4FJSA

Crystal structure of ureidoglycolate dehydrogenase enzyme in apo form
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
337
structure length
337
Chain Sequence
MKISRETLHQLIENKLCQAGLKREHAATVAEVLVYADARGIHSHGAVRVEYYAERISKGGTNREPEFRLEETGPCSAILHADNAAGQVAAKMGMEHAIKTAQQNGVAVVGISRMGHSGAISYFVQQAARAGFIGISMCQSDPMVVPFGGAEIYYGTNPLAFAAPGEGDEILTFDMATTVQAWGKVLDARSRNMSIPDTWAVDKNGVPTTDPFAVHALLPAAGPKGYGLMMMIDVLSGVLLGLPFGRQVSSMYDDLHAGRNLGQLHIVINPNFFSSSELFRQHLSQTMRELNAITPAPGFNQVYYPGQDQDIKQRKAAVEGIEIVDDIYQYLISDALY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional insights into (s)-ureidoglycolate dehydrogenase, a metabolic branch point enzyme in nitrogen utilization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
molecule keywords Ureidoglycolate dehydrogenase
total genus 109
structure length 337
sequence length 337
chains with identical sequence B
ec nomenclature ec 1.1.1.154: Ureidoglycolate dehydrogenase.
pdb deposition date 2012-06-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1530.10 Mainly Alpha Orthogonal Bundle Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 Hypothetical Oxidoreductase Yiak; Chain: A, domain 1 4fjsA01
3.30.1370.60 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 Hypothetical oxidoreductase yiak; domain 2 4fjsA02
1X0AA 1S20A 2X06A 4H8AA 1WTJA 2CWHA 4FJUA 1XRHA 4FJSA 1NXUA 1Z2IA 2G8YA 3I0PA 1VBIA 3UOEA 1V9NA 2CWFA
chains in the Genus database with same CATH superfamily
1MSZA 4X64H 3J7AK 3SB1A 1HNWH 1XMQH 2JZXA 1N34H 4DR7H 4WANA 1IBLH 3OTOH 4LF9H 1X4MA 4B3RH 4B8CD 2F4VH 4JI6H 4AQYH 2NN6G 4DV6H 5A2QW 2Y3MA 1ZZKA 3J80W 1PQXA 2QNDA 3J81W 2CTLA 4JYAH 4NXNH 1X9ZA 1WTJA 3NCVA 5IT9W 2G8YA 4EC5A 1J5KA 2A1SA 4LFCH 2CTFA 1SEIA 2HHHH 3L7ZC 4NBQA 2ANNA 4X62H 4JVHA 2VKCA 1FKAH 1UG8A 4JI0H 2CWHA 4X66H 3T1HH 3RF2A 4AIMA 4JI7H 5FLXW 2BL5A 4G08A 2E3UA 2FMRA 2OPVA 4DR2H 2PT7G 4QMFB 1V9NA 4JV5H 3GABA 2VQFH 1I94H 4FJSA 4DV3H 4JI8H 4JVYA 1N36H 4OD6A 4NZRM 4DUYH 1IBKH 4JI5H 2JEAI 1J4WA 2ZM6H 1WVNA 1HR0H 4DV5H 4DV7H 2X06A 3EZJA 2UUAH 4JI3H 4LF6H 2FFMA 4GKJH 2CTEA 4LFAH 2UUCH 1FJGH 2FPHX 2LRRA 4DR5H 2UU9H 4LF7H 3GKUA 4GKKH 2PQUA 1HNZH 1X4NA 3OETA 4DR1H 2YQRA 1NXUA 2P2RA 1Z2IA 2PY9A 2JEBI 3KDKA 2UXBH 1K1GA 5DT9A 4BA2I 1KHMA 4JI1H 2M6QA 1VIHA 4LIJA 5LMUH 5JEAG 1N32H 4B3TH 1V8CA 5LL6b 4DR4H 3I0PA 2D9IA 4DV2H 1X0AA 2ANRA 4H8AA 4FJUA 2AXYA 1HNXH 2OPUA 4JI2H 4BA1I 5K36G 1WE8A 2Z0SA 3JAMW 3QD7X 1TUAA 1VIGA 4OCHA 4OX9H 3T1YH 4AM3A 1XRHA 1XNRH 2HH3A 4YHHH 2CTKA 1DTJA 4DV0H 4B3SH 2MJHA 4NXMH 1I6UA 1WHRA 4K0KH 4PDBA 4X65H 4B8TA 2O4CA 3KDGA 4DV4H 2CTJA 1ZTGA 1XMOH 2CTMA 1VBIA 4IFDG 2CWFA 4WALA 2HH2A 2CPQA 2LF0A 5BR8H 3VKEA 2LTMA 1ZZIA 3OSSD 1S03G 4KHPH 2DGRA 5C0XG 4LF4H 3U1KA 1DT4A 3UOEA 4E9JA 2K1HA 4DUZH 4DR3H 4B3MH 1XNQH 1F0XA 2LTLA 3V69A 4LF5H 2UXCH 1IBMH 2CPMA 2JE6I 3FAUA 4YY3H 2ZQEA 1EC6A 2M8WA 5IWAH 2UUBH 1ZZJA 1S20A 3AEVB 2UXDH 4NZTM 4JI4H 2E5LH 1ODHA 4LFBH 1N33H 2JA9A 1J5EH 1AN7A 5LMNH 2BA0A 4DV1H 4OO1G 3GR5A 4DR6H 4LF8H 2JVZA 2VQEH
