTHR 2B4QA 2JFFA 4EBFA 2F1KA 2Y0CA 2GO1A 3P2YA 1RM4A 4PZCA 3L4BC 3DO5A 4QO7A 3AOEA 3K92A 4J6FA 2VRCA 1I0ZA 1R15A 1R37A 2GYYA 4A73A 1DIHA 3V1TC 2Q4BA 3RSHA 5C7OO 3VOSA 3DAGA 4FCCA 1JAXA 4BL5A 4CMIB 5ITVA 2NLOA 4J1SA 1IPEA 1LJ8A 4RF4A 5C3MA 2YDYA 2VNAA 2Y93A 1RM0A 2P68A 1SOWA 4JNKA 1UXJA 1JAYA 2Y66A 2O7QA 1F12A 3Q9UA 4Q9NA 1V3UA 1C0PA 2EKLA 5DZSA 1JVBA 4NG5A 1NQAO 3ITDA 3INRA 3IQDB 4B4VA 3ZHZA 2P9EA 3I6QA 4ND2A 4J2HA 1E3SA 4LRSB 4CV3A 4CQLA 4EW6A 2VN8A 3T7EA 1WNTA 4TRNA 4GPD1 3OIGA 2X22A 1DPGA 1F8GA 4ONEA 4DYDA 2BGLA 4FFPA 2WM3A 1E6WA 1I33A 3ZNOA 2IZ1A 4CMJA 4GLOA 4R5MA 3RKRA 3WQQA 1PGNA 4G65A 2C5EA 3RUAA 3V1YA 5T8KA 4ROSA 1LSUA 1G6KA 4XA8A 1D3AA 4AJ2A 3JD3A 1X7GA 3E1KA 1KERA 3P7MA 1A5ZA 3TOXA 4BGVA 1Y8QA 3K73O 4UUOA 1VM6A 1IE3A 1PS0A 3IOYA 3KVOA 4UVIA 1SZJG 1ZO8A 4CMIA 4NU5A 5LC1A 1BXGB 4ALIA 4HWKA 4E2WA 2Q3EA 4U8GA 1HDZA 4IJUA 2FWMX 4RPJA 1Y8QB 1E3JA 3K6JA 4XRRA 4LISA 3S2IA 1UP7A 1RM5A 4WK6A 4D79A 5JW6A 3UXYA 3I3OA 4M89A 3B1FA 3CINA 3TOZA 2FN7A 4R41A 4XZ3A 4MKRA 1HEUA 1VSVA 3H9EO 2PNFA 1PL6A 2PZMA 3I1JA 4WEQA 1Y5RA 4FOSA 5T8KC 4CM5A 4CMGA 5L7YA 2IYPA 3ZWNA 2Y68A 1X7HA 4Z9YA 1C1XB 2BI7A 3TDKA 2D1YA 1ZK2A 2R2GA 4J0EA 4D45A 2UYYA 2V65A 1MP0A 3TZHA 5ER6A 1MUUA 1WDLA 2AQ8A 4CQMA 2QG4A 4I1IA 4BO4A 4XR4A 2DT5A 3ZWYA 1FMCA 3O4RA 3PGXA 1X0XA 4BNIA 2VT3A 4NZ9A 2JHGA 3GVXA 5JO9A 4YT2A 1ID1A 3MJCA 2J5KA 3P5SA 1OOEA 1PS9A 4YRBA 4D0SA 2EW2A 4KUEA 4DREA 2B4TO 2O48X 4JN6B 4L9RA 3A1NA 2Q2QA 5GZ6A 3GGGA 3LYLA 4Z0PA 1DBVO 4R69A 4PG4A 4YJFA 4U6SA 2DTEA 4B7XA 3HDJA 3T4XA 4CM3A 5L40A 4J0FA 1A9YA 1KEPA 2UDPA 1LEHA 1V6AA 3JQAB 4JX8A 3W4IA 3B1JA 4MKZA 3KO8A 4BB5A 5IF3A 4WGGA 1VJTA 3F1LA 2VZ9A 5TIIA 1NBOA 3KM0A 3LSYA 3AOEC 5F3RA 1SC6A 4AJOA 3K2EA 3FR8A 3VVCA 4YAGA 1JQBA 4TWRA 4MPDA 1E5QA 3SBOA 4J90A 1NHGA 3KSZO 1M6WA 2CDBA 4MP8A 4S1VA 4RVUA 5TSDA 1WZIA 1P1KA 2AEMA 2DBZA 2NSDA 1ISMA 3GGOA 2YHUA 3R1IA 3BHIA 2WWRA 3DBHB 4U0JA 3TZ6A 2HRBA 1OAAA 4ZGWA 5HM8A 4I9NA 4WLNA 3M2PA 4GX2A 4XYLA 5IDXA 1G1AA 4Q3DA 5DDIP 1GQQA 3WGQA 4BKUA 2XXBA 1FF9A 1HE5A 2OP1A 2NQ8A 3U4IA 5C7IO 5G0VA 3WBFA 3NUGA 4RJTA 4GLLA 4B4UA 4OGWA 3ZV4A 1PJ2A 3BTVA 1Y5MA 1HDRA 2Y1GA 5JDIC 5KVSA 4DC1A 1KVTA 3HADA 4GMFA 4JJGA 3HFGA 4I5GA 2BD0A 3LC2O 3GUYA 1HDCA 5FEUA 1J0XO 4Z6KA 3NJ4A 2HSDA 3UW3A 4K26A 5H82A 1OC4A 3A4VA 4IQGA 4IZHA 3RUFA 4YRDA 1U8XX 4KQXA 3ADPA 3PQEA 1PJLA 1CIVA 2DTXA 5AQ1A 4R9RA 3G79A 2BKAA 5COAA 1YBAA 1ORRA 1GY8A 4B3IA 1TT7A 3DTTA 4YTEA 1E0DA 1DIAA 1PWZA 4Q3CA 1UP4A 3HB5X 4M49A 3DOJA 1H9AA 3ENNA 4IQ8A 4ALMA 3RFVA 4AJLA 1IUKA 2YHIA 3CTMA 4BNZA 4E2XA 1U28A 3WOHA 3OFSA 3GN1A 2P5UA 2E82A 4ZJUA 3COSA 2E49A 3GC6A 3RBXA 3DB2A 1R6DA 4BO0A 1P45A 1T2CA 3RUIA 1F0YA 3ENKA 4UUNA 2EERA 3S55A 3I5MA 4KDFA 4RORA 3VH4A 3W8FA 1WDMA 1YQDA 1DO8A 1SNYA 2OOSA 4B7CA 1R4NB 1YBVA 1YDWA 3KHUA 1E6EA 3WWZA 1WVGA 2BF7A 3SC4A 3AI1A 1EBUA 2IXAA 3NYWA 1ISIA 4PLCA 4XIJA 2A4KA 5G0SA 4Q3EA 3GFGA 4FFNA 2J6IA 5GZ1A 4BNKA 3GUCA 4D46A 4PG8A 4YT5A 1ZK1A 5DCWA 2F00A 2HMSA 2FR0A 5L9AA 2AG5A 2H6EA 3DZJA 3VZQA 4NJMA 4CMBA 2IYOA 1GUYA 4WKGA 4XGKA 4BNFA 1PGPA 3EY4A 4XJSA 4AICA 4CUZA 1LSSA 1Q0QA 2E37A 3IKVA 9LDTA 3Q0EA 2DFVA 3PZBA 2WEKA 3NTOA 3FHLA 1IY8A 1Z82A 2NVUA 4WLEA 4GVXA 5T67A 1Z74A 3RIHA 3ZZNA 1CWUA 4Y9DA 4CM4A 3GEDA 4IJWA 1TLTA 2HMVA 3I83A 1B16A 4WOKA 3KYBA 2EP7A 3K31A 3WLEA 4CM8A 1NR7A 