4FJSA

Crystal structure of ureidoglycolate dehydrogenase enzyme in apo form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
337
structure length
337
Chain Sequence
MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ureidoglycolate dehydrogenase
publication title Structural and functional insights into (s)-ureidoglycolate dehydrogenase, a metabolic branch point enzyme in nitrogen utilization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 109
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 1.1.1.154: Ureidoglycolate dehydrogenase.
pdb deposition date 2012-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 4fjsA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 4fjsA02
2X06A 4FJUA 1S20A 2G8YA 1VBIA 1XRHA 3UOEA 1NXUA 1V9NA 1Z2IA 2CWHA 4H8AA 3I0PA 1WTJA 2CWFA 4FJSA 1X0AA
chains in the Genus database with same CATH superfamily
2NN6G 4JVYA 2G8YA 5FLXW 3OSSD 4OCHA 1XNQH 3AEVB 4GKJH 1XMQH 2CWHA 2BA0A 4DV4H 2AXYA 1WTJA 2VQFH 2Z0SA 1TUAA 4LIJA 2BL5A 5IT9W 3L7ZC 2CTMA 2VQEH 2UU9H 1F0XA 3NCVA 4X66H 1EC6A 1KHMA 4G08A 3T1HH 1AN7A 3UOEA 4AQYH 3J81W 2QNDA 2DGRA 2PQUA 5IWAH 2E3UA 4DUZH 5A2QW 1DTJA 2CTJA 2CTFA 2FFMA 3T1YH 4JI8H 4OX9H 1WVNA 1FJGH 4LF6H 4DR3H 4PDBA 4WALA 2A1SA 4JI0H 1IBKH 4JVHA 4DV5H 1IBLH 4NZTM 4NZRM 4LF7H 2P2RA 2CPQA 2F4VH 4GKKH 2CWFA 3KDKA 1X0AA 3OETA 4X65H 3QD7X 4FJUA 5DT9A 2E5LH 2UUBH 2UXCH 1HNZH 4JI3H 3J7AK 4LF8H 1V8CA 1PQXA 4DR4H 4JI2H 4DR7H 4KHPH 2ANRA 1N36H 2YQRA 4B8TA 1XNRH 4DV3H 1VIGA 3GR5A 4B3MH 2ZM6H 2UUAH 4DUYH 2UUCH 4B3RH 2VKCA 1FKAH 1K1GA 1S03G 1DT4A 1N32H 5K36G 2HH2A 4QMFB 1HNXH 2LRRA 2JZXA 4X62H 3VKEA 3OTOH 5JEAG 1IBMH 4NXMH 1N34H 1HR0H 4OD6A 1J4WA 1UG8A 4JI7H 1J5KA 2PY9A 4WANA 1X9ZA 4DV6H 1XMOH 2OPVA 4K0KH 4JI1H 2ANNA 4YHHH 2JEAI 2CTEA 2M8WA 4NXNH 1VBIA 4LFCH 2CPMA 1V9NA 1WHRA 2K1HA 3U1KA 5BR8H 5LMNH 3I0PA 1ODHA 4LFAH 4AM3A 2JVZA 4DR5H 3GABA 3JAMW 2LTLA 4B8CD 2HH3A 1ZZKA 2UXDH 2X06A 2CTLA 2CTKA 5C0XG 1ZZJA 2OPUA 4JI5H 3V69A 4DR2H 4B3SH 4LF9H 4IFDG 4AIMA 3J80W 4BA1I 2M6QA 4JV5H 2JA9A 4LF4H 4B3TH 4H8AA 2O4CA 5LMUH 1HNWH 1X4NA 3RF2A 1N33H 4DR6H 4DV7H 4OO1G 4X64H 4LFBH 1J5EH 2UXBH 1ZTGA 4E9JA 2MJHA 4DR1H 1I94H 2JE6I 4DV1H 4JYAH 2ZQEA 4NBQA 4EC5A 4YY3H 3GKUA 1VIHA 2LF0A 4FJSA 4JI6H 1S20A 3EZJA 4DV0H 1X4MA 1XRHA 2LTMA 1WE8A 1Z2IA 2FPHX 2D9IA 1ZZIA 4BA2I 1MSZA 4DV2H 1SEIA 2Y3MA 2HHHH 2PT7G 3FAUA 2JEBI 1NXUA 2FMRA 3SB1A 1I6UA 4LF5H 3KDGA 4JI4H 5LL6b
chains in the Genus database with same CATH topology
2X06A 4FJUA 1S20A 2G8YA 1VBIA 1XRHA 3UOEA 1NXUA 1V9NA 1Z2IA 2CWHA 4H8AA 3I0PA 1WTJA 2CWFA 4FJSA 1X0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X06 A;  4FJU A;  1S20 A;  2G8Y A;  1VBI A;  1XRH A;  3UOE A;  1NXU A;  1V9N A;  1Z2I A;  2CWH A;  4H8A A;  3I0P A;  1WTJ A;  2CWF A;  4FJS A;  1X0A A; 
