4FJSA

Crystal structure of ureidoglycolate dehydrogenase enzyme in apo form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
337
structure length
337
Chain Sequence
MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycolate dehydrogenase
publication title Structural and functional insights into (s)-ureidoglycolate dehydrogenase, a metabolic branch point enzyme in nitrogen utilization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 109
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 1.1.1.154: Ureidoglycolate dehydrogenase.
pdb deposition date 2012-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 4fjsA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 4fjsA02
2X06A 4H8AA 4FJUA 2CWHA 2G8YA 3I0PA 1NXUA 2CWFA 1S20A 1WTJA 1VBIA 1Z2IA 1X0AA 4FJSA 3UOEA 1XRHA 1V9NA
chains in the Genus database with same CATH superfamily
4H8AA 4DR2H 4GKJH 4LF7H 4JVHA 2K1HA 4DV4H 2UUCH 1V8CA 2M8WA 4DV5H 2JEBI 1DTJA 3J81W 5LL6b 4BA1I 2UUAH 4DR7H 1ZZKA 1S20A 4QMFB 4KHPH 4JV5H 1XMOH 4X65H 2M6QA 1XNQH 4JI7H 2Y3MA 2ZQEA 2LTLA 4E9JA 4NXMH 3QD7X 2UU9H 4JI4H 4AM3A 1X4MA 2FPHX 5C0XG 1IBLH 2E5LH 2A1SA 4LF6H 1FJGH 1HNWH 1XMQH 4LFCH 4FJUA 1DT4A 4YY3H 4NBQA 4JI8H 3NCVA 4BA2I 4NZTM 2CTJA 2CPQA 2CTLA 2OPVA 3KDGA 3RF2A 3JAMW 2ZM6H 4DUYH 3OTOH 1MSZA 4G08A 2PQUA 4JYAH 1WTJA 1N36H 4FJSA 3EZJA 1IBMH 2UXCH 1WHRA 1S03G 4DR3H 1VIGA 4LF9H 1XNRH 1NXUA 2ANNA 2UXDH 4OO1G 2PY9A 1K1GA 2O4CA 1V9NA 4X66H 2HHHH 1J5EH 3J7AK 2DGRA 1X4NA 4EC5A 4DR4H 2VQEH 3FAUA 4PDBA 1VBIA 2PT7G 4OD6A 3SB1A 4JI1H 2F4VH 4DR6H 1HR0H 4NXNH 2UXBH 2CTFA 1AN7A 4JI5H 5BR8H 2VKCA 4DV2H 3OETA 1I94H 2NN6G 4B3RH 2HH2A 1J4WA 1HNZH 4JVYA 4LF4H 4IFDG 1TUAA 1UG8A 3U1KA 3GABA 4DV0H 1N32H 2FMRA 3AEVB 5JEAG 1ZZIA 1ODHA 2QNDA 4LF5H 2JA9A 1SEIA 2ANRA 4LF8H 2P2RA 2JEAI 3I0PA 3UOEA 5A2QW 1VIHA 5LMUH 1N33H 2LRRA 2LTMA 3V69A 2CTMA 4B3SH 1WE8A 4YHHH 4B8CD 4DR5H 2AXYA 4X64H 4JI6H 2LF0A 2CWHA 3J80W 3GR5A 4DV7H 2OPUA 4LFAH 1I6UA 4DR1H 1F0XA 3GKUA 4NZRM 1PQXA 4AIMA 4DV1H 3OSSD 2CPMA 2CTKA 2VQFH 2Z0SA 4DV3H 3VKEA 1J5KA 4WALA 2YQRA 4B3TH 5K36G 4OX9H 5IT9W 4B8TA 2JE6I 4LIJA 5LMNH 2MJHA 1KHMA 2E3UA 4X62H 1N34H 2D9IA 2CTEA 1FKAH 2JVZA 2HH3A 4OCHA 5DT9A 3T1HH 4JI0H 2G8YA 5IWAH 4GKKH 1ZZJA 1ZTGA 3KDKA 4DUZH 2BA0A 4K0KH 2JZXA 4JI2H 2X06A 5FLXW 1HNXH 4AQYH 3T1YH 4JI3H 2FFMA 4LFBH 4B3MH 4WANA 3L7ZC 1Z2IA 1X9ZA 1X0AA 1IBKH 2UUBH 1XRHA 4DV6H 1EC6A 2CWFA 1WVNA 2BL5A
chains in the Genus database with same CATH topology
2X06A 4H8AA 4FJUA 2CWHA 2G8YA 3I0PA 1NXUA 2CWFA 1S20A 1WTJA 1VBIA 1Z2IA 1X0AA 4FJSA 3UOEA 1XRHA 1V9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X06 A;  4H8A A;  4FJU A;  2CWH A;  2G8Y A;  3I0P A;  1NXU A;  2CWF A;  1S20 A;  1WTJ A;  1VBI A;  1Z2I A;  1X0A A;  4FJS A;  3UOE A;  1XRH A;  1V9N A; 