1P1JA 4NK5A 4OXYA 4CR8A 3D5TA 3CUKA 1YDEA 5JE8A 1VLLA 1AHHA 1JKJA 2OBYA 4HFMA 4EYEA 4E5NA 2VWGA 1XA0A 1NX6A 2EEZA 3OIDA 4FFLA 1B8VA 4R51A 1B3BA 4L0QA 4JQCA 1NFQA 2G76A 4LVUA 4CLOB 1ZBQA 1JTVA 3DTYA 4WECA 5F21A 3VPFA 1A9ZA 3GG2A 1RM3A 1UZNA 3E9MA 3K5PA 3RCBA 1O8CA 3ZCXA 3JQCA 4BGEA 1EE9A 3TN7A 2YYYA 3JYNA 4Y98A 5KWEA 1WPQA 1QYDA 3GMDA 2GF2A 5A06A 1DRWA 1RYEA 2D2IA 5C37A 3O03A 3OIFA 4C4OA 5J23A 3L77A 3PHIA 4WJZA 5F5LA 3ZV6A 1LDGA 2JCYA 1YRLA 3LF1A 5F1OA 5KIAA 2C7VA 1PL8A 5IN5A 5JY1A 1YONA 4WUVA 4F45A 1WW8A 4WPGA 1OMOA 4RZHA 1JDJA 5JFOA 4FD3A 1T26A 1TEHA 4J7CA 4CMHA 3QWHA 3E8XA 4DLLA 4XX0A 2OFPA 3BIOA 4Z3DA 1RJWA 2EGHA 5I9LA 1OC2A 3DQPA 2BGMA 2O3TA 3F47A 2YW9A 4RQUA 3EYWA 3M1LA 4A0SA 1SCUA 1HRDA 1K0UA 2O3UA 2VTEA 3UICA 1V35A 2X5OA 2BFAA 2OMEA 4JLWA 1Z45A 4NH4A 4YWJA 4YQYA 3WBBA 4BNVA 4ND3A 3ONFA 2YHIB 1UDCA 4MKXA 3A06A 3FRJA 4WASA 4DBZA 4F6LA 4I8XA 5THKA 4FR5A 1NQTA 4BKPA 1LDEA 1R4MA 2OHXA 1GCOA 1ULUA 5TJHA 2BFPA 1YB4A 1I3KA 2B83A 2HK9A 3LC7O 4J4HA 3UCEA 1V3VA 1E1KA 4W4TA 3SXPA 5DP2A 1R0KA 3D4PA 3DC2A 4CUKA 3GEGA 3PHLA 1XCBA 1XLTA 4OH1A 4Y6PA 4KP7A 3UH1A 1M66A 1BW9A 4OHUA 4BGIA 4IGEA 3W6ZA 1GZ4A 2XPCA 2WD8A 1HZZA 5EN4A 3BYZA 1JLLA 2AEFA 2HJRA 4G5HA 3U0BA 3ZNPA 1QP8A 3ZWCA 3HDHA 5HRUA 2DQ4A 3S1LA 3RU7A 3AM3A 3IAHA 1QV6A 3BMNA 3D3EA 3ROPA 5AXDA 1BW9B 5ENVA 1ZSNA 2EKPA 3FI9A 3WJ7A 5C5IA 1N1GA 3I9NA 4RF3A 3WSWA 4AFNA 4N7RA 3C24A 1PQWA 4DPKA 1ADFA 4ALLA 4W82A 3A14A 1OZAA 3PQDA 1IHXA 1I10A 4XQEA 1ZXBA 4R1UA 3RROA 4DQXA 3LC1O 4OIMA 3WS7A 4CM9D 2J5RA 2NUAA 3VH3A 3WLFA 4P22A 4OSOA 4Y6RA 1BGVA 3EHEA 5I7VA 3JTMA 4DPLA 4BNYA 3LF2A 1CF2O 3M1AA 3KOUA 1BVUA 2ZTLA 1E7WA 5DOVA 4KUHA 3CEAA 4ALKA 1GCUA 3JQ9C 4IGFA 5I7FA 1PL7A 2C59A 2CDCA 3GVIA 1LC3A 5ICMA 2AE2A 4NBWA 1J6UA 3GMSA 2OXIA 3RUCA 4NFSA 1X15A 4R68A 5KVCA 3PDJA 1DJQA 1JVSA 1EBFA 1ZSVA 2FMUA 4CQMB 3AJRA 2ZCVA 2P9GA 3IS3A 1EK5A 3O8QA 1GEGA 4FN4A 2BGKA 3VDRA 1PGJA 1T2DA 4EEZA 5AXAA 2RIRA 3RC7A 3TSCA 1I01A 2P4HX 4PLPA 3DMYA 4BO6A 3EAGA 4EJ6A 1EZ4A 3QWIA 4K9DA 5JDCA 5DBFA 1U3UA 3GRKA 1P44A 2PY6A 3MTGA 1UR5A 4RDHA 2BELA 4TSKA 3VDQA 5ILOA 3QLJA 3KTDA 4LGVA 3H65A 1U4SA 1AN9A 3OETA 4YJGA 4IZIA 4Z9XA 3NX4A 3PIIA 4TRRA 2P4QA 5CPFA 1UXKA 3H4VA 3HDQA 2FPGA 3QRWA 1BXGA 3NGLA 1U1IA 2CVOA 1ISFA 1DAOA 2DLDA 4NFYA 3OQ1A 4R1SA 3GN2A 4MVJE 2B35A 2EF1A 2OP0A 4MP6A 1PJQA 2VTDA 4ZICA 2ET6A 3GK3A 3WGHA 2PGLA 3DHEA 3PDUA 4IDEA 3OJFA 1YQXA 5CHEA 4DPMA 1P0FA 2PD3A 2VNSA 2FRDA 2ZTUA 5DOZA 4NBVA 1Q0HA 4GL4A 3D1LA 2OUIA 3U5TA 1O6ZA 1ZFNA 1K2WA 1ONOA 4L76A 3H9GA 3LLVA 4J91A 4CLHA 2QZZA 1YL7A 3JQFA 3UCFA 4DQUA 1XR3A 3PQFA 2VYNA 5U4QA 3IP1A 4D44A 4RCVA 2NADA 3WFIA 2HK8A 5B12A 4XD2A 1E7SA 3KUXA 5K6AA 1WAMA 4E5MA 5IDYA 4BNGA 3PFWO 1HWYA 4JK3A 4CMCA 2R00C 5G4LA 4EJ0A 2A92A 1NAIA 1WMAA 3F1KA 1CYDA 1P3DA 4EGFA 3WGYA 2ILTA 1BVRA 1FDWA 2WD7B 4GX5A 1K5HA 4ZN6A 1PZFA 3GHYA 2HUNA 3VKUA 3L6EA 2XAAA 4YPOA 3I6IA 4KWHA 1R0LA 4TKMA 3RASA 1IULA 5JAIA 4MP3A 3TFOA 2ZCUA 5H83A 4PLZA 1D8AA 2PGJA 3FTPA 1M76A 3BXXA 5ER9A 5IZCC 4CR7A 5KJCA 4L8VA 3WR5A 3FNHA 1KOLA 3GDFA 4TVBA 1ISGA 1P1RA 1TT5A 1YJ8A 2VYND 1HF3A 1A71A 2YV2A 3OA2A 3I9MA 1U3TA 2VZ0A 5CP8A 4RPKA 5KJEA 5BSHA 2YV3A 4DUPA 3PJDA 1D1TA 1LA2A 4UVHA 1ZEMA 2DM6A 1B0AA 1E3EA 2C0CA 1J4AA 1TB4A 2QQ5A 3HE3A 1VSUA 3VAZA 3GF4A 2Y1OA 2Y0EA 3O9ZA 1QLHA 2NV6A 4XCVA 