chains in the Genus database with same CATH topology
1X0AA 1S20A 2X06A 4H8AA 1WTJA 2CWHA 4FJUA 1XRHA 4FJSA 1NXUA 1Z2IA 2G8YA 3I0PA 1VBIA 3UOEA 1V9NA 2CWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X0A A;  1S20 A;  2X06 A;  4H8A A;  1WTJ A;  2CWH A;  4FJU A;  1XRH A;  4FJS A;  1NXU A;  1Z2I A;  2G8Y A;  3I0P A;  1VBI A;  3UOE A;  1V9N A;  2CWF A; 
#chains in the Genus database with same CATH topology
 1MSZ A;  4X64 H;  3J7A K;  3SB1 A;  1HNW H;  1XMQ H;  2JZX A;  1N34 H;  4DR7 H;  4WAN A;  1IBL H;  3OTO H;  4LF9 H;  1X4M A;  4B3R H;  4B8C D;  2F4V H;  4JI6 H;  4AQY H;  2NN6 G;  4DV6 H;  5A2Q W;  2Y3M A;  1ZZK A;  3J80 W;  1PQX A;  2QND A;  3J81 W;  2CTL A;  4JYA H;  4NXN H;  1X9Z A;  1WTJ A;  3NCV A;  5IT9 W;  2G8Y A;  4EC5 A;  1J5K A;  2A1S A;  4LFC H;  2CTF A;  1SEI A;  2HHH H;  3L7Z C;  4NBQ A;  2ANN A;  4X62 H;  4JVH A;  2VKC A;  1FKA H;  1UG8 A;  4JI0 H;  2CWH A;  4X66 H;  3T1H H;  3RF2 A;  4AIM A;  4JI7 H;  5FLX W;  2BL5 A;  4G08 A;  2E3U A;  2FMR A;  2OPV A;  4DR2 H;  2PT7 G;  4QMF B;  1V9N A;  4JV5 H;  3GAB A;  2VQF H;  1I94 H;  4FJS A;  4DV3 H;  4JI8 H;  4JVY A;  1N36 H;  4OD6 A;  4NZR M;  4DUY H;  1IBK H;  4JI5 H;  2JEA I;  1J4W A;  2ZM6 H;  1WVN A;  1HR0 H;  4DV5 H;  4DV7 H;  2X06 A;  3EZJ A;  2UUA H;  4JI3 H;  4LF6 H;  2FFM A;  4GKJ H;  2CTE A;  4LFA H;  2UUC H;  1FJG H;  2FPH X;  2LRR A;  4DR5 H;  2UU9 H;  4LF7 H;  3GKU A;  4GKK H;  2PQU A;  1HNZ H;  1X4N A;  3OET A;  4DR1 H;  2YQR A;  1NXU A;  2P2R A;  1Z2I A;  2PY9 A;  2JEB I;  3KDK A;  2UXB H;  1K1G A;  5DT9 A;  4BA2 I;  1KHM A;  4JI1 H;  2M6Q A;  1VIH A;  4LIJ A;  5LMU H;  5JEA G;  1N32 H;  4B3T H;  1V8C A;  5LL6 b;  4DR4 H;  3I0P A;  2D9I A;  4DV2 H;  1X0A A;  2ANR A;  4H8A A;  4FJU A;  2AXY A;  1HNX H;  2OPU A;  4JI2 H;  4BA1 I;  5K36 G;  1WE8 A;  2Z0S A;  3JAM W;  3QD7 X;  1TUA A;  1VIG A;  4OCH A;  4OX9 H;  3T1Y H;  4AM3 A;  1XRH A;  1XNR H;  2HH3 A;  4YHH H;  2CTK A;  1DTJ A;  4DV0 H;  4B3S H;  2MJH A;  4NXM H;  1I6U A;  1WHR A;  4K0K H;  4PDB A;  4X65 H;  4B8T A;  2O4C A;  3KDG A;  4DV4 H;  2CTJ A;  1ZTG A;  1XMO H;  2CTM A;  1VBI A;  4IFD G;  2CWF A;  4WAL A;  2HH2 A;  2CPQ A;  2LF0 A;  5BR8 H;  3VKE A;  2LTM A;  1ZZI A;  3OSS D;  1S03 G;  4KHP H;  2DGR A;  5C0X G;  4LF4 H;  3U1K A;  1DT4 A;  3UOE A;  4E9J A;  2K1H A;  4DUZ H;  4DR3 H;  4B3M H;  1XNQ H;  1F0X A;  2LTL A;  3V69 A;  4LF5 H;  2UXC H;  1IBM H;  2CPM A;  2JE6 I;  3FAU A;  4YY3 H;  2ZQE A;  1EC6 A;  2M8W A;  5IWA H;  2UUB H;  1ZZJ A;  1S20 A;  3AEV B;  2UXD H;  4NZT M;  4JI4 H;  2E5L H;  1ODH A;  4LFB H;  1N33 H;  2JA9 A;  1J5E H;  1AN7 A;  5LMN H;  2BA0 A;  4DV1 H;  4OO1 G;  3GR5 A;  4DR6 H;  4LF8 H;  2JVZ A;  2VQE H; 
#chains in the Genus database with same CATH homology
 1X0A A;  1S20 A;  2X06 A;  4H8A A;  1WTJ A;  2CWH A;  4FJU A;  1XRH A;  4FJS A;  1NXU A;  1Z2I A;  2G8Y A;  3I0P A;  1VBI A;  3UOE A;  1V9N A;  2CWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...