#chains in the Genus database with same CATH topology
 4H8A A;  4DR2 H;  4GKJ H;  4LF7 H;  4JVH A;  2K1H A;  4DV4 H;  2UUC H;  1V8C A;  2M8W A;  4DV5 H;  2JEB I;  1DTJ A;  3J81 W;  5LL6 b;  4BA1 I;  2UUA H;  4DR7 H;  1ZZK A;  1S20 A;  4QMF B;  4KHP H;  4JV5 H;  1XMO H;  4X65 H;  2M6Q A;  1XNQ H;  4JI7 H;  2Y3M A;  2ZQE A;  2LTL A;  4E9J A;  4NXM H;  3QD7 X;  2UU9 H;  4JI4 H;  4AM3 A;  1X4M A;  2FPH X;  5C0X G;  1IBL H;  2E5L H;  2A1S A;  4LF6 H;  1FJG H;  1HNW H;  1XMQ H;  4LFC H;  4FJU A;  1DT4 A;  4YY3 H;  4NBQ A;  4JI8 H;  3NCV A;  4BA2 I;  4NZT M;  2CTJ A;  2CPQ A;  2CTL A;  2OPV A;  3KDG A;  3RF2 A;  3JAM W;  2ZM6 H;  4DUY H;  3OTO H;  1MSZ A;  4G08 A;  2PQU A;  4JYA H;  1WTJ A;  1N36 H;  4FJS A;  3EZJ A;  1IBM H;  2UXC H;  1WHR A;  1S03 G;  4DR3 H;  1VIG A;  4LF9 H;  1XNR H;  1NXU A;  2ANN A;  2UXD H;  4OO1 G;  2PY9 A;  1K1G A;  2O4C A;  1V9N A;  4X66 H;  2HHH H;  1J5E H;  3J7A K;  2DGR A;  1X4N A;  4EC5 A;  4DR4 H;  2VQE H;  3FAU A;  4PDB A;  1VBI A;  2PT7 G;  4OD6 A;  3SB1 A;  4JI1 H;  2F4V H;  4DR6 H;  1HR0 H;  4NXN H;  2UXB H;  2CTF A;  1AN7 A;  4JI5 H;  5BR8 H;  2VKC A;  4DV2 H;  3OET A;  1I94 H;  2NN6 G;  4B3R H;  2HH2 A;  1J4W A;  1HNZ H;  4JVY A;  4LF4 H;  4IFD G;  1TUA A;  1UG8 A;  3U1K A;  3GAB A;  4DV0 H;  1N32 H;  2FMR A;  3AEV B;  5JEA G;  1ZZI A;  1ODH A;  2QND A;  4LF5 H;  2JA9 A;  1SEI A;  2ANR A;  4LF8 H;  2P2R A;  2JEA I;  3I0P A;  3UOE A;  5A2Q W;  1VIH A;  5LMU H;  1N33 H;  2LRR A;  2LTM A;  3V69 A;  2CTM A;  4B3S H;  1WE8 A;  4YHH H;  4B8C D;  4DR5 H;  2AXY A;  4X64 H;  4JI6 H;  2LF0 A;  2CWH A;  3J80 W;  3GR5 A;  4DV7 H;  2OPU A;  4LFA H;  1I6U A;  4DR1 H;  1F0X A;  3GKU A;  4NZR M;  1PQX A;  4AIM A;  4DV1 H;  3OSS D;  2CPM A;  2CTK A;  2VQF H;  2Z0S A;  4DV3 H;  3VKE A;  1J5K A;  4WAL A;  2YQR A;  4B3T H;  5K36 G;  4OX9 H;  5IT9 W;  4B8T A;  2JE6 I;  4LIJ A;  5LMN H;  2MJH A;  1KHM A;  2E3U A;  4X62 H;  1N34 H;  2D9I A;  2CTE A;  1FKA H;  2JVZ A;  2HH3 A;  4OCH A;  5DT9 A;  3T1H H;  4JI0 H;  2G8Y A;  5IWA H;  4GKK H;  1ZZJ A;  1ZTG A;  3KDK A;  4DUZ H;  2BA0 A;  4K0K H;  2JZX A;  4JI2 H;  2X06 A;  5FLX W;  1HNX H;  4AQY H;  3T1Y H;  4JI3 H;  2FFM A;  4LFB H;  4B3M H;  4WAN A;  3L7Z C;  1Z2I A;  1X9Z A;  1X0A A;  1IBK H;  2UUB H;  1XRH A;  4DV6 H;  1EC6 A;  2CWF A;  1WVN A;  2BL5 A; 
#chains in the Genus database with same CATH homology
 2X06 A;  4H8A A;  4FJU A;  2CWH A;  2G8Y A;  3I0P A;  1NXU A;  2CWF A;  1S20 A;  1WTJ A;  1VBI A;  1Z2I A;  1X0A A;  4FJS A;  3UOE A;  1XRH A;  1V9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...