3MOIA 2X1HA 2UAGA 3DFUA 1G0NA 1VKOA 1K6XA 1E1LA 2C29D 3IJPA 1YXMA 3DBLA 5B1YA 2NVBA 3QIVA 4LVCA 3GAFA 4H7PA 3U09A 4ZQGA 4GWKA 1R12A 4MVJI 4GH5A 5DN9A 4YAIA 1EVIA 2QX7A 3GAZA 3DHYA 3U3XA 1V0JA 1MG0A 3CKYA 4O6VA 1I3MA 2Q1TA 4NJMB 1SB8A 2EXXA 1C0IA 3ROQA 3HN2A 1G0OA 5CDTA 4M55A 2NU7A 3B6ZA 1EE2A 2Q1SA 1L7DA 2Q49A 2Q99A 2NTVA 3JYPA 3DZFA 2CUKA 1YWGO 1DJNA 3TPCA 4R4JA 3D4OA 4MVJM 5JO0A 1E7RA 3C7DB 3K9QO 4NNJA 2WMDA 1DIRA 3OA0A 4IS2A 1L1FA 3G3EA 3ZV3A 3WNVA 1S7CA 1B3RA 3ZH2A 5U1PA 1B8PA 1KYQA 4FFOA 1KIFA 1MV8A 4A10A 2B0JA 4LRTB 3VH1A 4R01A 3UAGA 4K28A 3H9JA 3IC5A 4S3MA 4BO8A 4CL8A 4XDYA 4URFA 3DWFA 2OL4A 4A7PA 4JCOA 3ONEA 1DFIA
chains in the Genus database with same CATH superfamily
3C8ZA 1Z5UA 4NU8X 1WCXA 4O5AA 2ZJ6A 4QM6A 5T64A 1NU8A 2Q1UA 4H18A 1UKEA 1Z2EA 3PNMA 2PK3A 3PS9A 5KTKA 2AKYA 4FWTA 3LZ6A 3A9WA 1IZYA 3AJAA 3BGOS 1Z7GA 1EFVB 3LSTA 4X71A 3UGTA 1BDBA 2FR8C 3SS9X 5FNVA 2G8NA 1WW3A 2Q3CA 3W04A 1L4FA 3V6LA 1V7ZA 2OLJA 3P9SA 2P75A 3C3XA 3O31A 5FUXA 2B6NA 3RI3A 3TZCA 3MELA 3UZUA 2CNWD 1RCTE 1OHHD 1RI3A 1E7QA 1P0CA 2GSWA 4QPCA 1IWPB 3GIWA 3RJ9A 5IRCD 3A31A 1GV0A 5M5BA 2FMXA 5KYTA 2HIGA 3BIXA 3HGTA 4HAVA 1EHCA 2PUCA 3NOXA 4JBLA 5ICFA 4JI2B 4TRJA 4TLEA 1FX0B 2OD2A 2QLTA 5EUCA 3WL3A 4CG1A 3JQEA 2Q4OA 4W9NA 1OQAA 5HF9A 2JLAA 1Q21A 1CRWG 3KZNA 1L4LA 1UKVY 2OAP1 3G88A 4Q1DA 2W43A 3EWIA 1HL7A 2BUBA 3K6RA 3M4NA 3K71B 2XGSA 1GYPA 3P2MA 5CW2A 5ICSA 2QJWA 1EK0A 2BSXA 4AJIA 1QX3A 4PINA 4DTIA 1DQNA 1GAWA 3WK4A 1D09A 1VRVA 4EUSA 5K09A 4B44A 4MICA 1ZA2A 1NC1A 2ERXA 2X5KO 3U17A 1M8GA 2BBOA 5DHFA 3OAAD 1TT5B 1HDOA 2NZJA 4ZO8A 4MS4A 2GPSA 4OJNA 2OB2A 1UJ4A 2AVDA 1R4AA 2FN3A 3JQFC 4KE9A 3MB5A 4OFWA 8OHMA 4E03A 3AVPA 1AQUA 1CP3A 4NAVA 4RJJA 3ND6A 4EHHA 1EFRD 1GQFA 3KK0A 3PJGA 4KQMA 5BVGB 2EX4A 3DDSA 1FDUA 3EDMA 3JQ7B 2XGJA 1UJNA 4PCAA 1EWKA 3KHSA 4O2RA 2CVHA 3ANXA 3O7WA 4OA5A 4MVJH 1E3IA 5AVJA 4XPZA 1LV7A 3EUFA 1JDVA 1P1BA 4HH0A 4YDRA 5F12A 1ZK3A 5A4AA 3SYLA 1UQUA 3PDIA 5TPZD 1QU3A 121PA 1QV9A 4B35A 2AIRA 4Z7OB 2W8BB 2DFPA 1NBMA 4OQNA 2C2ZA 4LCEA 4RY9A 3O3NB 1CUXA 4EVIA 3PF8A 4QU8A 1U3DA 3HJUA 1AKRA 1LW7A 1GZHB 2CB9A 2PMCA 5ALIA 3RFFA 3RYIA 3UMGA 4Z9BA 3WYGA 4MA5A 1FMFA 5L51A 3RSOA 4MV0A 2VHWA 5ALGA 2GEVA 3GR6A 3LKVA 2X4GA 1XMPA 1N92A 1VLJA 3PUXA 3Q2KA 4GKVA 3OZ7A 4MQEA 5E6UA 5FJIA 2WY2D 4OHBA 1U3GA 2C3PA 3KKNA 4M6WA 5JATA 3HU5A 1DLJA 4LK2A 1ZJ6A 5GIPE 4DW8A 3NANA 4Q18A 3R9KA 3FUTA 2FPXA 1RQ7A 4UREA 1I80A 1U02A 2B2CA 3KXPA 5MFPA 2EWWA 2WYUA 4XVQA 3GT3A 4H7HA 1COWA 1QGUB 5HKKD 4W5NA 1MOPA 4AG5A 2P2CA 4OJKA 4RHEA 4JLOA 2VHYA 1PSDA 1BCSB 4F4IA 2RBEA 5HX7A 4HAZA 2A94A 3CRZA 5DM60 1V45E 4XUDA 3K15A 3TVYA 2W6JD 4WK4B 3I92A 5DNVA 3EOZA 5L4NA 1LJLA 3GVPA 4AJEA 5JUWA 1AHNA 3HY4A 4W1QA 2J31A 2DFDA 1SQ0A 3FMOB 1UH5A 3LCMA 3PFGA 4TTAA 3HEMA 2PS3A 2FB9A 4P32A 1BTOA 1C3EA 4KWIA 4LJSA 1F4VA 2FRXA 5F9MA 1OX5A 4FVTA 1JG2A 4B71A 1SPBS 5GAJA 2QF7A 2IGBA 1QDLB 2GJAA 2VT2A 4YJ3A 5B36A 4FQ7A 4BV3A 1PV4A 3ZI0A 4URHA 3IR7A 3QF4A 1V8DA 3U3ZA 5IG2A 4E07A 1P73A 3Q9NA 4H0FA 4YYZA 1I7DA 2Q62A 3R23A 1ML4A 3S8YA 4O4LF 2R1UA 3F5SA 2AMLA 2IP1A 3FPFA 4KSYA 2IZZA 4YJ2B 4H4CA 1TI7A 4M86A 1N5LA 4BFCA 3OIYA 3AJ9A 3GLHA 1V8ZA 3IALA 1ZM3A 3H6KA 1Z13A 4Q4AA 5FEMA 3TTTA 4KJZA 2V3WA 4BGUA 5K8VA 1TMOA 2H4FA 5DP1A 4BWGA 4YJDA 1S2OA 2VS1A 1EPUA 3LNCA 1FFAA 3NO4A 