#chains in the Genus database with same CATH topology
 2NN6 G;  4JVY A;  2G8Y A;  5FLX W;  3OSS D;  4OCH A;  1XNQ H;  3AEV B;  4GKJ H;  1XMQ H;  2CWH A;  2BA0 A;  4DV4 H;  2AXY A;  1WTJ A;  2VQF H;  2Z0S A;  1TUA A;  4LIJ A;  2BL5 A;  5IT9 W;  3L7Z C;  2CTM A;  2VQE H;  2UU9 H;  1F0X A;  3NCV A;  4X66 H;  1EC6 A;  1KHM A;  4G08 A;  3T1H H;  1AN7 A;  3UOE A;  4AQY H;  3J81 W;  2QND A;  2DGR A;  2PQU A;  5IWA H;  2E3U A;  4DUZ H;  5A2Q W;  1DTJ A;  2CTJ A;  2CTF A;  2FFM A;  3T1Y H;  4JI8 H;  4OX9 H;  1WVN A;  1FJG H;  4LF6 H;  4DR3 H;  4PDB A;  4WAL A;  2A1S A;  4JI0 H;  1IBK H;  4JVH A;  4DV5 H;  1IBL H;  4NZT M;  4NZR M;  4LF7 H;  2P2R A;  2CPQ A;  2F4V H;  4GKK H;  2CWF A;  3KDK A;  1X0A A;  3OET A;  4X65 H;  3QD7 X;  4FJU A;  5DT9 A;  2E5L H;  2UUB H;  2UXC H;  1HNZ H;  4JI3 H;  3J7A K;  4LF8 H;  1V8C A;  1PQX A;  4DR4 H;  4JI2 H;  4DR7 H;  4KHP H;  2ANR A;  1N36 H;  2YQR A;  4B8T A;  1XNR H;  4DV3 H;  1VIG A;  3GR5 A;  4B3M H;  2ZM6 H;  2UUA H;  4DUY H;  2UUC H;  4B3R H;  2VKC A;  1FKA H;  1K1G A;  1S03 G;  1DT4 A;  1N32 H;  5K36 G;  2HH2 A;  4QMF B;  1HNX H;  2LRR A;  2JZX A;  4X62 H;  3VKE A;  3OTO H;  5JEA G;  1IBM H;  4NXM H;  1N34 H;  1HR0 H;  4OD6 A;  1J4W A;  1UG8 A;  4JI7 H;  1J5K A;  2PY9 A;  4WAN A;  1X9Z A;  4DV6 H;  1XMO H;  2OPV A;  4K0K H;  4JI1 H;  2ANN A;  4YHH H;  2JEA I;  2CTE A;  2M8W A;  4NXN H;  1VBI A;  4LFC H;  2CPM A;  1V9N A;  1WHR A;  2K1H A;  3U1K A;  5BR8 H;  5LMN H;  3I0P A;  1ODH A;  4LFA H;  4AM3 A;  2JVZ A;  4DR5 H;  3GAB A;  3JAM W;  2LTL A;  4B8C D;  2HH3 A;  1ZZK A;  2UXD H;  2X06 A;  2CTL A;  2CTK A;  5C0X G;  1ZZJ A;  2OPU A;  4JI5 H;  3V69 A;  4DR2 H;  4B3S H;  4LF9 H;  4IFD G;  4AIM A;  3J80 W;  4BA1 I;  2M6Q A;  4JV5 H;  2JA9 A;  4LF4 H;  4B3T H;  4H8A A;  2O4C A;  5LMU H;  1HNW H;  1X4N A;  3RF2 A;  1N33 H;  4DR6 H;  4DV7 H;  4OO1 G;  4X64 H;  4LFB H;  1J5E H;  2UXB H;  1ZTG A;  4E9J A;  2MJH A;  4DR1 H;  1I94 H;  2JE6 I;  4DV1 H;  4JYA H;  2ZQE A;  4NBQ A;  4EC5 A;  4YY3 H;  3GKU A;  1VIH A;  2LF0 A;  4FJS A;  4JI6 H;  1S20 A;  3EZJ A;  4DV0 H;  1X4M A;  1XRH A;  2LTM A;  1WE8 A;  1Z2I A;  2FPH X;  2D9I A;  1ZZI A;  4BA2 I;  1MSZ A;  4DV2 H;  1SEI A;  2Y3M A;  2HHH H;  2PT7 G;  3FAU A;  2JEB I;  1NXU A;  2FMR A;  3SB1 A;  1I6U A;  4LF5 H;  3KDG A;  4JI4 H;  5LL6 b; 
#chains in the Genus database with same CATH homology
 2X06 A;  4FJU A;  1S20 A;  2G8Y A;  1VBI A;  1XRH A;  3UOE A;  1NXU A;  1V9N A;  1Z2I A;  2CWH A;  4H8A A;  3I0P A;  1WTJ A;  2CWF A;  4FJS A;  1X0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...