5I9MA 2CE2X 1F06A 1H5NA 1RE1A 4EW3A 3ZY3A 1AKQA 1COWD 2EFHB 1Z36A 1L7XA 1YTLA 2ACEA 2ZKIA 2AB0A 5HKKA 1HEIA 4YDHB 5MN6A 5IVHA 4JWKA 3OE1A 4RIEA 5BSHA 2JLSA 3DE1X 3IPCA 3MAAC 1P6QA 5HMMA 2V4UA 5CW1A 1U8YA 4F2WA 3I52A 3FGZA 4ZVSA 1JFVA 2I8AA 3QKIA 3VNRA 1VL2A 5K45A 3CNHA 3P0HA 3RVSA 4BNJA 2CLKB 2FNAA 2DUMA 3PGJA 2OUKA 2B9VA 3B60A 2R0QC 3HUUA 4Q6WA 3BJZA 3EUAA 2AV6A 2OGWA 2VXBA 1AGPA 4B34A 4DCSA 4ZZ0A 5F7XA 1DZ3A 1QDEA 3NHRA 4DDVA 1JA9A 1RHQA 4YUWA 1S5PA 3DDOA 3TWOA 1L4HA 1UXGA 2D8AA 3EZXA 3IURA 1E2BA 1SELA 5KMGB 3ND8A 2ZVPX 3MZ0A 4UFOA 1RJ9A 4F9EA 2M32A 5LQUA 1IVYA 3WGGA 4CV2A 2J9FA 5ALEA 3L82B 4U4AA 1QVWA 2FK8A 1R4MB 2FVXA 1BWQA 1J7JA 2I3ZA 3AXTA 3HCAA 5E3JA 2TYSB 2WDPA 4C0SA 1NUSA 4KIGA 4IDGA 1A4IA 1YFLA 4KR7A 1ZKMA 1VLVA 4D6XA 1S7GA 4FHEA 3T3IA 1OI7A 2GM9A 1QBGA 4B43A 2X0NA 2BV3A 3ZHYA 1ILEA 1U99A 3L7BA 3J81k 1RPJA 1NPDA 2WM2A 5JCXA 4R40A 3TL6A 2YRXA 4YP5A 2H8KA 2G8LA 1CFJA 4D8YA 4NXMB 1MW9X 4U2DA 4K9PA 3EC1A 1RAIA 2B69A 3DR5A 2EQBA 3RK0A 4ZMBA 2ZBEA 3K4HA 3SYRA 3C97A 4XIYA 2EU8A 3A27A 2EGUA 3VQTA 1FUYB 2UXCB 4HYYA 1Z35A 2QYSA 2W6OA 1G6HA 4MYSA 3EGDA 3I6MA 2WJVA 3FYUA 3AUAA 3F5FA 1Z18A 1SH7A 3NDIA 5LQCA 1I6KA 1B93A 4N7MA 1EDBA 1PEDA 1U4OA 5I4CA 2EW8A 1O0BA 3ZYZA 1W8IA 2JGMA 4RE6A 4ZMRA 2FSHA 4DSOA 3V4ZA 1Q19A 1JSLA 3QSGA 4LYAA 4EM6A 3G9ZA 1AQNA 1U2QA 1BX1A 2CJFA 3M5CA 3G13A 3WLMA 5L3SB 3NEPX 2D5AA 2AD1A 1U98A 2PZGA 2ZYAA 5FFNA 4E4TA 1DC5A 1LZLA 2Q27A 3AM4A 3IIJA 4ILKA 1MENA 2R48A 1KPHA 3PT5A 5IANA 4DKJA 1RJ9B 3OEWA 4QHSA 1PU2A 3RHFA 2PPVA 1UXHA 2VBCA 4ZOAA 2CNWA 3FRHA 2BZGA 3WP1B 2KQUA 3EQ6A 4RLFA 3Q5EA 5IJZA 4QXRA 4RAOA 4QEDA 2ERCA 3N3BC 4I9FA 4Q9LA 1Q17A 1HZJA 1NE7A 3ZGXA 5DXJA 5H9WA 2F8SA 2J9RA 2DX7A 2DWQA 2ERYA 2GA8A 4PLYA 2QSZA 1PUXA 4N0PA 1IY9A 1JEOA 3G5MA 2FY8A 3RC1A 4DSNA 4EA8A 2LXNA 3OJCA 2BMJA 1A9QA 3JAWA 4CM8B 1WX1A 3ADCA 2QG6A 1X7YA 5HK9A 2DPLA 3ABSB 2GPTA 1L5FA 3H1TA 3IR6A 4HFNA 4RHUA 3UHFA 4AL4A 1KO5A 3CYFA 1UBNA 2GCGA 2FH5B 4HXGA 4RGQA 1GIAA 1RCUA 3CZMA 2PG3A 3I04A 3KS9A 2QVCA 4YP6A 3ZH9B 5BUSA 1U1DA 5IYZB 4RD1A 1IN6A 4ZREA 2F17A 2BFCA 3JQBC 1TO1E 5FT9A 5BMVA 5FXMA 3RV3A 2VJNA 4OMDA 5LP6C 3HR7A 5FBVB 1R5OA 4B4WA 1BMQA 3SZOA 1CP2A 2XX3A 3GY0A 2DPGA 3DTNA 1W48A 4KVAA 2C2GA 4M1YA 4W6QA 1EP9A 5EESA 3VYRB 1XZCA 4II3A 2ZBFA 2IEGA 2RFLA 3R4VA 3U3DA 4UCXA 1RXEA 4X60A 1W19A 1BFKA 2WHEA 3CX3A 3CV3A 4ZOLA 3C1UA 1HQCA 1EG7A 2AN3A 5JAZA 1MA3A 2W71A 3FNQA 3FZQA 2BM8A 2H9AA 4IUYA 4WGFA 3U39A 3CT6A 4F06A 4F3CA 2WABA 3E9EA 1I3CA 4LF4B 2ZRNA 5K6RA 1RHJA 4KR0A 1YU9A 2C1XA 3E7PA 3VR6H 2ZRFA 3G0HA 2Q3DA 3ZXUB 3FZEA 4KBFA 2WD7A 1Y1LA 5EZQA 3QBTA 4LWQA 1E8MA 5CPBA 2GZSA 1WUKS 1IG0A 1YRWA 2Q1YA 4KDRA 2P3LA 5H0IA 4Y9UA 2BEJA 2H4XA 3GZNB 3QVKA 2GF9A 3T3PB 3AR2A 1EUYA 4GIBA 2BHNA 1N2BA 1MH1A 1P61B 2B8JA 2NQ2C 4FE3A 4JVSB 5B37A 3VR1A 1JZQA 2Q6LA 4J75A 4U7DA 3VPSA 4IFEA 1IIRA 3N2GA 4PSVA 4CHGA 4WCVA 2WBLC 2XY4A 4TL7A 1O7JA 2I8LA 1BCSA 4Q4DA 1YULA 4FCVA 1H3NA 3RVBA 3FDZA 3ICWA 621PA 3NAQA 2IPOA 5SY9A 1PWEA 4JELA 5EPOA 3MCZA 3DC7A 3DZIA 1LRLA 4FSHA 4P4SA 3DLAA 2X2FA 5FAKA 1I2ZA 1SHTX 1AURA 1RWMA 3W8RA 1HPLA 1Z63A 4IZOA 3FZGA 3GLKA 2H5IA 4C6RA 5J43A 2R96A 3E18A 4FFBB 5JC1A 1F9AA 4BVFA 1DKMA 3FY4A 1BQ3A 2C5GA 5J5CA 3RQSA 2I7DA 1XQYA 2ZREA 4GR4A 2PA0A 4LVNA 2DBQA 1L3CA 1LI4A 2R85A 4DV2B 4YFVA 1UT6A 4LKOA 5KDOA 1ZK4A 3RK4A 3ODGA 5C4IA 3GT4A 1EX9A 2J0UB 3ELUA 3RC2A 4DWWA 2PUJA 2QAGB 4I8IA 2R65A 4PR3A 3QKSB 3DQZA 3KEGA 1P2BA 2J30A 3GJRA 1USVA 4K9SA 1QKJA 4WZ6A 3U3RA 5K8CA 4M1SA 4DJEC 1L5WA 4JITA 2WHPB 3ONVA 5LYJA 5HA5A 1H2ZA 4R0MA 3A9TA 3ZGZA 2CVPA 3BN3A 3WRYC 1AB6A 5I9NA 3C5EA 1I6MA 3CE9A 1KDPA 2JLQA 3E53A 5ARCA 5T5QA 3V1NA 3FBGA 1Q77A 4FKMA 1XTJA 3TBKA 5JNTA 5BWMA 1KVUA 3FJYA 2BZ1A 5AVYA 1MFZA 1X7XB 1F1JA 1UMDA 3PSAA 1L8XA 2IEBA 2E4YA 3FN4A 1J8DA 2GXSA 4C7BA 3TUJC 4IHQA 2XUDA 1NRIA 1A8UA 2QTCA 3ROGA 4UKDA 1E89A 1W5AA 3ADDA 4BKRA 1CQZA 1FVFA 1XXHE 3P4YA 4FFRA 2HLHA 2OO3A 3JATA 3NIFB 3Q3IA 3QPVA 1V6SA 4COOA 1ZJJA 3KB8A 1P62B 1T36B 1GAEO 1TCUA 2HQBA 3CFYA 3QW4B 4J6EA 4L4SA 4ND6A 2SNIE 4K7JA 5A6SA 2Q45A 1HYHA 1X2EA 4QA9A 3THWA 3R3XA 4TL6A 1WL8A 4KIUA 2J1LA 1TZMA 1DP4A 2WAYA 2MIIA 1XP8A 3D64A 3CX7A 2PMWB 1FFHA 3DKKA 3OEED 4N9QA 2CXHA 3BD6A 3OPYB 2F48A 4RLHA 5FWXB 1J23A 2HT6A 1F5NA 4E7OA 2QGFA 5IJXA 5ADUS 4MEAA 3QQPA 1NWCA 4L0MA 4CQJA 3U4GA 4DEYA 3J7AC 2IUFA 1R0SA 1JTEA 1NQ5A 1Q1EA 5AJTA 3ZK8A 2X7HA 5AVTA 2HBRA 4IPTA 4BP8A 2CY0A 3MCUA 4RO0A 4JT4A 3GEIA 1BCRA 2FWJA 4B40A 1L5RA 4RKWA 3C4VA 5BNIA 2GB4A 4W1RA 3K72B 4B3HA 4A15A 1ORWA 2VVTA 3RWBA 2OWEA 3ZBPA 3U44B 1THGA 2IJGX 2LP4Y 3ISTA 5DX1A 1WCIB 4AQ7A 1ANKA 3GRPA 3ZGVA 2Y4NA 3TJRA 4ER0A 1QHNA 2DVMA 1VPLA 4IDHA 2Q2OA 1R6TA 3AV0B 4AYXA 4CMEC 4IO0A 1YF3A 4HDRA 1DV1A 3E05A 3LLMA 4M7PA 4MQMA 1UOPA 2J0VA 2NXJA 4BHTA 1V1JA 3CEMA 3C1TA 3LOPA 2ZWIA 2ZKLA 3DBRA 3MWEB 4GR5A 4TMWA 4Q21A 5G2OA 5MN5A 4PNEA 3KSUA 4DR3B 1JKXA 3U9LA 2HI0A 4D9JA 3T5GA 1Y3HA 2JD2A 4OQMA 3N53A 4TN5A 4HG2A 1M1NA 1M73E 4I5IA 4NPHA 2AZTA 4W9NC 4D4HA 3IEMA 1VXOA 4RESA 2EX1A 3ONDA 1TK3A 3UAYA 4O4HF 2V1XA 3AV3A 4UULA 4BNUA 1WXHA 1Z07A 4C7KA 5JNWA 1FTNA 4ZVMA 3OP4A 1FDIA 1CZUA 2IYEA 3DYBA 4HGYA 4JROA 3U31A 2GXAA 2BHTA 1DAKA 1GPAA 2WB4A 1E3DA 4DXDA 4HAUA 3TAXA 1KK1A 4A91A 3DP7A 5KNDD 1N9KA 2IYLD 4BPBA 3EFEA 4CL3A 5TNXA 3BXGA 2QVGA 1N75A 2AJTA 1WIWA 1DKOA 4HL6A 3UENA 3IP6A 1NR1A 1JF8A 2D0OB 1SUEA 3NJRA 1EJBA 1EGMB 4KCGA 1PV2A 1SAYA 4U02A 4OOEA 1YRAA 3PWSA 1SZCA 4K9OA 3S68A 4L4RA 4RQBA 1TZKA 4OO3A 5BWCA 1BS9A 4CKCB 4N76A 4V0ME 3S2SA 5D01A 2GD1O 1Z12A 3AQ4A 3NVDA 1GGMA 3BJIC 1CB0A 1OAOC 2QMYA 3COZA 3FW1A 2QR2A 4ANFA 2VTBA 3WWEA 1ODKA 5TGDA 3VPHA 3EOAI 3K20A 3R6TA 4JB0A 4NBUA 4N9WA 1T2EA 1W47A 4XB6B 1P4RA 2H06A 2JLZA 1NE2A 1G16A 5EOVA 2HNKA 4ITUA 2QROA 3LQ4A 3LBFA 1HSZA 3KTOA 3D8RA 3MUNA 4AVYA 2D7CA 2FUEA 2P9FA 2HK7A 4YRAA 4TV8F 4FMPA 2PRKA 3MCTA 2OK8A 4MWSA 4EMBA 1T5OA 3QY0A 1V37A 3L7MA 1FMLA 3ZDYB 3CB2A 4KH1A 3RSFA 2YWGA 3LK7A 1CQPA 5BWBA 2P7IA 4A36A 1LV8A 2WWHA 4FEYA 1U2GA 3H05A 1G21A 2NU8A 5ALVA 3FOFC 4TYWA 2X0JA 3CZRA 4MVJA 4HTFA 4I4TA 2BM0A 2XUKA 3SBEA 1T3TA 3OX2A 3UFXA 4EG4A 3GL9A 1QC5B 4HGQA 4NJOA 3X2FA 1W73A 4JLPA 2ZRDA 4IXNA 1MNAA 2ZRHA 4V38A 5LDDC 4MUJA 1ZOIA 2EJTA 2IHZA 3PZRA 4NECA 4V3BA 2WF8A 3F9RA 3VH2A 2X6TA 5JSZB 3JASA 1X74A 3BB4A 2VPXA 3DZKA 3QFHA 3QY9A 1G4HA 1K3FA 3LNTA 2XTJA 4IY1A 4UUMA 5EHNA 3WFJA 1EP2B 4BMOB 2EF0A 5AVQA 5FBRB 3THXB 1L4NA 3QEBZ 1NQXA 2ZI6A 1C14A 4DJ5X 1Z6QA 1MB4A 2D0DA 4RQTA 1RPAA 3PRHA 1D2MA 1GPDG 1PP4A 1Q7EA 4EDHA 2J5QA 3GLUA 1YA8A 1MO4A 4RV5A 5DW3A 2YINC 3E70C 5JEEA 4YMWA 3CQ9A 5BSGA 1PT7A 4KFUA 4HBGA 1ARZA 2PPLA 3IOEA 1YQ9A 1P0PA 2WKWA 1J56A 4CG2A 5ALOA 3L1HA 4NCBA 1RRKA 3H1FA 3G1UA 3OFJA 2XKAA 4MLZA 16PKA 2IU4A 4Q7KA 4P33A 2XOXA 4LXUA 2QGNA 3SJ7A 1QYVA 3TOSA 1TD1A 4GSYA 4BMSA 2CDRA 3EMBA 3TL3A 2GS9A 1BRTA 1XMIA 3AYXB 1DKRA 1GSOA 4HATA 1O89A 1N8TA 3IAFA 4R6WA 4WOPA 5C1PA 1T4MA 1OX6A 1JBEA 4LOIA 3V7WA 1HFKA 2RH9B 2X23A 1VMAA 3BDIA 4H7KA 1HK7A 1X1BA 1F8YA 1GSHA 3Q6IA 2RHRA 4PVCA 4ZVVA 2ECFA 3RSCA 5BR8B 3SVTA 3AY6A 3GZJA 3M7IA 1R64A 4CT5A 1JEYA 3DM9B 4G97A 1CPYA 2ZYGA 3GLTA 3R6DA 1MO2A 3W1WA 2ZJ3A 1SXJB 1LCIA 3LYHA 4WEOA 4Z9AA 2IPLA 4Q3AA 5KVQA 5LOVB 2XTNA 4D2IA 4LYYA 3UJ3X 1PEAA 1US8A 1Z6GA 3G2MA 3R0JA 1NVFA 3SR3A 2PU7A 2AXEA 4AZTA 1GL9B 3E23A 4WNIA 1N3IA 1H23A 1XDSA 1X1TA 4YR7A 5JYEA 4TQUS 2DUUA 1INLA 1QFSA 2UZAA 1THMA 3DYVA 4D92A 521PA 4QTZA 4HDQB 4P3OA 1ZCJA 4FMDF 4H15A 2QWXA 4C43A 3A1DA 4C05A 4E3ZA 4BFLA 3E1SA 3HC7A 2WIJA 3NRJA 1X39A 2WWVD 4Z4GA 4YV0A 1K0FA 4PM4A 2Q4RA 1A04A 1YKSA 4EUNA 1OFGA 2EOAA 4FGWA 4Z4CA 1P17A 2EG5A 3R5TA 4XW2A 3UMVA 4JYMA 1RHKA 2NO4A 1EQAA 1PWYE 1W6RA 4AQDA 2TMYA 1T9KA 3TM5A 3U1TA 4A2CA 1TTQB 1V9CA 4LOAA 5L7TA 3UKOA 5DF1A 2VOEA 3BQMB 4ZO7A 1MAUA 4KLZA 3K0CA 1I2BA 4GEGA 5IC4A 3JQGB 3PEWA 1Y6GA 1TZJA 1WUIS 2PAFA 2ZS9A 4E30A 1K92A 1JLHA 5J2TF 4ACAA 3QXXA 1WZ2A 4KMSA 2M6LA 4QXOA 2IOFA 4JODA 3MT9A 3SYTA 1GYRA 4GPIB 5EJIA 4Z0HO 4HR7A 4AZSA 2VZ8A 4RVDA 2BGJA 1LXCA 4S35A 3R0QA 3Q7PA 4BEJA 5KWSA 5LQAA 2D13A 3HUDA 2CL5A 1UAYA 3K5WA 3ZHTA 1T3SA 1Q16A 2XJ4A 3NYIA 3OLCX 3WRWA 4L9AA 4KO2S 4JJ4A 2BHSA 4B7AA 1LS6A 1MU0A 1O4WA 1S02A 1XNJA 4TVSA 2C99A 3PXBA 4NMHA 1SK8A 5BRAA 5IUJC 3RJMA 2BCJQ 3HLKA 4PXAA 1G55A 2I4TA 2OTCA 2WIFA 4DV0B 2X41A 4HRAA 2IV7A 1JG4A 3ZC3A 4NONA 3T3MB 4ZAXA 1OE0A 1HLPA 2PL1A 2YXEA 4BX9A 4HNVA 5J3JA 2PUEA 2IV2X 2CHVA 3VSDA 3BGDA 5AFSA 1EXWA 1V39A 3LCUA 4HVCA 4N0MA 3LDUA 2W4MA 3OJLA 3GEPA 4G5QA 2QE7D 3KSRA 5HZHA 1IAVA 2WTNA 4LZZA 3AKZA 5DHAA 5T41A 5KDLA 2JFHA 1U2ZA 4ABTA 2E55A 5KKNB 5DBOA 5BNFA 3PQ5A 4UHBA 4W1SA 2JLWA 4K9NA 3D3NA 4Q4HB 3SYMA 1NQVA 4HDNA 5CG2A 1WMBA 4K9KA 4G9GA 5FOUA 4BNTA 5DHSA 5I7RA 3PX2A 4MYUA 1GILA 3P4XA 4GR9A 5FL7A 5EGSA 3P9KA 1M1XB 2B4YA 4G0UA 4H3VA 4AU1A 3MJDA 1T25A 1S89A 3I9V1 4HLUA 2ESRA 4AB1A 3ISJA 4H1VA 4RULA 3GWZA 2JHAA 3HPRA 3KR1A 4MGHA 2UZ3A 1CE8B 2V5AA 1YJCA 1GSIA 4OKSA 2H7CA 2FR1A 2OSBA 3A6GA 3OQBA 1M6HA 4FXOA 4HZUA 1CJCA 2PGAA 1ZINA 3K9LA 1QWOA 2FPIA 3PD7A 1ONPA 4QUJA 1LQ2A 5H80A 2VUUA 3H86A 2HA3A 3ZHBA 1C3OA 1XFDA 1AQLA 5ENDA 4A0HA 1FRFS 3SVZA 2R8BA 4QVKA 3HWX1 1BE0A 1SEPA 2HOQA 5BPFA 3GA0A 3WXMA 1D6JA 1JJIA 1HT0A 1W85A 3P2IA 4ZARA 4Q4JB 2GUWA 1O6CA 2KBFA 2VXOA 3UTCA 3VC7A 1KA9H 1A27A 3MF4A 4PYRA 4Y6QA 3CKLA 1XZDA 1VC2A 2B4AA 4FDTA 1LLQA 1ULTA 2BFNA 2Y99A 4RA9A 3WFZA 4AWAA 5I7EA 2CL0X 1D6MA 1XWIA 3EDQA 4Z8XA 3TRKA 3DMPA 3ZU3A 6REQA 4PYIA 1N6PA 1DIGA 4X00A 1BG6A 1BJRE 3ZQUA 1VJGA 1YJ5A 2QD2A 3V8MA 1USUA 3FCAA 1T8YA 1U5AA 1VKNA 1KIMA 1MT3A 1YUBA 3HCRA 3KLBA 4OU4A 2ZETA 5HZMA 2MYUA 1QIKA 3TH5A 3FOBA 3QNMA 4J16A 3P9ZA 2BBTA 2A9VA 2RHOA 3T1OA 4EYSA 3HXLA 4QG7A 4KQ9A 1K4KA 1TZ2A 4O63O 3N2KB 2IU0A 1KE2A 2J9ZB 2VF4X 1T5DX 3RAPR 4D41A 3PVSA 5I7OA 1NUPA 4GLFA 1STOA 4F3NA 3NM6B 3HN6A 1M2VA 4QT4A 2V3CC 3SYNA 3G59A 3V8QA 4O5OA 4D99A 5I4BA 4WFJA 5LZ5A 4BAUA 4TZ0A 2P2DA 3ETDA 4DUYB 2G04A 1YSCA 5ESWA 4BS9A 1FCJA 2XLCA 1DTEA 2XOEA 2JDIA 4JYBA 1NBME 1H69A 1EA7A 3NEYA 1O0SA 1LDMA 2WSBA 1DRUA 4MV3A 1JBQA 3THSA 1NGSA 3C6ZA 4MV5A 4O08A 4QGAA 4ZIRA 3OAAA 3JD1A 2JD1A 1DPFA 3ABIA 5TQVA 3QUSA 3SHTA 4EPYA 4BFZA 4EMSA 2COUA 3GT0A 4GW3A 1NVEA 2IYZA 1G3QA 1RRMA 2G40A 4KNWA 1GGJA 2E4AA 2R6R1 4L3VA 5CVEA 3WJAA 4H6XA 2PNJA 1QLJA 1XKXA 3GNSA 3BE6A 5DTJA 3DE0X 1Z7EA 1HMPA 2Q46A 4QM7A 3SD7A 2QXYA 5CCEA 2NUAB 1AA6A 2NO7A 1E2JA 3S2EA 1MDFA 3NUQA 4WOJA 3UA4A 5IW8A 4DIUA 1DGQA 1NOKA 1YZYA 1P7YA 2AEEA 1AIPA 2DUWA 3E03A 3GPDG 3NZEA 4YMVA 3V1LA 5TF4A 5B7PA 4FDAA 4DR5B 2YIDA 4E1AA 2PKYX 3ZY2A 3PC6A 4OI1A 3MJ4A 3COVA 5K0ZA 4JLAA 4YROA 4Q1EA 1VE3A 3D6JA 5SY6A 2HV8A 1QHFA 1SBQA 1ODSA 3HVHA 4OXQA 3SJBA 1NF9A 3VTAA 4C1NA 1NNSA 1WXDA 4PC3A 1N7JA 4EY4A 1TRKA 4JBHA 4FB5A 2B21A 2OG2A 1NN5A 4S04A 5FH9A 1Z68A 4MTLA 1UPUA 1UEXC 1ISHA 1RVDA 2QGZA 2G3YA 2GZ2A 1HE1C 4X97A 1TQ4A 2DPMA 4OLHA 4PO8A 4RKFA 5DU2A 1ZVMA 2C3OA 2X7XA 5ALTA 2Q28A 3G0OA 1EP3B 5GJWC 5JYCA 4P84A 1KP3A 3E22B 2EX0A 3C5VA 3JY6A 1XAHA 1P7VA 2R1VB 4FJ1A 4GQIA 2GBLC 3QVXA 2HMYB 1GUAA 5LZ8A 2R84A 2MMCA 1RWVA 4F92B 3LHIA 4YUYA 3I4LA 1D1QA 1YOVB 2IYFA 1JILA 1Q2UA 4INPA 4NZOA 1L4BA 4YP9A 1Y5LA 2JGAA 2AFIB 4LJ7A 5EPEA 4FYKA 3VZBA 1XUOA 4D9CA 2CF6A 4KZKA 2C82A 2GFQA 3MWFA 1M1YA 2WU0A 5L4LA 1T15A 4RENA 1E79D 2X14A 2Z30A 3KX2A 1NI4B 4DIKA 4EWLA 1U7DA 3UYLA 3ZZUA 5LBTA 5KJ6A 5AT1A 3TB6A 2PAAA 3NYQA 3WYFA 4MCJA 5HRAA 2YZGA 2P2SA 2G1UA 3U3JA 1DJMA 1MIOA 1DAFA 1N1EA 1NOIA 3O8RA 2Z9CA 5JCOA 2BTEA 2P2YA 1DBRA 2NTYC 2HFJA 3J81A 4IDNA 3KJZA 3JPWA 1U8AA 2HMWA 3FNFA 3MGGA 3HBLA 5KNBA 3EUEA 4E32A 3NATA 1V95A 5EIWA 2HRZA 3NHMA 2QTGA 3OFNA 1KZ1A 4J1TC 4X41A 3R0IA 3ORFA 3NJ8A 3GO4A 4MGYR 1H5QA 5E4JA 2Q4DA 1V4VA 4OMFG 2FFAA 2PBZA 3UJDA 2ZBGA 3DKVA 4N18A 6YASA 1GAQA 3L7KA 4OOFA 1ZJYA 1L1EA 4NC9A 3GJXC 1NHWA 2OO7A 3PYLA 1YQUA 2IIVA 2WJGA 4ZHQA 1DTWB 2CLSA 1N3YA 1N8SA 1X94A 1XPJA 4ZYWA 5LM3A 1VBKA 3L06A 4DLVA 4HADA 5AIBA 1OXSC 3EXEA 3E5MA 3QVTA 3OQNA 3CF4A 1ZUD1 5B3LA 2CJWB 3V4VB 5HF6A 2IE8A 2JDID 1ZOOA 5MF6A 2ZIWB 5DASA 2O19A 4BNLA 1BRMA 4DBVO 5KNDH 2YQ4A 3AO0B 2VXCA 2A5YB 3PBKA 5YASA 3VR4H 1ADGA 1NX9A 1IEQA 1HQDA 1QE5A 2IYRA 2OHHA 5C9ZA 1P1FA 3ESQA 3ZCVA 1BE8A 2AEJA 2BFEB 1I4DD 1X3SA 2PR2A 2Q0QA 1T10A 3KJIA 2AT1A 5TQ2A 4XKJA 4ZQFA 1RXSA 4UUPA 4LXIA 4EGJA 4FT2A 3AR3A 4FW8A 4OJTA 4WV3A 4OMUA 3IE0A 2M9MA 1P4GA 2XNJA 1DZIA 1Q6ZA 4LNUA 1MX9A 4TS3A 3K2BA 4LZLA 1FMJA 3FWYA 4FLEA 2C2XA 4ZVLA 1YNSA 4ZT4A 5CDFE 3Q7RA 4CEHB 1DEHA 2EBUA 1DBIA 3ANMA 2PH3A 4XPIB 3T9BA 3TG8A 1ZCBA 4JUBA 3BMXA 3OOWA 2AX4A 5KJ1A 1QH8B 2BONA 2CHEA 3DJFA 1CS0B 2WZCA 5J1TB 3GUZA 3MVEA 5LQKA 1GNTA 2CWDA 4Z51A 1OASA 3LXMA 3DD5A 3BWVA 4UQPA 3URMA 3ZWBA 1K6JA 2BKEA 3PRYA 3HA3A 4J0GA 1TM4E 4HKTA 2C04A 4LDQA 2E4UA 4FJ2A 2EDAA 2ATIA 4PAMA 2MWMA 3N6RA 1W88A 3L4SO 4G1BA 5K0BA 2DWCA 2WHPA 1V41E 1WP9A 3KFLA 3UMCA 1GPH1 4FU0A 3GUVA 1DTWA 1IFXA 4Y2JA 3DZBA 3W8NA 2UUCB 2WJ3A 3G85A 3IERA 5ILGA 4X64B 5BSWA 4TMZA 4X44A 3DEHA 5EQTA 5KQLA 1YB7A 3RC8A 2JG3A 1OH7A 4HLCA 1E2NA 2OCGA 2XCIA 4BNDB 3NHZA 4X90A 3MA0A 4CUJA 1IPHA 4NABA 4INOA 1ZD4A 2FX5A 4PQFA 1LU9A 4XR9A 5K99A 1II9A 2ZYTX 3MMNA 3G9QA 1OZHA 4PE5B 5EAIA 2VHXA 4DL9A 1YCDA 2F59A 2UUOA 1CUUA 1ZLYA 2W90A 2Y92A 1MHPA 4F04A 1XZIA 2L0XA 1NV9A 3DR3A 1VL0A 3I1YA 4ZYLA 4KWTA 4UMEA 2HXGA 1KR5A 1NUUA 4A8TA 2IVZA 4KWCA 1OXUA 3BWDD 1ZX1A 3JZDA 3UOAB 4C2AA 1QVVA 3GRUA 3R7FA 4E33A 4LQLA 1YTUA 3TM4A 1R00A 1ZM9A 5KKAA 2YFKA 4F56A 3Q87B 4R3NA 1TM2A 3O8NA 3ASYA 1Y6QA 4LHWA 3R3VA 1GITA 5AHWA 5JS6A 1QIHA 3KALA 4AZWA 3VDXA 2ONKA 3EH1A 3IR5A 3PJFA 4M7WA 6ABPA 2RBGA 4GUDA 3EPLA 4AY4A 3U7EB 5D86A 2J6BA 1XNGA 1DAPA 4HDMB 1WLYA 4RHYA 4AMZA 3ICQB 4KR3A 5E9JA 1BEEA 2FUG6 4KMRA 2RIPA 3OPYI 5DGCA 1P0IA 5B30A 1NBWB 5BVHA 3CZPA 3QYAA 3QE4A 4XM2A 3C3YA 2X8LA 1HR0B 3AU8A 1UMCA 1FQKA 3HSKA 2WE8A 5DNYB 3GHHA 2F55A 1C9EA 1D9ZA 3ZQ6A 5JPDA 3H1EA 1ZUNB 3OCVA 1QYWA 4YO7A 3HA2A 3OOSA 3OSZA 3Q2IA 4RVCA 3BXEA 2YC2C 3L1JA 1N6LA 1G2OA 3I12A 2QN9A 4KV9A 1OXBB 5JISA 3HMKA 4BAGA 5BO5A 3QOFA 4ZYUA 2QL6A 2H54A 5JEDA 3GRRA 3WL4A 3KQUA 2AQIA 3FG9A 4XWAA 3VJRA 3IJRA 3R44A 4QYSA 4EEXA 1C7EA 1R9MA 3EZ9A 3PFCA 4HWPA 3B8EA 2GASA 4TT8A 2OXEA 1JWBB 2GDZA 3PV0A 1JHVA 2ZSHA 3T0FA 3UGQA 1EVZA 2HADA 2R44A 3CX8A 1TO2E 4WJKB 3C1AA 5NLLA 3NNDA 5IBQA 2UVQA 3RODA 4II2A 3UQZA 4B2YA 5LXTB 1LNQA 4IOJA 1V5GA 2ZSIA 1Z6PA 3QBJA 3WLSA 2J09A 3GYBA 5TQJA 1QFMA 3E6AA 1K5PA 4FIZA 4KVFA 2OGUA 2G9UA 3PQ7A 1RWKA 3OKPA 4NV0A 3Q3HA 3RW9A 4DIBA 3U1VA 2IHBA 4G81A 1TM5E 2WMNB 4C0JA 1M6EX 2K5UA 1CUAA 2XNDA 4X7RA 4NENA 1EVKA 4NS4A 1VOTA 2C2WA 2NUTB 2D8MA 2WJJA 3V1UA 3V4PB 2WYOA 3WNDA 1MO5A 4ALNA 5JBQA 4AO8A 5LIRA 4GPEA 3R7WB 2O50A 4O1HA 2AOWA 3GDWA 4N0DA 4XYMA 3B2QA 3UT6A 5L9AA 1FQOA 1U0NA 3UWSA 1LPPA 1BU5A 5ES3A 1CUSA 3R2JA 4CIAA 4IS3A 1KYYA 1GR1A 4RW0A 3IQFA 2FWBA 1NIJA 2XQGA 3AUSA 3HYCA 1N2SA 1QMPA 3X2EA 2HAEA 1NBEA 2NQTA 3CHYA 1TM1E 1XK7A 1FNMA 3GBPA 1NYTA 4WXEA 3BILA 3SF8B 1N5IA 2HQSA 3MG9A 3U19A 2WHXA 4AKTA 4KBYA 5CAEB 3NHBA 1VL8A 3L7IA 3N2YA 3QGMA 3S2GA 2JGRA 4LJ5A 4AW9A 3RBAA 5KYYB 1Z29A 2I9PA 1UBSB 3FWNA 4P93A 4ZRMA 4QVIA 4YYEA 4QWMA 4QASA 1ADJA 3EVFA 4LTDA 1Z4LA 3D4BA 4IDBA 1UEIA 3HA7A 4QUGA 2DR0A 2VT6A 1K97A 3DV9A 1G19A 1TEXA 2O1WA 1SC1A 2NUPA 2HM7A 2QLLA 1GUZA 3HYLA 5GZ3A 3AL3A 5ALKA 3HJAA 3LO8A 4C5BA 2DHEA 1KORA 1VIYA 3GJ6A 1KVQA 3PLNA 1KI6B 4DHEA 4KSBA 3KJNA 1QQAA 3UC9A 4XVHA 1G9XA 1U8FO 1J22A 4OSPA 4LJRA 3BG5A 1A4RA 3IKLA 4XB2A 3G2PA 1Y8ZA 3W05A 4HI0E 3OTOB 2IUSA 2BR3A 4EKNB 1F48A 3AFNA 2QN8A 3K8ZA 4UTZA 1XMJA 5K8TA 2GT1A 3AUKA 3IVCA 1WSWA 1Q6YA 1P8JA 2OBFA 3F74A 3WYNA 1NT4A 4DRXA 4CF5A 3EQ2A 3GVHA 2OQVA 3T1VA 3L43A 1JSRA 3DEIA 3U3KA 2PZKA 3MYYA 2FW6A 1RU3A 4RE5A 2FN8A 5KI6A 3BSYA 4R8KA 1UMDB 1ICIA 2IHTA 3KVYA 4XJTA 2E4WA 2IZ5A 4UNNA 2PMFA 1MXFA 2KLBA 3F7MA 4WADA 3DNMA 1NT2A 3DFMA 4RD0A 5LNK1 4UM8B 2XB8A 5IC5A 3DDCA 4QKQA 1PJ3A 3AB3A 1X80B 1Z5OA 1XRNA 4ZXFA 2WAXA 3TNFA 2VQEB 2VK1A 4IHJA 1Y3CE 2VCHA 1E63A 4YCAA 5KAPA 2QJRA 1NR5A 2QAGC 4HDAA 3DZDA 4E11A 2M98A 1BVYF 3FKSD 3IBTA 3MTAA 4FZVA 1IXRC 3E9ZA 1SD5A 2HCRA 3AUUA 1Q1NA 4OF4A 5EERA 3WNZA 1ZD5A 3REOA 3OLYA 2H1RA 2NV2B 3LQRA 4ZO4A 5TT1A 1EDDA 4CDGA 3KWJA 2JLVA 2XUJA 4NQZA 5B1HA 1PJTA 1L2TA 3MB8A 4UEWA 2ZXFA 4K87A 1SUSA 3M33A 4N48A 5DNCA 1ZGCA 1DWOA 2N42A 3PXAA 4TV9A 2YMLA 1UBCA 2WIDA 2H51A 2ZI5A 2G4VA 1CEXA 2R1ZA 1BFUA 3OT4A 2C9YA 3QMMA 4NWIA 2OFFA 1KMHB 4R1NA 2HRRA 4B3TB 1ESCA 1N6IA 4OQPA 4X91A 2C7QA 2WT4A 1G7CA 3EEYA 3RJZA 3W4JA 2FGKA 3QG5A 2DE0X 4MVJG 5DT2A 5BNTA 5LJLA 3PD1A 2UUBB 1NVTA 4QE3A 1POXA 4AY5A 4YRSA 3U4CA 2Z95A 2F43A 3FVVA 5U9CA 4MSUA 3F97A 2F3SA 3L0ZA 4YRRA 3WHPA 3RIMA 4JI8B 1G2PA 1V1MA 1E2PA 2PX2A 3TSYA 4PS0A 1I6LA 4FDLA 3PNLA 4N5LA 3W9BA 4R1LA 4I3HA 2QUAA 6REQB 2W8ZA 1QM5A 5KQMA 1MABB 1D4ZA 2ZSFA